F397912

General Info

Members Datasets Scaffolds Average Seq Length
305 186 610 122

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10004987|Ga0065714_100049874
Length 114
Sequence MYERKIIPNLNCGFDLIGEVLFGKWKIRLLWFINEGHKRPSELQRKIPDASRRVLNIQLKEHELVTRKIFPVVSPKVEYSLTEFGRTLIPVIAALGQWGDENEVRLRDVILRQV

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
30 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
83 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
84 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
85 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
86 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
87 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
88 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
89 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
90 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
91 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
92 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
93 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
94 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
121 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
122 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
123 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
124 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
125 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
126 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
127 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
128 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
133 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
134 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
137 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
138 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
139 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
140 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
141 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
142 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
143 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
144 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
145 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
146 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
147 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
148 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
149 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
150 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
151 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
152 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
153 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
154 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
155 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
156 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
157 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
158 2738543023 Pedobacter sp. OK628 Isolate Unclassified
159 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
160 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
161 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
162 2818991437 Pedobacter terrae 518 Isolate Unclassified
163 2818991444 Filimonas endophytica 3197 Isolate Unclassified
164 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
165 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
166 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
167 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
168 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
169 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
170 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
171 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
172 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
173 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
174 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
175 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
176 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
177 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
178 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
179 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
180 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
181 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
182 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
183 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
184 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
185 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
186 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.92
Metatranscriptomes 0
Isolates 15.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.52
Nodule 0.98
Rhizoplane 3.93
Rhizosphere 65.25
Stem 0
Stem Tuber 0
Unclassified 3.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10004987 3300005288 Bacteria 4783
2 MRS2a_Contig_27592 2124908027 Bacteria 706
3 SwRhRL2b_contig_1494727 2162886007 Bacteria 34556
4 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
5 SwRhRL2b_contig_1674267 2162886007 Bacteria 1166
6 SwRhRL2b_contig_3711852 2162886007 Bacteria 997
7 SwRhRL2b_contig_3809335 2162886007 Bacteria 2343
8 JGI24739J22299_10002038 3300001989 Bacteria 7741
9 JGI25153J46596_10015700 3300003215 Bacteria 3070
10 rootH2_10119825 3300003320 Bacteria 1419
11 rootH2_10257166 3300003320 Bacteria 2704
12 rootL2_10075774 3300003322 Bacteria 9678
13 rootL2_10301526 3300003322 Bacteria 1299
14 rootH1_10045631 3300003323 Bacteria 5888
15 rootH1_10386488 3300003323 Bacteria 1678
16 JGI25160J50197_1000563 3300003354 Bacteria 20992
17 Ga0055526_1010199 3300003771 Bacteria 4402
18 Ga0065714_10003796 3300005288 Bacteria 20147
19 Ga0065714_10064427 3300005288 Bacteria 167245
20 Ga0065714_10073519 3300005288 Bacteria 3161
21 Ga0065714_10080498 3300005288 Bacteria 2436
22 Ga0065714_10081679 3300005288 Bacteria 2357
23 Ga0065714_10306401 3300005288 Bacteria 666
24 Ga0065704_10000205 3300005289 Bacteria 128899
25 Ga0065704_10070140 3300005289 Bacteria 482257
26 Ga0065704_10070204 3300005289 Bacteria 85748
27 Ga0065704_10072170 3300005289 Bacteria 9024
28 Ga0065704_10128087 3300005289 Bacteria 1667
29 Ga0065704_10167288 3300005289 Bacteria 1314
30 Ga0065704_10387836 3300005289 Bacteria 766
31 Ga0065704_10397535 3300005289 Bacteria 755
32 Ga0065704_10715843 3300005289 Bacteria 555
33 Ga0070683_100007078 3300005329 Bacteria 9447
34 Ga0070666_10981685 3300005335 Bacteria 626
35 Ga0068868_101155807 3300005338 Bacteria 714
36 Ga0070660_100108023 3300005339 Bacteria 2211
37 Ga0070668_100070644 3300005347 Unclassified 2718
38 Ga0070669_100187201 3300005353 Bacteria 1622
39 Ga0070688_101141229 3300005365 Bacteria 624
40 Ga0070700_100509409 3300005441 Bacteria 927
41 Ga0070678_101010651 3300005456 Bacteria 765
42 Ga0068867_100794472 3300005459 Unclassified 843
43 Ga0070684_100022335 3300005535 Bacteria 5276
44 Ga0070672_100521601 3300005543 Bacteria 1029
45 Ga0070672_101859574 3300005543 Bacteria 542
46 Ga0068857_100538767 3300005577 Bacteria 1099
47 Ga0068854_101153838 3300005578 Bacteria 692
48 Ga0068861_100042532 3300005719 Unclassified 3406
49 Ga0068862_100563940 3300005844 Bacteria 1089
50 Ga0075434_100864144 3300006871 Bacteria 920
51 Ga0099824_1028747 3300006942 Bacteria 2471
52 Ga0099826_10054564 3300006948 Bacteria 2652
53 Ga0105244_10018428 3300009036 Bacteria 3917
54 Ga0105244_10129640 3300009036 Bacteria 1217
55 Ga0105240_10451947 3300009093 Unclassified 1438
56 Ga0111539_11084477 3300009094 Bacteria 931
57 Ga0105243_10000143 3300009148 Bacteria 81998
58 Ga0105242_10382560 3300009176 Bacteria 1309
59 Ga0105237_10884734 3300009545 Unclassified 900
60 Ga0157373_10000290 3300013100 Bacteria 40415
61 Ga0157373_10132518 3300013100 Bacteria 1752
62 Ga0157373_10534036 3300013100 Bacteria 849
63 Ga0157371_10000438 3300013102 Bacteria 51021
64 Ga0157371_10004549 3300013102 Bacteria 12073
65 Ga0157371_10018094 3300013102 Bacteria 5217
66 Ga0157371_10046965 3300013102 Bacteria 3069
67 Ga0157371_10076584 3300013102 Bacteria 2369
68 Ga0157371_10527690 3300013102 Bacteria 874
69 Ga0157370_10000026 3300013104 Bacteria 152092
70 Ga0157370_10001117 3300013104 Bacteria 33565
71 Ga0157370_10001781 3300013104 Bacteria 26566
72 Ga0157370_10004705 3300013104 Bacteria 15554
73 Ga0157370_10005399 3300013104 Bacteria 14338
74 Ga0157370_10016660 3300013104 Bacteria 7437
75 Ga0157370_10054513 3300013104 Bacteria 3811
76 Ga0157370_10057388 3300013104 Bacteria 3702
77 Ga0157370_10262405 3300013104 Bacteria 1596
78 Ga0157370_10635284 3300013104 Bacteria 976
79 Ga0157369_10001230 3300013105 Bacteria 31909
80 Ga0157369_10001456 3300013105 Bacteria 29016
81 Ga0157369_10369478 3300013105 Bacteria 1489
82 Ga0157374_11323801 3300013296 Bacteria 742
83 Ga0163162_10169759 3300013306 Bacteria 2306
84 Ga0163162_10442197 3300013306 Bacteria 1432
85 Ga0157375_10002170 3300013308 Bacteria 16959
86 Ga0163163_10085682 3300014325 Bacteria 3159
87 Ga0157380_10163040 3300014326 Bacteria 1940
88 Ga0182008_10000008 3300014497 Bacteria 371823
89 Ga0182008_10000029 3300014497 Bacteria 176649
90 Ga0182008_10000540 3300014497 Bacteria 28126
91 Ga0182006_1000012 3300015261 Bacteria 394239
92 Ga0182006_1000407 3300015261 Bacteria 34782
93 Ga0182006_1000824 3300015261 Bacteria 20784
94 Ga0182006_1001429 3300015261 Bacteria 14457
95 Ga0182006_1129081 3300015261 Bacteria 871
96 Ga0182007_10000007 3300015262 Bacteria 376596
97 Ga0182007_10399482 3300015262 Bacteria 524
98 Ga0163161_10012141 3300017792 Bacteria 5975
99 Ga0163161_10021761 3300017792 Bacteria 4509
100 Ga0163161_10055400 3300017792 Bacteria 2878
101 Ga0163161_10155166 3300017792 Bacteria 1742
102 Ga0163161_10325589 3300017792 Bacteria 1216
103 Ga0163161_10498903 3300017792 Bacteria 991
104 Ga0163161_10747065 3300017792 Bacteria 818
105 Ga0209673_1027375 3300025273 Bacteria 1855
106 Ga0209675_1000200 3300025291 Bacteria 63684
107 Ga0209564_1001302 3300025295 Bacteria 26894
108 Ga0209564_1008207 3300025295 Bacteria 5210
109 Ga0209758_1000465 3300025297 Bacteria 67058
110 Ga0209758_1004804 3300025297 Bacteria 10915
111 Ga0207426_1000170 3300025302 Bacteria 164216
112 Ga0207426_1007198 3300025302 Bacteria 4692
113 Ga0207655_1142020 3300025728 Bacteria 769
114 Ga0207647_10396131 3300025904 Bacteria 778
115 Ga0207657_10179939 3300025919 Bacteria 1709
116 Ga0207686_10223616 3300025934 Bacteria 1361
117 Ga0207709_10000184 3300025935 Bacteria 83205
118 Ga0207661_10004923 3300025944 Bacteria 9364
119 Ga0207668_10080555 3300025972 Unclassified 2359
120 Ga0207640_11138041 3300025981 Bacteria 692
121 Ga0207708_11116723 3300026075 Bacteria 688
122 Ga0207648_11389920 3300026089 Bacteria 660
123 Ga0207674_10169881 3300026116 Bacteria 2134
124 Ga0207675_100039765 3300026118 Unclassified 4389
125 Ga0207683_10198183 3300026121 Bacteria 1825
126 Ga0209282_1064202 3300027666 Bacteria 2031
127 Ga0268265_10436790 3300028380 Bacteria 1219
128 Ga0307517_10098696 3300028786 Bacteria 2322
129 Ga0307515_10101159 3300028794 Bacteria 3482
130 Ga0307515_10172385 3300028794 Bacteria 2150
131 Ga0307515_10276005 3300028794 Bacteria 1394
132 Ga0307515_10912960 3300028794 Bacteria 510
133 Ga0316181_1235503 3300030744 Unclassified 2420
134 Ga0307408_100716636 3300031548 Bacteria 901
135 Ga0307405_10000002 3300031731 Bacteria 575196
136 Ga0307405_10104247 3300031731 Bacteria 1908
137 Ga0307413_10000195 3300031824 Bacteria 17593
138 Ga0307413_10000257 3300031824 Bacteria 16055
139 Ga0307413_10208906 3300031824 Bacteria 1416
140 Ga0307406_10021092 3300031901 Bacteria 3849
141 Ga0307406_10226658 3300031901 Bacteria 1393
142 Ga0307412_10000007 3300031911 Bacteria 486267
143 Ga0307412_10000023 3300031911 Bacteria 237005
144 Ga0307412_10141768 3300031911 Bacteria 1761
145 Ga0307412_11041314 3300031911 Bacteria 725
146 Ga0307409_101344359 3300031995 Bacteria 740
147 Ga0307416_100022743 3300032002 Bacteria 4533
148 Ga0307414_10000046 3300032004 Bacteria 133496
149 Ga0307414_10000234 3300032004 Bacteria 35611
150 Ga0307414_10001191 3300032004 Bacteria 13367
151 Ga0307414_10010050 3300032004 Bacteria 5467
152 Ga0307414_10020298 3300032004 Bacteria 4139
153 Ga0307414_10023635 3300032004 Bacteria 3902
154 Ga0307414_10042786 3300032004 Unclassified 3080
155 Ga0307414_10048363 3300032004 Bacteria 2933
156 Ga0307414_10049682 3300032004 Bacteria 2901
157 Ga0307414_10072068 3300032004 Bacteria 2494
158 Ga0307414_10100495 3300032004 Bacteria 2176
159 Ga0307414_10104735 3300032004 Bacteria 2137
160 Ga0307414_10113981 3300032004 Bacteria 2064
161 Ga0307414_10362663 3300032004 Bacteria 1247
162 Ga0307414_11332698 3300032004 Bacteria 666
163 Ga0307414_11842459 3300032004 Bacteria 564
164 Ga0307414_12230993 3300032004 Bacteria 511
165 Ga0307414_12317008 3300032004 Bacteria 501
166 Ga0307411_10000001 3300032005 Bacteria 931810
167 Ga0307411_10001224 3300032005 Bacteria 10202
168 Ga0307411_10387175 3300032005 Bacteria 1152
169 Ga0439447_002887 3300041407 Bacteria 6157
170 Ga0439466_0003192 3300041411 Bacteria 6379
171 Ga0439465_0000291 3300041413 Bacteria 14146
172 Ga0451791_1831943 3300041451 Bacteria 842
173 Ga0451793_1611631 3300041452 Bacteria 667
174 Ga0451797_0904053 3300041453 Bacteria 1010
175 Ga0451802_0498939 3300041460 Bacteria 702
176 Ga0451806_492651 3300041462 Bacteria 532
177 Ga0451804_0478562 3300041463 Bacteria 597
178 Ga0451807_1592854 3300041486 Bacteria 700
179 Ga0451807_1818166 3300041486 Bacteria 797
180 Ga0451841_0152411 3300041498 Bacteria 545
181 Ga0439457_006624 3300042014 Bacteria 2822
182 Ga0450905_047271 3300042142 Bacteria 695
183 Ga0466965_0045449 3300044683 Bacteria 2172
184 Ga0466965_0192204 3300044683 Bacteria 1080
185 Ga0466961_0937384 3300044693 Bacteria 515
186 Ga0466959_0159335 3300045049 Bacteria 1587
187 Ga0495590_0015883 3300046457 Bacteria 2724
188 Ga0495610_0000001 3300046512 Bacteria 1620061
189 Ga0495610_0000009 3300046512 Bacteria 554843
190 Ga0495630_0244592 3300046517 Bacteria 1371
191 Ga0495632_0001272 3300046519 Bacteria 21347
192 Ga0495648_0462216 3300046524 Bacteria 552
193 Ga0495633_0000644 3300046558 Bacteria 32447
194 Ga0495633_0006190 3300046558 Bacteria 7150
195 Ga0495625_0001008 3300046660 Bacteria 37194
196 Ga0495625_0005112 3300046660 Bacteria 12136
197 Ga0496102_0029807 3300048905 Bacteria 4883
198 Ga0496104_0306687 3300048907 Bacteria 1500
199 Ga0496113_0047478 3300048916 Bacteria 3191
200 Ga0496115_0008453 3300048918 Bacteria 7615
201 Ga0496116_0000079 3300048919 Bacteria 226744
202 Ga0496116_0000452 3300048919 Bacteria 57179
203 Ga0496116_0012674 3300048919 Bacteria 6861
204 Ga0496117_0000023 3300048920 Bacteria 438585
205 Ga0496117_0006327 3300048920 Bacteria 12046
206 Ga0496118_0000564 3300048921 Bacteria 61236
207 Ga0496118_0035804 3300048921 Bacteria 4023
208 Ga0496118_0369449 3300048921 Bacteria 757
209 Ga0496119_0000010 3300048922 Bacteria 438534
210 Ga0496120_0065676 3300048923 Bacteria 2009
211 Ga0496121_0172374 3300048924 Bacteria 1570
212 Ga0496122_0000166 3300048925 Bacteria 157284
213 Ga0496122_0001690 3300048925 Bacteria 34216
214 Ga0496122_0020853 3300048925 Bacteria 5894
215 Ga0496122_0043435 3300048925 Bacteria 3521
216 Ga0496123_0006328 3300048926 Bacteria 11502
217 Ga0496123_0011253 3300048926 Bacteria 7779
218 Ga0496123_0041947 3300048926 Bacteria 3165
219 Ga0496124_0028700 3300048927 Bacteria 4973
220 Ga0496124_0044686 3300048927 Bacteria 3799
221 Ga0496124_0145153 3300048927 Bacteria 1868
222 Ga0496124_0160333 3300048927 Bacteria 1754
223 Ga0496124_0214128 3300048927 Bacteria 1455
224 Ga0496125_0000675 3300048928 Bacteria 56932
225 Ga0496125_0007729 3300048928 Bacteria 11389
226 Ga0496125_0038061 3300048928 Bacteria 4171
227 Ga0496126_0002974 3300048929 Bacteria 21999
228 Ga0496126_0029326 3300048929 Bacteria 5228
229 Ga0496126_0192145 3300048929 Bacteria 1728
230 Ga0496126_0374087 3300048929 Bacteria 1161
231 Ga0496126_0552085 3300048929 Bacteria 914
232 Ga0501300_022551 3300049523 Bacteria 920
233 Ga0501235_031397 3300049669 Bacteria 1200
234 Ga0501235_171192 3300049669 Bacteria 574
235 Ga0501238_056809 3300049671 Bacteria 593
236 Ga0501247_001333 3300049677 Unclassified 2346
237 Ga0501251_000487 3300049681 Bacteria 3535
238 Ga0501241_000789 3300049758 Bacteria 6707
239 Ga0501241_017920 3300049758 Bacteria 1296
240 Ga0501266_000005 3300049763 Bacteria 346750
241 Ga0501269_000030 3300049766 Bacteria 45680
242 Ga0501204_085366 3300049850 Bacteria 543
243 nmdc:mga07m45_369740_c1 3300050496 Bacteria 833
244 nmdc:mga0rr50_1742962_c1 3300050513 Bacteria 525
245 nmdc:mga0a205_1549367_c1 3300050515 Bacteria 511
246 Ga0500644_0039229 3300053088 Bacteria 1560
247 Ga0500646_0003133 3300053090 Bacteria 4245
248 Ga0500566_0311193 3300053094 Bacteria 737
249 Ga0500641_0000009 3300053096 Bacteria 173260
250 Ga0500556_0115192 3300053104 Bacteria 1045
251 Ga0500594_0087624 3300053118 Bacteria 940
252 Ga0500655_001054 3300053133 Bacteria 5309
253 Ga0500658_0000003 3300053134 Bacteria 512506
254 Ga0500573_0418450 3300053140 Bacteria 629
255 Ga0500588_0000391 3300053146 Bacteria 6835
256 Ga0500590_358003 3300053148 Bacteria 518
257 Ga0500616_0033759 3300053153 Bacteria 2790
258 Ga0500622_0000162 3300053156 Bacteria 70682
259 Ga0500622_0000340 3300053156 Bacteria 45986
260 2520879134 2519899754 Bacteria 5336938
261 2522553511 2522125168 Bacteria 7376607
262 2587746925 2585428060 Bacteria 5304711
263 2587868012 2585428095 Bacteria 3789702
264 2588211519 2585428182 Bacteria 5007281
265 2588212660 2585428183 Bacteria 5166119
266 2588218389 2585428184 Bacteria 4978681
267 2588233798 2585428187 Bacteria 4629388
268 2588233899 2585428187 Bacteria 4629388
269 2588444841 2588253712 Bacteria 5403181
270 2644011277 2643221600 Bacteria 5530138
271 2644644053 2643221716 Bacteria 4986332
272 2644644415 2643221716 Bacteria 4986332
273 2644683141 2643221725 Bacteria 5087956
274 2729199449 2728369107 Bacteria 5082720
275 2739300683 2738543023 Bacteria 6767879
276 2775673639 2775506739 Bacteria 3855222
277 2816875554 2816332188 Bacteria 5133218
278 2817416115 2816332280 Bacteria 5109718
279 2819546943 2818991437 Bacteria 5805520
280 2819587218 2818991444 Bacteria 6968812
281 2842084351 2842083920 Bacteria 4857652
282 2842913187 2842909656 Bacteria 6185908
283 2857616929 2857613821 Bacteria 4917088
284 2857618573 2857618242 Bacteria 5635925
285 2857622982 2857618242 Bacteria 5635925
286 2881249344 2881247448 Bacteria 3717788
287 2889295007 2889290771 Bacteria 5530962
288 2903897119 2903895155 Bacteria 5258610
289 2904424007 2904419702 Bacteria 5166287
290 2904560533 2904555929 Bacteria 5218588
291 2919097745 2919097161 Bacteria 3860339
292 2919190509 2919186247 Bacteria 6244071
293 2919193829 2919191525 Bacteria 5765973
294 2919513241 2919509842 Bacteria 4104664
295 2919685816 2919683626 Bacteria 5534354
296 2929155577 2929154850 Bacteria 6753285
297 2929242726 2929239360 Bacteria 7745570
298 2929925535 2929921140 Bacteria 8649150
299 2939668068 2939664404 Bacteria 6364494
300 2939668790 2939664404 Bacteria 6364494
301 2946002655 2945997725 Bacteria 6404843
302 2958513776 2958512119 Bacteria 4528530
303 2965320642 2965320100 Bacteria 3975600
304 2977270931 2977268062 Bacteria 5243061
305 3003234315 3003233435 Bacteria 4458031
306 Ga0065714_10004987
307 MRS2a_Contig_27592
308 SwRhRL2b_contig_1494727
309 SwRhRL2b_contig_1663050
310 SwRhRL2b_contig_1674267
311 SwRhRL2b_contig_3711852
312 SwRhRL2b_contig_3809335
313 JGI24739J22299_10002038
314 JGI25153J46596_10015700
315 rootH2_10119825
316 rootH2_10257166
317 rootL2_10075774
318 rootL2_10301526
319 rootH1_10045631
320 rootH1_10386488
321 JGI25160J50197_1000563
322 Ga0055526_1010199
323 Ga0065714_10003796
324 Ga0065714_10064427
325 Ga0065714_10073519
326 Ga0065714_10080498
327 Ga0065714_10081679
328 Ga0065714_10306401
329 Ga0065704_10000205
330 Ga0065704_10070140
331 Ga0065704_10070204
332 Ga0065704_10072170
333 Ga0065704_10128087
334 Ga0065704_10167288
335 Ga0065704_10387836
336 Ga0065704_10397535
337 Ga0065704_10715843
338 Ga0070683_100007078
339 Ga0070666_10981685
340 Ga0068868_101155807
341 Ga0070660_100108023
342 Ga0070668_100070644
343 Ga0070669_100187201
344 Ga0070688_101141229
345 Ga0070700_100509409
346 Ga0070678_101010651
347 Ga0068867_100794472
348 Ga0070684_100022335
349 Ga0070672_100521601
350 Ga0070672_101859574
351 Ga0068857_100538767
352 Ga0068854_101153838
353 Ga0068861_100042532
354 Ga0068862_100563940
355 Ga0075434_100864144
356 Ga0099824_1028747
357 Ga0099826_10054564
358 Ga0105244_10018428
359 Ga0105244_10129640
360 Ga0105240_10451947
361 Ga0111539_11084477
362 Ga0105243_10000143
363 Ga0105242_10382560
364 Ga0105237_10884734
365 Ga0157373_10000290
366 Ga0157373_10132518
367 Ga0157373_10534036
368 Ga0157371_10000438
369 Ga0157371_10004549
370 Ga0157371_10018094
371 Ga0157371_10046965
372 Ga0157371_10076584
373 Ga0157371_10527690
374 Ga0157370_10000026
375 Ga0157370_10001117
376 Ga0157370_10001781
377 Ga0157370_10004705
378 Ga0157370_10005399
379 Ga0157370_10016660
380 Ga0157370_10054513
381 Ga0157370_10057388
382 Ga0157370_10262405
383 Ga0157370_10635284
384 Ga0157369_10001230
385 Ga0157369_10001456
386 Ga0157369_10369478
387 Ga0157374_11323801
388 Ga0163162_10169759
389 Ga0163162_10442197
390 Ga0157375_10002170
391 Ga0163163_10085682
392 Ga0157380_10163040
393 Ga0182008_10000008
394 Ga0182008_10000029
395 Ga0182008_10000540
396 Ga0182006_1000012
397 Ga0182006_1000407
398 Ga0182006_1000824
399 Ga0182006_1001429
400 Ga0182006_1129081
401 Ga0182007_10000007
402 Ga0182007_10399482
403 Ga0163161_10012141
404 Ga0163161_10021761
405 Ga0163161_10055400
406 Ga0163161_10155166
407 Ga0163161_10325589
408 Ga0163161_10498903
409 Ga0163161_10747065
410 Ga0209673_1027375
411 Ga0209675_1000200
412 Ga0209564_1001302
413 Ga0209564_1008207
414 Ga0209758_1000465
415 Ga0209758_1004804
416 Ga0207426_1000170
417 Ga0207426_1007198
418 Ga0207655_1142020
419 Ga0207647_10396131
420 Ga0207657_10179939
421 Ga0207686_10223616
422 Ga0207709_10000184
423 Ga0207661_10004923
424 Ga0207668_10080555
425 Ga0207640_11138041
426 Ga0207708_11116723
427 Ga0207648_11389920
428 Ga0207674_10169881
429 Ga0207675_100039765
430 Ga0207683_10198183
431 Ga0209282_1064202
432 Ga0268265_10436790
433 Ga0307517_10098696
434 Ga0307515_10101159
435 Ga0307515_10172385
436 Ga0307515_10276005
437 Ga0307515_10912960
438 Ga0316181_1235503
439 Ga0307408_100716636
440 Ga0307405_10000002
441 Ga0307405_10104247
442 Ga0307413_10000195
443 Ga0307413_10000257
444 Ga0307413_10208906
445 Ga0307406_10021092
446 Ga0307406_10226658
447 Ga0307412_10000007
448 Ga0307412_10000023
449 Ga0307412_10141768
450 Ga0307412_11041314
451 Ga0307409_101344359
452 Ga0307416_100022743
453 Ga0307414_10000046
454 Ga0307414_10000234
455 Ga0307414_10001191
456 Ga0307414_10010050
457 Ga0307414_10020298
458 Ga0307414_10023635
459 Ga0307414_10042786
460 Ga0307414_10048363
461 Ga0307414_10049682
462 Ga0307414_10072068
463 Ga0307414_10100495
464 Ga0307414_10104735
465 Ga0307414_10113981
466 Ga0307414_10362663
467 Ga0307414_11332698
468 Ga0307414_11842459
469 Ga0307414_12230993
470 Ga0307414_12317008
471 Ga0307411_10000001
472 Ga0307411_10001224
473 Ga0307411_10387175
474 Ga0439447_002887
475 Ga0439466_0003192
476 Ga0439465_0000291
477 Ga0451791_1831943
478 Ga0451793_1611631
479 Ga0451797_0904053
480 Ga0451802_0498939
481 Ga0451806_492651
482 Ga0451804_0478562
483 Ga0451807_1592854
484 Ga0451807_1818166
485 Ga0451841_0152411
486 Ga0439457_006624
487 Ga0450905_047271
488 Ga0466965_0045449
489 Ga0466965_0192204
490 Ga0466961_0937384
491 Ga0466959_0159335
492 Ga0495590_0015883
493 Ga0495610_0000001
494 Ga0495610_0000009
495 Ga0495630_0244592
496 Ga0495632_0001272
497 Ga0495648_0462216
498 Ga0495633_0000644
499 Ga0495633_0006190
500 Ga0495625_0001008
501 Ga0495625_0005112
502 Ga0496102_0029807
503 Ga0496104_0306687
504 Ga0496113_0047478
505 Ga0496115_0008453
506 Ga0496116_0000079
507 Ga0496116_0000452
508 Ga0496116_0012674
509 Ga0496117_0000023
510 Ga0496117_0006327
511 Ga0496118_0000564
512 Ga0496118_0035804
513 Ga0496118_0369449
514 Ga0496119_0000010
515 Ga0496120_0065676
516 Ga0496121_0172374
517 Ga0496122_0000166
518 Ga0496122_0001690
519 Ga0496122_0020853
520 Ga0496122_0043435
521 Ga0496123_0006328
522 Ga0496123_0011253
523 Ga0496123_0041947
524 Ga0496124_0028700
525 Ga0496124_0044686
526 Ga0496124_0145153
527 Ga0496124_0160333
528 Ga0496124_0214128
529 Ga0496125_0000675
530 Ga0496125_0007729
531 Ga0496125_0038061
532 Ga0496126_0002974
533 Ga0496126_0029326
534 Ga0496126_0192145
535 Ga0496126_0374087
536 Ga0496126_0552085
537 Ga0501300_022551
538 Ga0501235_031397
539 Ga0501235_171192
540 Ga0501238_056809
541 Ga0501247_001333
542 Ga0501251_000487
543 Ga0501241_000789
544 Ga0501241_017920
545 Ga0501266_000005
546 Ga0501269_000030
547 Ga0501204_085366
548 nmdc:mga07m45_369740_c1
549 nmdc:mga0rr50_1742962_c1
550 nmdc:mga0a205_1549367_c1
551 Ga0500644_0039229
552 Ga0500646_0003133
553 Ga0500566_0311193
554 Ga0500641_0000009
555 Ga0500556_0115192
556 Ga0500594_0087624
557 Ga0500655_001054
558 Ga0500658_0000003
559 Ga0500573_0418450
560 Ga0500588_0000391
561 Ga0500590_358003
562 Ga0500616_0033759
563 Ga0500622_0000162
564 Ga0500622_0000340
565 2520879134
566 2522553511
567 2587746925
568 2587868012
569 2588211519
570 2588212660
571 2588218389
572 2588233798
573 2588233899
574 2588444841
575 2644011277
576 2644644053
577 2644644415
578 2644683141
579 2729199449
580 2739300683
581 2775673639
582 2816875554
583 2817416115
584 2819546943
585 2819587218
586 2842084351
587 2842913187
588 2857616929
589 2857618573
590 2857622982
591 2881249344
592 2889295007
593 2903897119
594 2904424007
595 2904560533
596 2919097745
597 2919190509
598 2919193829
599 2919513241
600 2919685816
601 2929155577
602 2929242726
603 2929925535
604 2939668068
605 2939668790
606 2946002655
607 2958513776
608 2965320642
609 2977270931
610 3003234315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

20

106

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.8848 12 108
7kd3-assembly1.cif.gz_A structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.8732 9 101
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.8724 12 102
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.8451 12 108
7bzg-assembly3.cif.gz_J structure of bacillus subtilis hxlr, wild type in complex with formaldehyde and dna 0.8423 9 108
ID Description Score Start End Superfamily
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8829 10 101 1.10.10.10
2f2eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8214 16 101 1.10.10.10
3w6jE02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.814 23 85 1.10.10.10
4hqmA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8088 14 101 1.10.10.10
5hs7B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8011 10 101 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1I0RII5-F1-model_v4 DNA-binding transcriptional regulator, HxlR family 0.9305 6 111 GO:0003677
GO:0005737
AF-A0A327WQU1-F1-model_v4 HxlR family transcriptional regulator 0.9298 7 114 GO:0003677
GO:0005737
AF-A0A3D9P8G2-F1-model_v4 deleted 0.9245 1 113
AF-A0A1H6Q8E7-F1-model_v4 Transcriptional regulator, HxlR family 0.9205 2 113 GO:0003677
GO:0005737
AF-A0A850ND84-F1-model_v4 Transcriptional regulator 0.9204 1 113 GO:0003677
GO:0005737

Map