F397975

General Info

Members Datasets Scaffolds Average Seq Length
305 254 610 87

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100235070|Ga0070713_1002350703
Length 101
Sequence MAHKKGGGSSTNGRDSQGQRLGVKRFGGQLVTSGSILIRQRGTHYKAGKNVGRAKDDSLFARMDGVVLFEDKGGKGRFISVLSPAEHASRYEKVSSAPAAG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
93 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
122 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
137 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
138 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
139 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
140 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
141 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
142 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
143 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
144 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
145 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
150 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
151 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
152 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
153 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
154 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
155 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
156 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
157 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
158 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
159 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
160 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
161 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
201 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
222 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
223 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
224 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
225 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
226 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
227 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
228 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
229 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
230 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
231 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
232 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
233 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
234 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
235 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
236 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
244 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
245 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
246 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
247 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
248 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
249 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
250 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
251 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
252 2738543013 Variovorax sp. BT01 Isolate Unclassified
253 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
254 2932422444 Comamonas sp. 4034 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.57
Metatranscriptomes 12.46
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.57
Nodule 0.66
Rhizoplane 5.25
Rhizosphere 83.61
Stem 0
Stem Tuber 0
Unclassified 6.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100235070 3300005436 Bacteria 1667
2 SwRhRL2b_contig_1616504 2162886007 Bacteria 1186
3 SwRhRL2b_contig_37466 2162886007 Bacteria 1075
4 Ga0007417J51691_1041049 3300003544 Bacteria 751
5 Ga0055530_10092352 3300003791 Bacteria 618
6 Ga0055540_1050213 3300003792 Bacteria 863
7 Ga0055531_10000500 3300003794 Bacteria 35897
8 Ga0058863_11528505 3300004799 Viruses 710
9 Ga0058861_11957894 3300004800 Bacteria 946
10 Ga0058862_11853061 3300004803 Viruses 723
11 Ga0058862_12441055 3300004803 Bacteria 987
12 Ga0065704_10041388 3300005289 Bacteria 789
13 Ga0065704_10117241 3300005289 Bacteria 1834
14 Ga0070670_100992313 3300005331 Bacteria 763
15 Ga0070666_10699993 3300005335 Bacteria 743
16 Ga0070680_101407062 3300005336 Viruses 604
17 Ga0068868_100250372 3300005338 Bacteria 1491
18 Ga0070660_101144957 3300005339 Bacteria 659
19 Ga0070687_100301947 3300005343 Bacteria 1016
20 Ga0070675_101129783 3300005354 Bacteria 721
21 Ga0070674_100057937 3300005356 Bacteria 2691
22 Ga0070673_101281203 3300005364 Bacteria 688
23 Ga0070659_101996429 3300005366 Bacteria 521
24 Ga0070701_10153363 3300005438 Bacteria 1328
25 Ga0070708_100068257 3300005445 Bacteria 3195
26 Ga0070708_101933644 3300005445 Bacteria 547
27 Ga0070708_102081283 3300005445 Bacteria 525
28 Ga0070678_100881928 3300005456 Bacteria 817
29 Ga0070681_10464168 3300005458 Viruses 1179
30 Ga0070706_100649475 3300005467 Bacteria 979
31 Ga0070707_100866308 3300005468 Bacteria 868
32 Ga0070699_100275092 3300005518 Bacteria 1508
33 Ga0070699_100547113 3300005518 Bacteria 1053
34 Ga0070697_100283534 3300005536 Bacteria 1422
35 Ga0070697_100778544 3300005536 Unclassified 846
36 Ga0070695_101408308 3300005545 Unclassified 578
37 Ga0070693_100501830 3300005547 Bacteria 861
38 Ga0070665_101124563 3300005548 Bacteria 797
39 Ga0070664_100652607 3300005564 Bacteria 978
40 Ga0068866_10024434 3300005718 Bacteria 2826
41 Ga0068863_101304606 3300005841 Bacteria 733
42 Ga0068860_100861348 3300005843 Bacteria 921
43 Ga0068862_100787052 3300005844 Bacteria 928
44 Ga0075366_10107738 3300006195 Bacteria 1675
45 Ga0075433_11189463 3300006852 Bacteria 662
46 Ga0068865_100282545 3300006881 Bacteria 1322
47 Ga0079104_1000055 3300006946 Bacteria 166522
48 Ga0099794_10062561 3300007265 Bacteria 1810
49 Ga0099794_10076960 3300007265 Bacteria 1641
50 Ga0099794_10177254 3300007265 Bacteria 1087
51 Ga0105250_10001192 3300009092 Bacteria 14517
52 Ga0105240_10011302 3300009093 Bacteria 12439
53 Ga0111539_13453028 3300009094 Bacteria 508
54 Ga0105245_10103773 3300009098 Bacteria 2635
55 Ga0105243_10002600 3300009148 Bacteria 15051
56 Ga0105241_10230366 3300009174 Bacteria 1561
57 Ga0105242_12689804 3300009176 Bacteria 547
58 Ga0105237_10004245 3300009545 Bacteria 16680
59 Ga0105249_13508913 3300009553 Bacteria 505
60 Ga0099796_10192390 3300010159 Bacteria 824
61 Ga0105239_10417172 3300010375 Bacteria 1520
62 Ga0105246_11118836 3300011119 Bacteria 720
63 Ga0157371_10601419 3300013102 Bacteria 818
64 Ga0157370_10730523 3300013104 Bacteria 903
65 Ga0157378_10152966 3300013297 Bacteria 2151
66 Ga0157378_10167039 3300013297 Bacteria 2062
67 Ga0163162_10426021 3300013306 Bacteria 1459
68 Ga0163162_10903500 3300013306 Bacteria 996
69 Ga0157375_10044060 3300013308 Bacteria 4331
70 Ga0157375_10188136 3300013308 Bacteria 2219
71 Ga0163163_10022210 3300014325 Bacteria 6004
72 Ga0163163_10732562 3300014325 Bacteria 1052
73 Ga0163163_11065845 3300014325 Bacteria 871
74 Ga0157380_10328721 3300014326 Bacteria 1421
75 Ga0157376_10052430 3300014969 Bacteria 3392
76 Ga0157376_12666545 3300014969 Bacteria 540
77 Ga0163161_10077396 3300017792 Bacteria 2443
78 Ga0206356_11405752 3300020070 Viruses 906
79 Ga0206352_10989137 3300020078 Bacteria 942
80 Ga0213872_10126370 3300021361 Bacteria 1128
81 Ga0228598_1064083 3300024227 Unclassified 733
82 Ga0209050_1001301 3300025298 Bacteria 28152
83 Ga0209051_1044141 3300025303 Bacteria 1556
84 Ga0209257_1000131 3300025304 Bacteria 211464
85 Ga0209257_1143970 3300025304 Bacteria 532
86 Ga0207696_1001691 3300025711 Bacteria 11466
87 Ga0207684_10886966 3300025910 Bacteria 750
88 Ga0207707_10470902 3300025912 Viruses 1074
89 Ga0207695_10004215 3300025913 Bacteria 19760
90 Ga0207671_10160951 3300025914 Viruses 1738
91 Ga0207657_11019487 3300025919 Bacteria 635
92 Ga0207652_10337278 3300025921 Viruses 1361
93 Ga0207681_11580133 3300025923 Bacteria 549
94 Ga0207650_10263018 3300025925 Bacteria 1400
95 Ga0207659_10581825 3300025926 Bacteria 953
96 Ga0207687_10066964 3300025927 Bacteria 2553
97 Ga0207700_11290357 3300025928 Unclassified 651
98 Ga0207709_10000111 3300025935 Bacteria 127580
99 Ga0207709_11386355 3300025935 Bacteria 582
100 Ga0207670_11664635 3300025936 Unclassified 543
101 Ga0207669_10063132 3300025937 Bacteria 2285
102 Ga0207704_10654241 3300025938 Bacteria 866
103 Ga0207677_11063187 3300026023 Bacteria 736
104 Ga0207639_11468345 3300026041 Bacteria 640
105 Ga0207702_10560276 3300026078 Bacteria 1118
106 Ga0207641_11298766 3300026088 Bacteria 728
107 Ga0207674_10014017 3300026116 Bacteria 8859
108 Ga0207683_10755550 3300026121 Bacteria 902
109 Ga0209281_1000007 3300027111 Bacteria 938265
110 Ga0209588_1001135 3300027671 Bacteria 6854
111 Ga0268266_10550823 3300028379 Bacteria 1105
112 Ga0268265_10348791 3300028380 Bacteria 1351
113 Ga0265319_1062375 3300028563 Bacteria 1207
114 Ga0307515_10016568 3300028794 Bacteria 13488
115 Ga0307515_10070822 3300028794 Bacteria 4738
116 Ga0265338_10033189 3300028800 Bacteria 5015
117 Ga0265762_1048314 3300030760 Unclassified 848
118 Ga0265760_10083015 3300031090 Bacteria 994
119 Ga0265760_10258923 3300031090 Unclassified 605
120 Ga0265325_10083964 3300031241 Unclassified 1579
121 Ga0265331_10434164 3300031250 Bacteria 590
122 Ga0265327_10012557 3300031251 Bacteria 5702
123 Ga0265316_10370395 3300031344 Bacteria 1035
124 Ga0316579_10128751 3300031691 Bacteria 1219
125 Ga0265314_10364511 3300031711 Bacteria 791
126 Ga0316578_10186210 3300031728 Unclassified 1251
127 Ga0307405_10173496 3300031731 Bacteria 1540
128 Ga0316577_10143904 3300031733 Bacteria 1343
129 Ga0307413_10609019 3300031824 Bacteria 895
130 Ga0307410_10478600 3300031852 Bacteria 1021
131 Ga0307410_10627174 3300031852 Bacteria 899
132 Ga0307410_11975304 3300031852 Bacteria 520
133 Ga0307406_10172895 3300031901 Bacteria 1565
134 Ga0307407_10415712 3300031903 Bacteria 968
135 Ga0307409_100242668 3300031995 Bacteria 1641
136 Ga0307409_102079147 3300031995 Bacteria 598
137 Ga0307409_102746827 3300031995 Bacteria 520
138 Ga0307416_101134350 3300032002 Bacteria 887
139 Ga0307414_10202034 3300032004 Bacteria 1617
140 Ga0307414_10922542 3300032004 Bacteria 801
141 Ga0307411_10094050 3300032005 Bacteria 2100
142 Ga0307411_10789251 3300032005 Bacteria 835
143 Ga0307415_100113492 3300032126 Bacteria 2015
144 Ga0316593_10018037 3300032168 Bacteria 2163
145 Ga0316593_10062408 3300032168 Bacteria 1276
146 Ga0316596_1149608 3300033541 Bacteria 641
147 Ga0373948_0017442 3300034817 Bacteria 1338
148 Ga0373928_0249119 3300035084 Bacteria 529
149 Ga0373934_0175752 3300035086 Unclassified 879
150 Ga0373952_0060529 3300035092 Bacteria 925
151 Ga0373936_0278820 3300035113 Bacteria 751
152 Ga0373956_0010970 3300035119 Bacteria 3729
153 Ga0373957_0028076 3300035120 Bacteria 2048
154 Ga0373955_0190796 3300035172 Unclassified 1218
155 Ga0373931_0504334 3300035691 Bacteria 781
156 Ga0373931_1230018 3300035691 Bacteria 513
157 Ga0373927_0081090 3300035695 Bacteria 2103
158 Ga0373933_0000034 3300035724 Bacteria 83243
159 Ga0373933_0392313 3300035724 Bacteria 905
160 Ga0373933_0700748 3300035724 Bacteria 666
161 Ga0373947_0771883 3300035725 Unclassified 656
162 Ga0373937_0000001 3300036401 Bacteria 478903
163 Ga0373937_0223132 3300036401 Bacteria 1774
164 Ga0373925_1228126 3300037068 Bacteria 616
165 Ga0436361_0796155 3300039447 Bacteria 8850
166 Ga0439461_0010810 3300041410 Bacteria 1683
167 Ga0451794_48726 3300041446 Bacteria 666
168 Ga0451791_0860348 3300041451 Bacteria 536
169 Ga0451797_1587335 3300041453 Bacteria 1089
170 Ga0451795_1097443 3300041456 Bacteria 589
171 Ga0451800_0771616 3300041459 Bacteria 545
172 Ga0451805_055637 3300041461 Bacteria 538
173 Ga0451804_0153612 3300041463 Bacteria 900
174 Ga0451849_0418868 3300041505 Bacteria 1006
175 Ga0451855_1465734 3300041511 Bacteria 742
176 Ga0451853_0597047 3300041512 Bacteria 1019
177 Ga0439437_000955 3300042000 Bacteria 3011
178 Ga0439445_0056112 3300042004 Bacteria 1071
179 Ga0450911_000084 3300042115 Bacteria 37818
180 Ga0450912_003447 3300042116 Bacteria 1126
181 Ga0450917_000101 3300042120 Bacteria 5224
182 Ga0450922_028653 3300042124 Bacteria 600
183 Ga0450888_000038 3300042126 Bacteria 9334
184 Ga0450890_001097 3300042127 Bacteria 3945
185 Ga0450891_000246 3300042129 Bacteria 5494
186 Ga0450892_000862 3300042130 Bacteria 3303
187 Ga0450902_076547 3300042137 Bacteria 586
188 Ga0450889_000093 3300042144 Bacteria 8414
189 Ga0439444_0203110 3300042437 Bacteria 501
190 Ga0450916_019177 3300042530 Bacteria 927
191 Ga0450893_0003312 3300042532 Bacteria 2534
192 Ga0451577_0567837 3300042876 Bacteria 1030
193 Ga0451577_0602671 3300042876 Bacteria 997
194 Ga0453683_0212095 3300044673 Bacteria 1230
195 Ga0453684_0810033 3300044712 Bacteria 1009
196 Ga0453684_0812199 3300044712 Bacteria 1008
197 Ga0451576_0009538 3300045051 Bacteria 11245
198 Ga0451576_0181581 3300045051 Bacteria 2197
199 Ga0451576_0228760 3300045051 Bacteria 1942
200 Ga0451576_0441129 3300045051 Bacteria 1366
201 Ga0451576_0949953 3300045051 Bacteria 901
202 Ga0451576_2020924 3300045051 Bacteria 594
203 Ga0495651_0005814 3300046462 Bacteria 9411
204 Ga0495653_0115206 3300046463 Bacteria 1924
205 Ga0495653_0225666 3300046463 Bacteria 1257
206 Ga0495580_0499769 3300046472 Bacteria 812
207 Ga0495580_0847901 3300046472 Bacteria 590
208 Ga0495608_0554910 3300046511 Unclassified 692
209 Ga0495628_0419215 3300046516 Bacteria 976
210 Ga0495652_0039918 3300046529 Bacteria 4057
211 Ga0495587_0000912 3300046536 Bacteria 19527
212 Ga0495645_0141760 3300046543 Bacteria 1676
213 Ga0495657_0448915 3300046675 Bacteria 755
214 Ga0495599_0905066 3300046678 Unclassified 500
215 Ga0495623_0030174 3300046679 Bacteria 3488
216 Ga0495646_0137888 3300046680 Unclassified 1367
217 Ga0495604_0923915 3300047317 Unclassified 544
218 Ga0495636_0245423 3300047318 Bacteria 827
219 Ga0495675_0001586 3300047444 Bacteria 13704
220 Ga0495675_0251259 3300047444 Unclassified 1062
221 Ga0495675_0571670 3300047444 Bacteria 643
222 Ga0495684_0097067 3300047471 Bacteria 2230
223 Ga0495602_0000056 3300048088 Bacteria 109741
224 Ga0495602_0031296 3300048088 Bacteria 5033
225 Ga0495602_0728122 3300048088 Unclassified 671
226 Ga0496100_0090968 3300048903 Bacteria 2082
227 Ga0496101_0433723 3300048904 Bacteria 1036
228 Ga0496105_0168660 3300048908 Bacteria 1795
229 Ga0496106_0529405 3300048909 Bacteria 946
230 Ga0496107_0058098 3300048910 Bacteria 2797
231 Ga0496108_0330486 3300048911 Unclassified 1329
232 Ga0496109_0314351 3300048912 Bacteria 1478
233 Ga0496109_0762896 3300048912 Bacteria 905
234 Ga0496114_0034066 3300048917 Bacteria 4199
235 Ga0496121_0007616 3300048924 Bacteria 13022
236 Ga0496125_0031471 3300048928 Bacteria 4728
237 Ga0496125_0356416 3300048928 Bacteria 871
238 Ga0496125_0372596 3300048928 Bacteria 844
239 Ga0496126_0156079 3300048929 Bacteria 1953
240 Ga0496126_0181491 3300048929 Bacteria 1788
241 Ga0501306_014007 3300049127 Bacteria 1053
242 Ga0501306_024998 3300049127 Bacteria 857
243 Ga0501309_001769 3300049129 Bacteria 2205
244 Ga0501310_001378 3300049130 Bacteria 2203
245 Ga0501304_002583 3300049160 Bacteria 1271
246 Ga0501305_005535 3300049161 Bacteria 1535
247 Ga0501307_004588 3300049162 Bacteria 1419
248 Ga0501294_015945 3300049517 Bacteria 779
249 Ga0501311_024032 3300049527 Bacteria 847
250 Ga0501312_007340 3300049528 Bacteria 1402
251 Ga0501313_017874 3300049529 Bacteria 859
252 Ga0501314_002027 3300049530 Bacteria 1533
253 Ga0501315_007224 3300049531 Bacteria 1261
254 Ga0501316_023949 3300049532 Bacteria 786
255 Ga0501317_003095 3300049533 Bacteria 1628
256 Ga0501318_005169 3300049534 Bacteria 1281
257 Ga0501318_032605 3300049534 Bacteria 715
258 Ga0501320_018176 3300049536 Bacteria 792
259 Ga0501322_004476 3300049538 Bacteria 941
260 Ga0501323_039659 3300049539 Bacteria 687
261 Ga0501324_016911 3300049540 Bacteria 719
262 Ga0501325_020193 3300049541 Bacteria 697
263 Ga0501329_03877 3300049545 Bacteria 778
264 Ga0501334_09885 3300049550 Bacteria 683
265 Ga0501031_0076754 3300049568 Bacteria 2176
266 Ga0501032_0006297 3300049569 Bacteria 8743
267 Ga0501039_0306200 3300049575 Bacteria 1249
268 Ga0501039_0483080 3300049575 Bacteria 973
269 Ga0501071_0946193 3300049587 Bacteria 665
270 Ga0501077_0490242 3300049593 Bacteria 788
271 Ga0501202_014864 3300049652 Bacteria 1493
272 Ga0501206_070288 3300049653 Bacteria 591
273 Ga0501211_000169 3300049658 Bacteria 5302
274 Ga0501217_307798 3300049661 Bacteria 524
275 Ga0501222_003160 3300049662 Bacteria 2264
276 Ga0501235_026669 3300049669 Bacteria 1295
277 Ga0501236_019289 3300049670 Bacteria 993
278 Ga0501242_061698 3300049674 Bacteria 571
279 Ga0501258_016784 3300049687 Bacteria 830
280 Ga0501221_000307 3300049704 Bacteria 7344
281 Ga0501229_005873 3300049706 Bacteria 1513
282 Ga0501232_008626 3300049757 Bacteria 1106
283 Ga0501264_005050 3300049761 Bacteria 1198
284 Ga0501267_000659 3300049764 Bacteria 2743
285 Ga0501272_009520 3300049769 Bacteria 1076
286 Ga0501226_003946 3300049853 Bacteria 1737
287 nmdc:mga0k408_20083_c1 3300050493 Bacteria 3738
288 nmdc:mga0k408_2385_c2 3300050493 Bacteria 8224
289 nmdc:mga07m45_273201_c2 3300050496 Bacteria 616
290 nmdc:mga06r32_294149_c1 3300050510 Bacteria 1610
291 nmdc:mga08y16_667708_c1 3300050511 Bacteria 1042
292 nmdc:mga08x19_1225502_c1 3300050514 Bacteria 532
293 Ga0495601_0049610 3300053077 Bacteria 2647
294 Ga0500607_025590 3300053121 Bacteria 3283
295 Ga0500624_080786 3300053157 Bacteria 648
296 Ga0500636_0009564 3300053177 Bacteria 5639
297 Ga0500637_0015554 3300053178 Bacteria 4035
298 Ga0500625_093527 3300053729 Bacteria 1279
299 Ga0500596_030743 3300053735 Bacteria 832
300 2643743060 2643221544 Bacteria 5886209
301 2644218523 2643221639 Bacteria 6649903
302 2644260418 2643221646 Bacteria 6433402
303 2739248267 2738543013 Bacteria 5618633
304 2904480792 2904479285 Bacteria 5073931
305 2932424035 2932422444 Bacteria 4678430
306 Ga0070713_100235070
307 SwRhRL2b_contig_1616504
308 SwRhRL2b_contig_37466
309 Ga0007417J51691_1041049
310 Ga0055530_10092352
311 Ga0055540_1050213
312 Ga0055531_10000500
313 Ga0058863_11528505
314 Ga0058861_11957894
315 Ga0058862_11853061
316 Ga0058862_12441055
317 Ga0065704_10041388
318 Ga0065704_10117241
319 Ga0070670_100992313
320 Ga0070666_10699993
321 Ga0070680_101407062
322 Ga0068868_100250372
323 Ga0070660_101144957
324 Ga0070687_100301947
325 Ga0070675_101129783
326 Ga0070674_100057937
327 Ga0070673_101281203
328 Ga0070659_101996429
329 Ga0070701_10153363
330 Ga0070708_100068257
331 Ga0070708_101933644
332 Ga0070708_102081283
333 Ga0070678_100881928
334 Ga0070681_10464168
335 Ga0070706_100649475
336 Ga0070707_100866308
337 Ga0070699_100275092
338 Ga0070699_100547113
339 Ga0070697_100283534
340 Ga0070697_100778544
341 Ga0070695_101408308
342 Ga0070693_100501830
343 Ga0070665_101124563
344 Ga0070664_100652607
345 Ga0068866_10024434
346 Ga0068863_101304606
347 Ga0068860_100861348
348 Ga0068862_100787052
349 Ga0075366_10107738
350 Ga0075433_11189463
351 Ga0068865_100282545
352 Ga0079104_1000055
353 Ga0099794_10062561
354 Ga0099794_10076960
355 Ga0099794_10177254
356 Ga0105250_10001192
357 Ga0105240_10011302
358 Ga0111539_13453028
359 Ga0105245_10103773
360 Ga0105243_10002600
361 Ga0105241_10230366
362 Ga0105242_12689804
363 Ga0105237_10004245
364 Ga0105249_13508913
365 Ga0099796_10192390
366 Ga0105239_10417172
367 Ga0105246_11118836
368 Ga0157371_10601419
369 Ga0157370_10730523
370 Ga0157378_10152966
371 Ga0157378_10167039
372 Ga0163162_10426021
373 Ga0163162_10903500
374 Ga0157375_10044060
375 Ga0157375_10188136
376 Ga0163163_10022210
377 Ga0163163_10732562
378 Ga0163163_11065845
379 Ga0157380_10328721
380 Ga0157376_10052430
381 Ga0157376_12666545
382 Ga0163161_10077396
383 Ga0206356_11405752
384 Ga0206352_10989137
385 Ga0213872_10126370
386 Ga0228598_1064083
387 Ga0209050_1001301
388 Ga0209051_1044141
389 Ga0209257_1000131
390 Ga0209257_1143970
391 Ga0207696_1001691
392 Ga0207684_10886966
393 Ga0207707_10470902
394 Ga0207695_10004215
395 Ga0207671_10160951
396 Ga0207657_11019487
397 Ga0207652_10337278
398 Ga0207681_11580133
399 Ga0207650_10263018
400 Ga0207659_10581825
401 Ga0207687_10066964
402 Ga0207700_11290357
403 Ga0207709_10000111
404 Ga0207709_11386355
405 Ga0207670_11664635
406 Ga0207669_10063132
407 Ga0207704_10654241
408 Ga0207677_11063187
409 Ga0207639_11468345
410 Ga0207702_10560276
411 Ga0207641_11298766
412 Ga0207674_10014017
413 Ga0207683_10755550
414 Ga0209281_1000007
415 Ga0209588_1001135
416 Ga0268266_10550823
417 Ga0268265_10348791
418 Ga0265319_1062375
419 Ga0307515_10016568
420 Ga0307515_10070822
421 Ga0265338_10033189
422 Ga0265762_1048314
423 Ga0265760_10083015
424 Ga0265760_10258923
425 Ga0265325_10083964
426 Ga0265331_10434164
427 Ga0265327_10012557
428 Ga0265316_10370395
429 Ga0316579_10128751
430 Ga0265314_10364511
431 Ga0316578_10186210
432 Ga0307405_10173496
433 Ga0316577_10143904
434 Ga0307413_10609019
435 Ga0307410_10478600
436 Ga0307410_10627174
437 Ga0307410_11975304
438 Ga0307406_10172895
439 Ga0307407_10415712
440 Ga0307409_100242668
441 Ga0307409_102079147
442 Ga0307409_102746827
443 Ga0307416_101134350
444 Ga0307414_10202034
445 Ga0307414_10922542
446 Ga0307411_10094050
447 Ga0307411_10789251
448 Ga0307415_100113492
449 Ga0316593_10018037
450 Ga0316593_10062408
451 Ga0316596_1149608
452 Ga0373948_0017442
453 Ga0373928_0249119
454 Ga0373934_0175752
455 Ga0373952_0060529
456 Ga0373936_0278820
457 Ga0373956_0010970
458 Ga0373957_0028076
459 Ga0373955_0190796
460 Ga0373931_0504334
461 Ga0373931_1230018
462 Ga0373927_0081090
463 Ga0373933_0000034
464 Ga0373933_0392313
465 Ga0373933_0700748
466 Ga0373947_0771883
467 Ga0373937_0000001
468 Ga0373937_0223132
469 Ga0373925_1228126
470 Ga0436361_0796155
471 Ga0439461_0010810
472 Ga0451794_48726
473 Ga0451791_0860348
474 Ga0451797_1587335
475 Ga0451795_1097443
476 Ga0451800_0771616
477 Ga0451805_055637
478 Ga0451804_0153612
479 Ga0451849_0418868
480 Ga0451855_1465734
481 Ga0451853_0597047
482 Ga0439437_000955
483 Ga0439445_0056112
484 Ga0450911_000084
485 Ga0450912_003447
486 Ga0450917_000101
487 Ga0450922_028653
488 Ga0450888_000038
489 Ga0450890_001097
490 Ga0450891_000246
491 Ga0450892_000862
492 Ga0450902_076547
493 Ga0450889_000093
494 Ga0439444_0203110
495 Ga0450916_019177
496 Ga0450893_0003312
497 Ga0451577_0567837
498 Ga0451577_0602671
499 Ga0453683_0212095
500 Ga0453684_0810033
501 Ga0453684_0812199
502 Ga0451576_0009538
503 Ga0451576_0181581
504 Ga0451576_0228760
505 Ga0451576_0441129
506 Ga0451576_0949953
507 Ga0451576_2020924
508 Ga0495651_0005814
509 Ga0495653_0115206
510 Ga0495653_0225666
511 Ga0495580_0499769
512 Ga0495580_0847901
513 Ga0495608_0554910
514 Ga0495628_0419215
515 Ga0495652_0039918
516 Ga0495587_0000912
517 Ga0495645_0141760
518 Ga0495657_0448915
519 Ga0495599_0905066
520 Ga0495623_0030174
521 Ga0495646_0137888
522 Ga0495604_0923915
523 Ga0495636_0245423
524 Ga0495675_0001586
525 Ga0495675_0251259
526 Ga0495675_0571670
527 Ga0495684_0097067
528 Ga0495602_0000056
529 Ga0495602_0031296
530 Ga0495602_0728122
531 Ga0496100_0090968
532 Ga0496101_0433723
533 Ga0496105_0168660
534 Ga0496106_0529405
535 Ga0496107_0058098
536 Ga0496108_0330486
537 Ga0496109_0314351
538 Ga0496109_0762896
539 Ga0496114_0034066
540 Ga0496121_0007616
541 Ga0496125_0031471
542 Ga0496125_0356416
543 Ga0496125_0372596
544 Ga0496126_0156079
545 Ga0496126_0181491
546 Ga0501306_014007
547 Ga0501306_024998
548 Ga0501309_001769
549 Ga0501310_001378
550 Ga0501304_002583
551 Ga0501305_005535
552 Ga0501307_004588
553 Ga0501294_015945
554 Ga0501311_024032
555 Ga0501312_007340
556 Ga0501313_017874
557 Ga0501314_002027
558 Ga0501315_007224
559 Ga0501316_023949
560 Ga0501317_003095
561 Ga0501318_005169
562 Ga0501318_032605
563 Ga0501320_018176
564 Ga0501322_004476
565 Ga0501323_039659
566 Ga0501324_016911
567 Ga0501325_020193
568 Ga0501329_03877
569 Ga0501334_09885
570 Ga0501031_0076754
571 Ga0501032_0006297
572 Ga0501039_0306200
573 Ga0501039_0483080
574 Ga0501071_0946193
575 Ga0501077_0490242
576 Ga0501202_014864
577 Ga0501206_070288
578 Ga0501211_000169
579 Ga0501217_307798
580 Ga0501222_003160
581 Ga0501235_026669
582 Ga0501236_019289
583 Ga0501242_061698
584 Ga0501258_016784
585 Ga0501221_000307
586 Ga0501229_005873
587 Ga0501232_008626
588 Ga0501264_005050
589 Ga0501267_000659
590 Ga0501272_009520
591 Ga0501226_003946
592 nmdc:mga0k408_20083_c1
593 nmdc:mga0k408_2385_c2
594 nmdc:mga07m45_273201_c2
595 nmdc:mga06r32_294149_c1
596 nmdc:mga08y16_667708_c1
597 nmdc:mga08x19_1225502_c1
598 Ga0495601_0049610
599 Ga0500607_025590
600 Ga0500624_080786
601 Ga0500636_0009564
602 Ga0500637_0015554
603 Ga0500625_093527
604 Ga0500596_030743
605 2643743060
606 2644218523
607 2644260418
608 2739248267
609 2904480792
610 2932424035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

81

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9733 19 85
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9725 19 85
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9721 21 85
8c95-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.956 19 85
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9451 19 85
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9721 21 85 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9293 21 85 2.40.50.100
af_C0Z3L6_20_123_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8937 21 85 2.40.50.100
af_Q9ZVX0_51_147_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8763 8 84 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8725 29 83 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A2E9FJN9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 1.005 21 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A378VWB8-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 1.005 21 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A5C8B9S1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 1.003 25 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A0K8NY46-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 1.001 20 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A0A8XHI5-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9984 20 85 GO:0003735
GO:0006412
GO:0022625

Map