F398043

General Info

Members Datasets Scaffolds Average Seq Length
305 200 610 331

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10015277|Ga0070717_100152776
Length 401
Sequence LIVDGGAEAANCQGCDENGSHCAYFTKVYTRLWRDIVAAYCLLSTRCSDNLVGYMDIPNESLSRRKIVASAGIGLGSXXFAGLARAQGSAAKASADSAAKIWSNDYWAKKGDVSLYMFRKRVGAPKAGQPALPVLFLVHGSSLSSRPSFDLTVPGHGEYSVMNTFAQYGFDVWTMDHENYGRSGRTEGNSDIASGVEDLKAGIDLVLRETGQSKVHMFGESSGGLRAGAYAMVRPERIDRLVLAAFTYKGEGSPTLTERAKQLEYYRTHNRRLRDRAMIRSIYTRDKVGTSDPALGEFVADLELKFGDQVPTGTYLDMTANLPVVDPAKVLSPVLLIRGEYDGIATVADLLEFYKQLPCGDRQFVILPGMAHSVVSGLNRQLLWHSMRAFLTMPSPTAPSA

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
134 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
199 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 0
Rhizoplane 5.25
Rhizosphere 87.21
Stem 0
Stem Tuber 0
Unclassified 6.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10015277 3300006028 Bacteria 5926
2 JGI25153J46596_10000582 3300003215 Bacteria 22452
3 JGI25153J46596_10005105 3300003215 Bacteria 6930
4 Ga0070683_100061515 3300005329 Bacteria 3492
5 Ga0070680_100005275 3300005336 Bacteria 9772
6 Ga0068868_100011277 3300005338 Bacteria 6507
7 Ga0070660_100004941 3300005339 Bacteria 9222
8 Ga0070660_100065400 3300005339 Bacteria 2830
9 Ga0070689_100017503 3300005340 Bacteria 5265
10 Ga0070661_100213492 3300005344 Unclassified 1478
11 Ga0070674_100060082 3300005356 Bacteria 2648
12 Ga0070674_100061686 3300005356 Bacteria 2618
13 Ga0070713_100006709 3300005436 Bacteria 8011
14 Ga0070713_100221151 3300005436 Bacteria 1718
15 Ga0070711_100184520 3300005439 Bacteria 1599
16 Ga0070711_100322513 3300005439 Bacteria 1235
17 Ga0070708_100000142 3300005445 Bacteria 49401
18 Ga0070708_100011130 3300005445 Bacteria 7314
19 Ga0070708_100052437 3300005445 Bacteria 3617
20 Ga0070678_100012047 3300005456 Bacteria 5359
21 Ga0070681_10037086 3300005458 Bacteria 4893
22 Ga0070681_10247994 3300005458 Bacteria 1693
23 Ga0070706_100047998 3300005467 Bacteria 3941
24 Ga0070707_100020534 3300005468 Bacteria 6234
25 Ga0070707_100203566 3300005468 Bacteria 1929
26 Ga0070698_100003427 3300005471 Bacteria 17426
27 Ga0070699_100032296 3300005518 Bacteria 4520
28 Ga0070699_100206402 3300005518 Unclassified 1748
29 Ga0070679_100184904 3300005530 Bacteria 2055
30 Ga0070697_100003531 3300005536 Bacteria 12022
31 Ga0070697_100059562 3300005536 Bacteria 3109
32 Ga0070672_100025008 3300005543 Bacteria 4422
33 Ga0070665_100019386 3300005548 Bacteria 6825
34 Ga0068855_100000803 3300005563 Bacteria 38843
35 Ga0068855_100121955 3300005563 Unclassified 2983
36 Ga0068857_100009576 3300005577 Bacteria 8415
37 Ga0068854_100026720 3300005578 Bacteria 3970
38 Ga0068856_100120999 3300005614 Unclassified 2619
39 Ga0068856_100236365 3300005614 Bacteria 1843
40 Ga0068852_100008847 3300005616 Bacteria 7449
41 Ga0068859_100028890 3300005617 Bacteria 5562
42 Ga0068864_100011572 3300005618 Bacteria 7285
43 Ga0068863_100021034 3300005841 Bacteria 6232
44 Ga0068863_100056483 3300005841 Bacteria 3716
45 Ga0068863_100309743 3300005841 Bacteria 1532
46 Ga0068858_100006596 3300005842 Bacteria 11291
47 Ga0068858_100487562 3300005842 Bacteria 1190
48 Ga0070712_100227412 3300006175 Bacteria 1480
49 Ga0075369_10136621 3300006186 Bacteria 1116
50 Ga0075366_10035608 3300006195 Bacteria 2935
51 Ga0068871_100053508 3300006358 Bacteria 3272
52 Ga0075428_100066487 3300006844 Bacteria 3947
53 Ga0075431_100258404 3300006847 Bacteria 1768
54 Ga0097620_100028890 3300006931 Bacteria 5562
55 Ga0099794_10003361 3300007265 Bacteria 6093
56 Ga0099794_10078764 3300007265 Bacteria 1623
57 Ga0105240_10327817 3300009093 Unclassified 1743
58 Ga0105243_10055813 3300009148 Bacteria 3139
59 Ga0105241_10009839 3300009174 Bacteria 7027
60 Ga0105242_10022657 3300009176 Unclassified 4943
61 Ga0105242_10267988 3300009176 Bacteria 1546
62 Ga0105248_10010848 3300009177 Bacteria 10058
63 Ga0105248_10152754 3300009177 Bacteria 2605
64 Ga0105248_10204603 3300009177 Bacteria 2224
65 Ga0105237_10041148 3300009545 Bacteria 4661
66 Ga0105238_10056413 3300009551 Bacteria 3941
67 Ga0105238_10103036 3300009551 Unclassified 2835
68 Ga0105238_10329439 3300009551 Bacteria 1514
69 Ga0099796_10020538 3300010159 Bacteria 2020
70 Ga0105239_10010491 3300010375 Bacteria 10357
71 Ga0105239_10029264 3300010375 Bacteria 6057
72 Ga0105246_10129140 3300011119 Bacteria 1885
73 Ga0157370_10058424 3300013104 Bacteria 3666
74 Ga0157369_10059465 3300013105 Bacteria 4121
75 Ga0157378_10038534 3300013297 Unclassified 4237
76 Ga0157378_10404923 3300013297 Bacteria 1345
77 Ga0163162_10043037 3300013306 Bacteria 4521
78 Ga0163162_10045791 3300013306 Bacteria 4383
79 Ga0157375_10031281 3300013308 Bacteria 5028
80 Ga0157375_10400523 3300013308 Bacteria 1539
81 Ga0163163_10056499 3300014325 Bacteria 3879
82 Ga0163163_10162820 3300014325 Unclassified 2277
83 Ga0163163_10230205 3300014325 Bacteria 1902
84 Ga0157380_10056739 3300014326 Unclassified 3116
85 Ga0157376_10060702 3300014969 Bacteria 3176
86 Ga0213876_10044842 3300021384 Bacteria 2338
87 Ga0213875_10006511 3300021388 Bacteria 6118
88 Ga0209758_1000173 3300025297 Bacteria 147509
89 Ga0207426_1034476 3300025302 Bacteria 1623
90 Ga0207682_10000330 3300025893 Bacteria 21622
91 Ga0207688_10013890 3300025901 Bacteria 4376
92 Ga0207680_10008696 3300025903 Bacteria 4999
93 Ga0207680_10172787 3300025903 Bacteria 1456
94 Ga0207699_10037117 3300025906 Bacteria 2783
95 Ga0207705_10022850 3300025909 Unclassified 4459
96 Ga0207705_10111805 3300025909 Bacteria 2019
97 Ga0207684_10006932 3300025910 Bacteria 10252
98 Ga0207654_10008905 3300025911 Bacteria 5090
99 Ga0207707_10037125 3300025912 Bacteria 4257
100 Ga0207707_10081968 3300025912 Bacteria 2816
101 Ga0207707_10216443 3300025912 Bacteria 1668
102 Ga0207695_10021211 3300025913 Bacteria 7418
103 Ga0207671_10185555 3300025914 Bacteria 1620
104 Ga0207663_10013028 3300025916 Bacteria 4510
105 Ga0207660_10058494 3300025917 Bacteria 2764
106 Ga0207657_10002229 3300025919 Bacteria 21012
107 Ga0207657_10138474 3300025919 Bacteria 1990
108 Ga0207652_10061718 3300025921 Unclassified 3238
109 Ga0207652_10234913 3300025921 Bacteria 1652
110 Ga0207652_10264221 3300025921 Bacteria 1552
111 Ga0207646_10002633 3300025922 Bacteria 21088
112 Ga0207646_10035664 3300025922 Bacteria 4492
113 Ga0207694_10016200 3300025924 Bacteria 5626
114 Ga0207694_10025043 3300025924 Bacteria 4534
115 Ga0207694_10247257 3300025924 Bacteria 1459
116 Ga0207659_10073336 3300025926 Bacteria 2506
117 Ga0207687_10253177 3300025927 Bacteria 1401
118 Ga0207700_10067204 3300025928 Bacteria 2743
119 Ga0207700_10177241 3300025928 Bacteria 1782
120 Ga0207644_10342390 3300025931 Bacteria 1213
121 Ga0207686_10038125 3300025934 Unclassified 2906
122 Ga0207686_10137123 3300025934 Bacteria 1686
123 Ga0207709_10112898 3300025935 Bacteria 1820
124 Ga0207669_10033459 3300025937 Bacteria 2901
125 Ga0207665_10053318 3300025939 Bacteria 2726
126 Ga0207711_10091586 3300025941 Bacteria 2674
127 Ga0207689_10028158 3300025942 Bacteria 4699
128 Ga0207689_10127126 3300025942 Bacteria 2097
129 Ga0207661_10060597 3300025944 Bacteria 3054
130 Ga0207667_10025313 3300025949 Bacteria 6498
131 Ga0207651_10101174 3300025960 Bacteria 2138
132 Ga0207640_10026986 3300025981 Bacteria 3495
133 Ga0207658_10237155 3300025986 Unclassified 1543
134 Ga0207677_10005412 3300026023 Bacteria 6929
135 Ga0207703_10018646 3300026035 Bacteria 5420
136 Ga0207639_10135126 3300026041 Bacteria 2047
137 Ga0207678_10283057 3300026067 Bacteria 1423
138 Ga0207702_10069328 3300026078 Bacteria 3031
139 Ga0207702_10074698 3300026078 Unclassified 2926
140 Ga0207641_10419425 3300026088 Bacteria 1288
141 Ga0207648_10018185 3300026089 Bacteria 6366
142 Ga0207676_10050991 3300026095 Unclassified 3229
143 Ga0207676_10055154 3300026095 Bacteria 3118
144 Ga0207674_10026996 3300026116 Bacteria 6087
145 Ga0207683_10021157 3300026121 Bacteria 5567
146 Ga0209179_1010807 3300027512 Bacteria 1600
147 Ga0207428_10113551 3300027907 Unclassified 2082
148 Ga0268266_10012924 3300028379 Bacteria 7202
149 Ga0265330_10012550 3300031235 Bacteria 3963
150 Ga0265320_10015955 3300031240 Bacteria 4226
151 Ga0265329_10033967 3300031242 Bacteria 1648
152 Ga0265340_10084755 3300031247 Bacteria 1487
153 Ga0265316_10173240 3300031344 Bacteria 1609
154 Ga0307513_10128529 3300031456 Bacteria 2484
155 Ga0307513_10133386 3300031456 Bacteria 2424
156 Ga0265314_10007359 3300031711 Bacteria 9558
157 Ga0265342_10051233 3300031712 Bacteria 2464
158 Ga0373948_0011801 3300034817 Bacteria 1552
159 Ga0373948_0033115 3300034817 Bacteria 1051
160 Ga0373934_0073058 3300035086 Bacteria 1373
161 Ga0373923_0005344 3300035111 Bacteria 4360
162 Ga0373923_0082752 3300035111 Bacteria 1394
163 Ga0373936_0000312 3300035113 Bacteria 16371
164 Ga0373954_0002800 3300035118 Bacteria 7346
165 Ga0373957_0004555 3300035120 Bacteria 4225
166 Ga0373957_0020855 3300035120 Bacteria 2320
167 Ga0373943_0005530 3300035170 Bacteria 5673
168 Ga0373946_0004875 3300035171 Bacteria 4831
169 Ga0373955_0000333 3300035172 Bacteria 19680
170 Ga0373955_0002148 3300035172 Bacteria 8518
171 Ga0373955_0030723 3300035172 Bacteria 2808
172 Ga0373924_0014124 3300035410 Bacteria 3013
173 Ga0373924_0021902 3300035410 Bacteria 2494
174 Ga0373935_0000333 3300035692 Bacteria 23819
175 Ga0373935_0020472 3300035692 Bacteria 4044
176 Ga0373927_0016825 3300035695 Bacteria 4822
177 Ga0373927_0021938 3300035695 Bacteria 4184
178 Ga0373947_0009557 3300035725 Bacteria 5564
179 Ga0373937_0000006 3300036401 Bacteria 194781
180 Ga0373937_0006157 3300036401 Bacteria 10330
181 Ga0373937_0008285 3300036401 Bacteria 9025
182 Ga0373937_0027506 3300036401 Bacteria 5142
183 Ga0373937_0052401 3300036401 Bacteria 3741
184 Ga0373937_0196499 3300036401 Bacteria 1896
185 Ga0373925_0000002 3300037068 Bacteria 368879
186 Ga0373925_0055766 3300037068 Bacteria 2959
187 Ga0373925_0192197 3300037068 Bacteria 1620
188 Ga0373925_0192981 3300037068 Bacteria 1617
189 Ga0436364_0272101 3300037853 Bacteria 2066
190 Ga0436364_0736730 3300037853 Bacteria 11757
191 Ga0436365_0220979 3300039437 Bacteria 3529
192 Ga0436365_1342014 3300039437 Bacteria 2732
193 Ga0436360_0137646 3300039438 Bacteria 1334
194 Ga0436361_0324513 3300039447 Bacteria 1352
195 Ga0439453_0000139 3300041408 Bacteria 6344
196 Ga0439435_0013672 3300042436 Bacteria 1991
197 Ga0451577_0042937 3300042876 Bacteria 4051
198 Ga0453683_0024946 3300044673 Bacteria 3799
199 Ga0453684_0061000 3300044712 Bacteria 4844
200 Ga0451576_0006553 3300045051 Bacteria 14246
201 Ga0451576_0124896 3300045051 Bacteria 2681
202 Ga0495592_0000039 3300046454 Bacteria 124471
203 Ga0495592_0025201 3300046454 Bacteria 4516
204 Ga0495629_0017919 3300046459 Bacteria 5076
205 Ga0495638_0067773 3300046460 Bacteria 2190
206 Ga0495651_0000376 3300046462 Bacteria 34540
207 Ga0495653_0000006 3300046463 Bacteria 363285
208 Ga0495580_0018320 3300046472 Bacteria 5214
209 Ga0495582_0012092 3300046473 Bacteria 4756
210 Ga0495582_0130342 3300046473 Bacteria 1421
211 Ga0495662_0004567 3300046476 Bacteria 6941
212 Ga0495664_0000002 3300046477 Bacteria 625183
213 Ga0495664_0010336 3300046477 Bacteria 5235
214 Ga0495584_0033615 3300046491 Bacteria 2595
215 Ga0495608_0000006 3300046511 Bacteria 324334
216 Ga0495608_0006657 3300046511 Bacteria 8195
217 Ga0495608_0235188 3300046511 Bacteria 1146
218 Ga0495618_0000027 3300046514 Bacteria 112522
219 Ga0495628_0000002 3300046516 Bacteria 589399
220 Ga0495630_0000950 3300046517 Bacteria 20249
221 Ga0495648_0002892 3300046524 Bacteria 15444
222 Ga0495652_0000004 3300046529 Bacteria 588877
223 Ga0495640_0000005 3300046533 Bacteria 318271
224 Ga0495640_0037822 3300046533 Bacteria 3400
225 Ga0495640_0093876 3300046533 Bacteria 1977
226 Ga0495587_0000007 3300046536 Bacteria 290788
227 Ga0495587_0077090 3300046536 Bacteria 1936
228 Ga0495645_0000003 3300046543 Bacteria 570133
229 Ga0495645_0008555 3300046543 Bacteria 7148
230 Ga0495667_0000002 3300046559 Bacteria 437535
231 Ga0495667_0018956 3300046559 Bacteria 4644
232 Ga0495667_0025067 3300046559 Bacteria 4020
233 Ga0495667_0147639 3300046559 Unclassified 1514
234 Ga0495667_0175597 3300046559 Bacteria 1376
235 Ga0495634_0000022 3300046642 Bacteria 118988
236 Ga0495634_0063212 3300046642 Bacteria 2457
237 Ga0495635_0000022 3300046663 Bacteria 160907
238 Ga0495635_0082716 3300046663 Bacteria 2197
239 Ga0495657_0000072 3300046675 Bacteria 91747
240 Ga0495657_0008853 3300046675 Bacteria 7663
241 Ga0495599_0000001 3300046678 Bacteria 537563
242 Ga0495599_0084641 3300046678 Bacteria 1981
243 Ga0495623_0000001 3300046679 Bacteria 313861
244 Ga0495646_0000014 3300046680 Bacteria 143781
245 Ga0495647_0074607 3300046681 Bacteria 1364
246 Ga0495613_0052776 3300046689 Bacteria 2993
247 Ga0495600_0000006 3300046809 Bacteria 151916
248 Ga0495600_0085903 3300046809 Bacteria 2053
249 Ga0495604_0000005 3300047317 Bacteria 424516
250 Ga0495604_0125284 3300047317 Bacteria 1853
251 Ga0495674_0000003 3300047319 Bacteria 562126
252 Ga0495674_0097289 3300047319 Bacteria 2507
253 Ga0495674_0225950 3300047319 Bacteria 1546
254 Ga0495680_0002479 3300047322 Bacteria 18871
255 Ga0495680_0144292 3300047322 Bacteria 1740
256 Ga0495675_0000010 3300047444 Bacteria 153375
257 Ga0495675_0084707 3300047444 Unclassified 1994
258 Ga0495684_0000028 3300047471 Bacteria 123549
259 Ga0495684_0223875 3300047471 Bacteria 1378
260 Ga0495593_0018835 3300047673 Bacteria 3875
261 Ga0495602_0000054 3300048088 Bacteria 111411
262 Ga0495602_0013595 3300048088 Bacteria 8311
263 Ga0495602_0069927 3300048088 Bacteria 3007
264 Ga0496100_0006218 3300048903 Bacteria 6495
265 Ga0496101_0021676 3300048904 Bacteria 4415
266 Ga0496104_0033641 3300048907 Bacteria 4777
267 Ga0496104_0041804 3300048907 Bacteria 4299
268 Ga0496106_0037592 3300048909 Bacteria 3622
269 Ga0496106_0254742 3300048909 Bacteria 1404
270 Ga0496107_0150322 3300048910 Bacteria 1722
271 Ga0496108_0106540 3300048911 Bacteria 2393
272 Ga0496108_0209461 3300048911 Bacteria 1692
273 Ga0496110_0015940 3300048913 Bacteria 6267
274 Ga0496110_0359739 3300048913 Bacteria 1326
275 Ga0496111_0133395 3300048914 Bacteria 1839
276 Ga0496111_0385299 3300048914 Bacteria 1036
277 Ga0496112_0320434 3300048915 Bacteria 1494
278 Ga0496114_0013173 3300048917 Bacteria 6629
279 Ga0496114_0064426 3300048917 Bacteria 3069
280 Ga0496118_0018669 3300048921 Bacteria 6235
281 Ga0496119_0136856 3300048922 Bacteria 1327
282 Ga0496126_0146357 3300048929 Bacteria 2029
283 Ga0501072_0026344 3300049588 Bacteria 4533
284 nmdc:mga06r32_257579_c1 3300050510 Bacteria 1732
285 nmdc:mga0n895_107115_c1 3300050512 Bacteria 2808
286 Ga0495601_0000008 3300053077 Bacteria 362152
287 Ga0495601_0000735 3300053077 Bacteria 17656
288 Ga0495601_0049868 3300053077 Bacteria 2640
289 Ga0495612_0000002 3300053078 Bacteria 310466
290 Ga0495612_0002450 3300053078 Bacteria 7640
291 Ga0495612_0006255 3300053078 Bacteria 4906
292 Ga0495612_0015908 3300053078 Bacteria 3015
293 Ga0495595_0000008 3300053084 Bacteria 196206
294 Ga0495595_0000581 3300053084 Bacteria 13982
295 Ga0495595_0080027 3300053084 Bacteria 1555
296 Ga0495619_0000002 3300053085 Bacteria 530226
297 Ga0495619_0005016 3300053085 Bacteria 8404
298 Ga0495619_0053287 3300053085 Bacteria 2676
299 Ga0500651_0001825 3300053093 Bacteria 10922
300 Ga0500641_0004372 3300053096 Bacteria 4993
301 Ga0500595_000589 3300053119 Bacteria 21663
302 Ga0500595_009987 3300053119 Bacteria 3797
303 Ga0500642_0002166 3300053130 Bacteria 5703
304 Ga0500577_0099237 3300053142 Bacteria 1188
305 Ga0501082_0337869 3300060353 Bacteria 1312
306 Ga0070717_10015277
307 JGI25153J46596_10000582
308 JGI25153J46596_10005105
309 Ga0070683_100061515
310 Ga0070680_100005275
311 Ga0068868_100011277
312 Ga0070660_100004941
313 Ga0070660_100065400
314 Ga0070689_100017503
315 Ga0070661_100213492
316 Ga0070674_100060082
317 Ga0070674_100061686
318 Ga0070713_100006709
319 Ga0070713_100221151
320 Ga0070711_100184520
321 Ga0070711_100322513
322 Ga0070708_100000142
323 Ga0070708_100011130
324 Ga0070708_100052437
325 Ga0070678_100012047
326 Ga0070681_10037086
327 Ga0070681_10247994
328 Ga0070706_100047998
329 Ga0070707_100020534
330 Ga0070707_100203566
331 Ga0070698_100003427
332 Ga0070699_100032296
333 Ga0070699_100206402
334 Ga0070679_100184904
335 Ga0070697_100003531
336 Ga0070697_100059562
337 Ga0070672_100025008
338 Ga0070665_100019386
339 Ga0068855_100000803
340 Ga0068855_100121955
341 Ga0068857_100009576
342 Ga0068854_100026720
343 Ga0068856_100120999
344 Ga0068856_100236365
345 Ga0068852_100008847
346 Ga0068859_100028890
347 Ga0068864_100011572
348 Ga0068863_100021034
349 Ga0068863_100056483
350 Ga0068863_100309743
351 Ga0068858_100006596
352 Ga0068858_100487562
353 Ga0070712_100227412
354 Ga0075369_10136621
355 Ga0075366_10035608
356 Ga0068871_100053508
357 Ga0075428_100066487
358 Ga0075431_100258404
359 Ga0097620_100028890
360 Ga0099794_10003361
361 Ga0099794_10078764
362 Ga0105240_10327817
363 Ga0105243_10055813
364 Ga0105241_10009839
365 Ga0105242_10022657
366 Ga0105242_10267988
367 Ga0105248_10010848
368 Ga0105248_10152754
369 Ga0105248_10204603
370 Ga0105237_10041148
371 Ga0105238_10056413
372 Ga0105238_10103036
373 Ga0105238_10329439
374 Ga0099796_10020538
375 Ga0105239_10010491
376 Ga0105239_10029264
377 Ga0105246_10129140
378 Ga0157370_10058424
379 Ga0157369_10059465
380 Ga0157378_10038534
381 Ga0157378_10404923
382 Ga0163162_10043037
383 Ga0163162_10045791
384 Ga0157375_10031281
385 Ga0157375_10400523
386 Ga0163163_10056499
387 Ga0163163_10162820
388 Ga0163163_10230205
389 Ga0157380_10056739
390 Ga0157376_10060702
391 Ga0213876_10044842
392 Ga0213875_10006511
393 Ga0209758_1000173
394 Ga0207426_1034476
395 Ga0207682_10000330
396 Ga0207688_10013890
397 Ga0207680_10008696
398 Ga0207680_10172787
399 Ga0207699_10037117
400 Ga0207705_10022850
401 Ga0207705_10111805
402 Ga0207684_10006932
403 Ga0207654_10008905
404 Ga0207707_10037125
405 Ga0207707_10081968
406 Ga0207707_10216443
407 Ga0207695_10021211
408 Ga0207671_10185555
409 Ga0207663_10013028
410 Ga0207660_10058494
411 Ga0207657_10002229
412 Ga0207657_10138474
413 Ga0207652_10061718
414 Ga0207652_10234913
415 Ga0207652_10264221
416 Ga0207646_10002633
417 Ga0207646_10035664
418 Ga0207694_10016200
419 Ga0207694_10025043
420 Ga0207694_10247257
421 Ga0207659_10073336
422 Ga0207687_10253177
423 Ga0207700_10067204
424 Ga0207700_10177241
425 Ga0207644_10342390
426 Ga0207686_10038125
427 Ga0207686_10137123
428 Ga0207709_10112898
429 Ga0207669_10033459
430 Ga0207665_10053318
431 Ga0207711_10091586
432 Ga0207689_10028158
433 Ga0207689_10127126
434 Ga0207661_10060597
435 Ga0207667_10025313
436 Ga0207651_10101174
437 Ga0207640_10026986
438 Ga0207658_10237155
439 Ga0207677_10005412
440 Ga0207703_10018646
441 Ga0207639_10135126
442 Ga0207678_10283057
443 Ga0207702_10069328
444 Ga0207702_10074698
445 Ga0207641_10419425
446 Ga0207648_10018185
447 Ga0207676_10050991
448 Ga0207676_10055154
449 Ga0207674_10026996
450 Ga0207683_10021157
451 Ga0209179_1010807
452 Ga0207428_10113551
453 Ga0268266_10012924
454 Ga0265330_10012550
455 Ga0265320_10015955
456 Ga0265329_10033967
457 Ga0265340_10084755
458 Ga0265316_10173240
459 Ga0307513_10128529
460 Ga0307513_10133386
461 Ga0265314_10007359
462 Ga0265342_10051233
463 Ga0373948_0011801
464 Ga0373948_0033115
465 Ga0373934_0073058
466 Ga0373923_0005344
467 Ga0373923_0082752
468 Ga0373936_0000312
469 Ga0373954_0002800
470 Ga0373957_0004555
471 Ga0373957_0020855
472 Ga0373943_0005530
473 Ga0373946_0004875
474 Ga0373955_0000333
475 Ga0373955_0002148
476 Ga0373955_0030723
477 Ga0373924_0014124
478 Ga0373924_0021902
479 Ga0373935_0000333
480 Ga0373935_0020472
481 Ga0373927_0016825
482 Ga0373927_0021938
483 Ga0373947_0009557
484 Ga0373937_0000006
485 Ga0373937_0006157
486 Ga0373937_0008285
487 Ga0373937_0027506
488 Ga0373937_0052401
489 Ga0373937_0196499
490 Ga0373925_0000002
491 Ga0373925_0055766
492 Ga0373925_0192197
493 Ga0373925_0192981
494 Ga0436364_0272101
495 Ga0436364_0736730
496 Ga0436365_0220979
497 Ga0436365_1342014
498 Ga0436360_0137646
499 Ga0436361_0324513
500 Ga0439453_0000139
501 Ga0439435_0013672
502 Ga0451577_0042937
503 Ga0453683_0024946
504 Ga0453684_0061000
505 Ga0451576_0006553
506 Ga0451576_0124896
507 Ga0495592_0000039
508 Ga0495592_0025201
509 Ga0495629_0017919
510 Ga0495638_0067773
511 Ga0495651_0000376
512 Ga0495653_0000006
513 Ga0495580_0018320
514 Ga0495582_0012092
515 Ga0495582_0130342
516 Ga0495662_0004567
517 Ga0495664_0000002
518 Ga0495664_0010336
519 Ga0495584_0033615
520 Ga0495608_0000006
521 Ga0495608_0006657
522 Ga0495608_0235188
523 Ga0495618_0000027
524 Ga0495628_0000002
525 Ga0495630_0000950
526 Ga0495648_0002892
527 Ga0495652_0000004
528 Ga0495640_0000005
529 Ga0495640_0037822
530 Ga0495640_0093876
531 Ga0495587_0000007
532 Ga0495587_0077090
533 Ga0495645_0000003
534 Ga0495645_0008555
535 Ga0495667_0000002
536 Ga0495667_0018956
537 Ga0495667_0025067
538 Ga0495667_0147639
539 Ga0495667_0175597
540 Ga0495634_0000022
541 Ga0495634_0063212
542 Ga0495635_0000022
543 Ga0495635_0082716
544 Ga0495657_0000072
545 Ga0495657_0008853
546 Ga0495599_0000001
547 Ga0495599_0084641
548 Ga0495623_0000001
549 Ga0495646_0000014
550 Ga0495647_0074607
551 Ga0495613_0052776
552 Ga0495600_0000006
553 Ga0495600_0085903
554 Ga0495604_0000005
555 Ga0495604_0125284
556 Ga0495674_0000003
557 Ga0495674_0097289
558 Ga0495674_0225950
559 Ga0495680_0002479
560 Ga0495680_0144292
561 Ga0495675_0000010
562 Ga0495675_0084707
563 Ga0495684_0000028
564 Ga0495684_0223875
565 Ga0495593_0018835
566 Ga0495602_0000054
567 Ga0495602_0013595
568 Ga0495602_0069927
569 Ga0496100_0006218
570 Ga0496101_0021676
571 Ga0496104_0033641
572 Ga0496104_0041804
573 Ga0496106_0037592
574 Ga0496106_0254742
575 Ga0496107_0150322
576 Ga0496108_0106540
577 Ga0496108_0209461
578 Ga0496110_0015940
579 Ga0496110_0359739
580 Ga0496111_0133395
581 Ga0496111_0385299
582 Ga0496112_0320434
583 Ga0496114_0013173
584 Ga0496114_0064426
585 Ga0496118_0018669
586 Ga0496119_0136856
587 Ga0496126_0146357
588 Ga0501072_0026344
589 nmdc:mga06r32_257579_c1
590 nmdc:mga0n895_107115_c1
591 Ga0495601_0000008
592 Ga0495601_0000735
593 Ga0495601_0049868
594 Ga0495612_0000002
595 Ga0495612_0002450
596 Ga0495612_0006255
597 Ga0495612_0015908
598 Ga0495595_0000008
599 Ga0495595_0000581
600 Ga0495595_0080027
601 Ga0495619_0000002
602 Ga0495619_0005016
603 Ga0495619_0053287
604 Ga0500651_0001825
605 Ga0500641_0004372
606 Ga0500595_000589
607 Ga0500595_009987
608 Ga0500642_0002166
609 Ga0500577_0099237
610 Ga0501082_0337869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

133

376

0.84

PF12146

Hydrolase_4

Serine aminopeptidase, S33

153

378

0.83

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

135

377

0.57

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8166 45 337
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.8043 46 339
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.801 46 339
6eic-assembly1.cif.gz_C crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.8 45 338
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.7984 45 337
ID Description Score Start End Superfamily
af_A0A0R0I9Y7_269_527_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8087 136 337 3.40.50.1820
3bdiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8059 46 337 3.40.50.1820
af_A0A0R0KP61_46_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7984 135 329 3.40.50.1820
af_Q8IIG3_100_338_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7964 43 195 3.40.50.1820
2hdwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7955 43 336 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0D7NRL0-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9914 46 345
AF-A0A0D7NRL0-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9848 46 345
AF-A0A0N7J9V4-F1-model_v4 Alpha/beta hydrolase family protein 0.9819 45 340 GO:0016020
GO:0016787
AF-A0A537QVW0-F1-model_v4 Lysophospholipase 0.9758 211 340
AF-A0A0N7J9V4-F1-model_v4 Alpha/beta hydrolase family protein 0.9721 45 340 GO:0016020
GO:0016787

Map