F398064

General Info

Members Datasets Scaffolds Average Seq Length
305 217 245 331

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100137860|Ga0075428_1001378602
Length 390
Sequence MALGVRRRDGVRLSILVVVPVLVAAAMPCVSGRTCSELTSYAESVDRFRWRPVAGRVGGMRLLVLGGTNFVGRAIVADALSRGAEVTVFNRGHTMPPPGVTSLRGDRNQPGGLASLATGEWDIAVDTWSAAPVAVRNAAQLLKGRTDRYAYISSRSVYTRPGGPCLTEQSPVVEASADAGADGEEVAYAPAKRGGELAAEAAFGDRTLLVRAGLILGPYEDVGRLPWWLRRLARGGPAAAPGPHDLDLQYVDARDLAQWTLDAAEAGLSGPYNVVSESGHTTMGELLDRCVQATGNVAQLHWVTPEAVLAAGVEPWTELPIWLPPGTLHDLLHRGDVSKALAAGLRCRPVAETIADTWAWLSSLDSEPPQRSDRPAPGLSAEAEAKLLGL

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
4 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
5 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
6 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
7 2643221647 Streptomyces sp. Root369 Isolate Unclassified
8 2643221670 Streptomyces sp. Root431 Isolate Unclassified
9 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
10 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
11 2643221714 Streptomyces sp. Root264 Isolate Unclassified
12 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
13 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
14 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
15 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
16 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
17 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
18 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
19 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
20 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
21 2808606448 Streptomyces sp. 193411 Isolate Unclassified
22 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
23 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
24 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
25 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
26 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
27 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
28 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
29 2862574272 Streptomyces sp. AcE210 Isolate Nodule
30 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
31 2867428634 Streptomyces sp. RP5T Isolate Unclassified
32 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
33 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
34 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
35 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
36 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
37 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
38 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
39 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
40 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
41 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
42 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
43 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
44 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
45 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
46 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
47 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
48 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
49 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
50 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
51 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
52 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
53 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
54 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
55 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
56 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
57 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
86 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
102 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
103 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
106 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
107 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
108 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
109 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
110 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
111 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
205 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
206 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
207 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
208 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
212 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
213 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
214 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
215 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
216 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
217 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.02
Metatranscriptomes 0.98
Isolates 20

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.95
Nodule 0.98
Rhizoplane 0.98
Rhizosphere 76.72
Stem 0
Stem Tuber 0
Unclassified 18.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10132885 3300003316 Bacteria 1512
2 rootH1_10132885 3300003323 Bacteria 4122
3 rootH2_10053425 3300003320 Bacteria 2941
4 rootH2_10149265 3300003320 Bacteria 1807
5 rootL2_10087164 3300003322 Bacteria 1342
6 rootH1_10042401 3300003323 Bacteria 3374
7 Ga0006562J51391_1185458 3300003578 Bacteria 2026
8 Ga0006562J51391_1185459 3300003578 Bacteria 1660
9 Ga0006562J51391_1189894 3300003578 Bacteria 3921
10 Ga0070668_100000299 3300005347 Bacteria 32488
11 Ga0070667_100037006 3300005367 Bacteria 4091
12 Ga0070664_100243737 3300005564 Bacteria 1614
13 Ga0068863_100148722 3300005841 Bacteria 2241
14 Ga0068862_100022074 3300005844 Bacteria 5325
15 Ga0075367_10018534 3300006178 Bacteria 3843
16 Ga0075428_100080256 3300006844 Bacteria 3560
17 Ga0075428_100137860 3300006844 Bacteria 2652
18 Ga0075431_100061286 3300006847 Bacteria 3882
19 Ga0105251_10166001 3300009011 Bacteria 995
20 Ga0105250_10024578 3300009092 Bacteria 2427
21 Ga0114129_10071323 3300009147 Bacteria 4844
22 Ga0114129_10315103 3300009147 Unclassified 2081
23 Ga0114129_10716731 3300009147 Bacteria 1284
24 Ga0105246_10009190 3300011119 Bacteria 6086
25 Ga0157369_10217709 3300013105 Bacteria 2000
26 Ga0157372_10351771 3300013307 Bacteria 1716
27 Ga0182008_10013983 3300014497 Bacteria 4208
28 Ga0157379_10071789 3300014968 Bacteria 3097
29 Ga0182007_10002380 3300015262 Bacteria 9401
30 Ga0207426_1026110 3300025302 Bacteria 1960
31 Ga0207426_1026656 3300025302 Bacteria 1932
32 Ga0207668_10000556 3300025972 Bacteria 23387
33 Ga0207668_10041080 3300025972 Bacteria 3124
34 Ga0207676_10309451 3300026095 Bacteria 1446
35 Ga0268266_10172157 3300028379 Bacteria 1966
36 Ga0268265_10146415 3300028380 Bacteria 1985
37 Ga0268264_10021095 3300028381 Bacteria 5323
38 Ga0307517_10008284 3300028786 Bacteria 14939
39 Ga0307515_10002305 3300028794 Bacteria 41711
40 Ga0307511_10002481 3300030521 Bacteria 19295
41 Ga0307512_10001914 3300030522 Bacteria 27799
42 Ga0307513_10004391 3300031456 Bacteria 18827
43 Ga0307513_10032939 3300031456 Bacteria 5834
44 Ga0307509_10009102 3300031507 Bacteria 12486
45 Ga0307509_10011455 3300031507 Bacteria 10734
46 Ga0307509_10035408 3300031507 Bacteria 5479
47 Ga0307508_10009294 3300031616 Bacteria 9046
48 Ga0307508_10018114 3300031616 Bacteria 6397
49 Ga0307514_10030219 3300031649 Bacteria 4349
50 Ga0307514_10081466 3300031649 Bacteria 2391
51 Ga0307516_10023129 3300031730 Bacteria 6376
52 Ga0307410_10066541 3300031852 Bacteria 2483
53 Ga0307406_10030567 3300031901 Bacteria 3272
54 Ga0307409_100156024 3300031995 Bacteria 1989
55 Ga0307415_100005396 3300032126 Bacteria 6783
56 Ga0307507_10030552 3300033179 Bacteria 5680
57 Ga0307507_10031400 3300033179 Bacteria 5577
58 Ga0307507_10056830 3300033179 Bacteria 3692
59 Ga0395898_0003346 3300037466 Bacteria 17988
60 Ga0395898_0015430 3300037466 Bacteria 7834
61 Ga0395905_0147316 3300037471 Bacteria 2215
62 Ga0436364_0253333 3300037853 Bacteria 10450
63 Ga0395901_0066680 3300038443 Bacteria 3749
64 Ga0439439_0004026 3300041406 Bacteria 3281
65 Ga0451793_0194435 3300041452 Bacteria 4765
66 Ga0451837_0219355 3300041494 Bacteria 3530
67 Ga0451853_2017319 3300041512 Bacteria 2906
68 Ga0439433_0001595 3300041999 Bacteria 4712
69 Ga0439448_0016092 3300042005 Bacteria 2272
70 Ga0439449_0007355 3300042007 Bacteria 4183
71 Ga0439449_0025365 3300042007 Bacteria 2216
72 Ga0439449_0042043 3300042007 Bacteria 1699
73 Ga0439457_000327 3300042014 Bacteria 13092
74 Ga0450896_003501 3300042133 Bacteria 2090
75 Ga0450903_000164 3300042138 Bacteria 14582
76 Ga0439458_0001196 3300042157 Bacteria 6603
77 Ga0466972_0012475 3300044658 Bacteria 4272
78 Ga0466972_0031326 3300044658 Bacteria 2617
79 Ga0466965_0012213 3300044683 Bacteria 4036
80 Ga0466965_0036513 3300044683 Bacteria 2411
81 Ga0466966_0032168 3300044684 Bacteria 3401
82 Ga0466963_0016926 3300044694 Bacteria 4541
83 Ga0466963_0022087 3300044694 Bacteria 4025
84 Ga0466968_0008775 3300044735 Bacteria 3877
85 Ga0466970_0027577 3300044765 Bacteria 2980
86 Ga0466970_0036040 3300044765 Bacteria 2619
87 Ga0466957_0012361 3300044842 Bacteria 4943
88 Ga0466959_0000608 3300045049 Bacteria 20897
89 Ga0466959_0090115 3300045049 Bacteria 2203
90 Ga0466958_0022548 3300045836 Bacteria 3690
91 Ga0466967_0008671 3300045976 Bacteria 7479
92 Ga0495617_026161 3300046452 Bacteria 1964
93 Ga0495627_049538 3300046453 Bacteria 1268
94 Ga0495592_0030517 3300046454 Bacteria 4077
95 Ga0495603_0012557 3300046455 Bacteria 5127
96 Ga0495603_0042146 3300046455 Bacteria 2729
97 Ga0495603_0051952 3300046455 Bacteria 2434
98 Ga0495629_0011794 3300046459 Bacteria 6341
99 Ga0495629_0015779 3300046459 Bacteria 5424
100 Ga0495629_0024457 3300046459 Bacteria 4301
101 Ga0495629_0034526 3300046459 Bacteria 3575
102 Ga0495629_0101227 3300046459 Bacteria 2011
103 Ga0495651_0007725 3300046462 Bacteria 8228
104 Ga0495651_0095016 3300046462 Bacteria 2230
105 Ga0495580_0039283 3300046472 Bacteria 3386
106 Ga0495582_0005299 3300046473 Bacteria 7201
107 Ga0495662_0003930 3300046476 Bacteria 7499
108 Ga0495662_0017599 3300046476 Bacteria 3459
109 Ga0495662_0023960 3300046476 Bacteria 2946
110 Ga0495662_0036912 3300046476 Bacteria 2358
111 Ga0495662_0040037 3300046476 Bacteria 2263
112 Ga0495664_0009272 3300046477 Bacteria 5503
113 Ga0495585_0079743 3300046492 Bacteria 1775
114 Ga0495594_0017253 3300046499 Bacteria 3812
115 Ga0495594_0121802 3300046499 Bacteria 1475
116 Ga0495606_0032326 3300046507 Bacteria 3626
117 Ga0495620_0002612 3300046515 Bacteria 10422
118 Ga0495620_0013952 3300046515 Bacteria 4098
119 Ga0495628_0028057 3300046516 Bacteria 4578
120 Ga0495628_0177737 3300046516 Bacteria 1611
121 Ga0495630_0012433 3300046517 Bacteria 6181
122 Ga0495631_0011465 3300046518 Bacteria 4356
123 Ga0495648_0048936 3300046524 Bacteria 2596
124 Ga0495652_0278360 3300046529 Bacteria 1226
125 Ga0495640_0018106 3300046533 Bacteria 5233
126 Ga0495586_0007232 3300046535 Bacteria 5923
127 Ga0495609_0030918 3300046538 Bacteria 2436
128 Ga0495597_0006887 3300046542 Bacteria 5833
129 Ga0495597_0032448 3300046542 Bacteria 2370
130 Ga0495645_0009285 3300046543 Bacteria 6880
131 Ga0495667_0180173 3300046559 Bacteria 1356
132 Ga0495668_0011861 3300046616 Bacteria 5194
133 Ga0495634_0007176 3300046642 Bacteria 8401
134 Ga0495625_0013660 3300046660 Bacteria 6513
135 Ga0495625_0032110 3300046660 Bacteria 3898
136 Ga0495635_0000778 3300046663 Bacteria 20772
137 Ga0495635_0017855 3300046663 Bacteria 4955
138 Ga0495588_0016418 3300046674 Bacteria 3578
139 Ga0495588_0038363 3300046674 Bacteria 2436
140 Ga0495657_0002550 3300046675 Bacteria 15279
141 Ga0495657_0006812 3300046675 Bacteria 8894
142 Ga0495657_0045661 3300046675 Bacteria 2971
143 Ga0495599_0107110 3300046678 Bacteria 1742
144 Ga0495646_0003309 3300046680 Bacteria 10024
145 Ga0495646_0111092 3300046680 Bacteria 1561
146 Ga0495658_0050866 3300046683 Bacteria 2345
147 Ga0495613_0003633 3300046689 Bacteria 11552
148 Ga0495613_0027410 3300046689 Bacteria 4239
149 Ga0495613_0040602 3300046689 Bacteria 3447
150 Ga0495613_0059196 3300046689 Bacteria 2808
151 Ga0495624_0026845 3300046690 Bacteria 3773
152 Ga0495671_0010586 3300046692 Bacteria 5100
153 Ga0495589_0051093 3300046794 Bacteria 2044
154 Ga0495600_0010419 3300046809 Bacteria 5771
155 Ga0495581_0008978 3300047315 Bacteria 5784
156 Ga0495581_0235007 3300047315 Bacteria 1072
157 Ga0495604_0000574 3300047317 Bacteria 32248
158 Ga0495604_0051951 3300047317 Bacteria 3175
159 Ga0495636_0013082 3300047318 Bacteria 3291
160 Ga0495636_0037615 3300047318 Bacteria 1999
161 Ga0495676_0008294 3300047321 Bacteria 9524
162 Ga0495676_0026004 3300047321 Bacteria 5043
163 Ga0495676_0058799 3300047321 Bacteria 3022
164 Ga0495680_0102778 3300047322 Bacteria 2127
165 Ga0495687_003611 3300047443 Bacteria 11057
166 Ga0495687_014403 3300047443 Bacteria 4076
167 Ga0495675_0003708 3300047444 Bacteria 9233
168 Ga0495685_007308 3300047447 Bacteria 3644
169 Ga0495685_008473 3300047447 Bacteria 3417
170 Ga0495685_010500 3300047447 Bacteria 3107
171 Ga0495685_016782 3300047447 Bacteria 2503
172 Ga0495685_028598 3300047447 Bacteria 1917
173 Ga0495681_0028443 3300047470 Bacteria 2876
174 Ga0495593_0002367 3300047673 Bacteria 11325
175 Ga0495593_0018407 3300047673 Bacteria 3924
176 Ga0495593_0028658 3300047673 Bacteria 3057
177 Ga0495602_0024526 3300048088 Bacteria 5851
178 Ga0495626_0115848 3300048091 Bacteria 1156
179 Ga0496105_0385502 3300048908 Bacteria 1115
180 Ga0496108_0000058 3300048911 Bacteria 123379
181 Ga0501031_0034429 3300049568 Bacteria 3305
182 Ga0501033_0092345 3300049570 Bacteria 2213
183 Ga0501034_0006102 3300049571 Bacteria 13009
184 Ga0501034_0008222 3300049571 Bacteria 11049
185 Ga0501034_0012768 3300049571 Bacteria 8662
186 Ga0501034_0272447 3300049571 Bacteria 1633
187 Ga0501036_0154791 3300049572 Bacteria 1933
188 Ga0501036_0251071 3300049572 Bacteria 1482
189 Ga0501037_0058132 3300049573 Bacteria 2822
190 Ga0501037_0123228 3300049573 Bacteria 1862
191 Ga0501038_0008324 3300049574 Bacteria 9544
192 Ga0501038_0016041 3300049574 Bacteria 6803
193 Ga0501038_0017829 3300049574 Bacteria 6415
194 Ga0501038_0120881 3300049574 Bacteria 2160
195 Ga0501039_0059091 3300049575 Bacteria 2970
196 Ga0501042_0040985 3300049578 Bacteria 3291
197 Ga0501042_0063353 3300049578 Bacteria 2642
198 Ga0501043_0019381 3300049579 Bacteria 5341
199 Ga0501046_0028999 3300049580 Bacteria 4503
200 Ga0501046_0130241 3300049580 Bacteria 1908
201 Ga0501046_0149570 3300049580 Bacteria 1762
202 Ga0501047_0004945 3300049581 Bacteria 12514
203 Ga0501047_0018403 3300049581 Bacteria 6697
204 Ga0501047_0032069 3300049581 Bacteria 5070
205 Ga0501047_0039358 3300049581 Bacteria 4573
206 Ga0501047_0102362 3300049581 Bacteria 2743
207 Ga0501048_0018458 3300049582 Bacteria 5128
208 Ga0501048_0019928 3300049582 Bacteria 4917
209 Ga0501048_0094955 3300049582 Bacteria 2103
210 Ga0501048_0098203 3300049582 Bacteria 2066
211 Ga0501067_0038394 3300049583 Bacteria 2658
212 Ga0501069_0019557 3300049585 Bacteria 3663
213 Ga0501070_0254653 3300049586 Bacteria 1435
214 Ga0501071_0000108 3300049587 Bacteria 32155
215 Ga0501072_0337272 3300049588 Bacteria 1197
216 Ga0501073_0016031 3300049589 Bacteria 5431
217 Ga0501073_0155328 3300049589 Bacteria 1586
218 Ga0501074_0023147 3300049590 Bacteria 4517
219 Ga0501074_0117172 3300049590 Bacteria 1905
220 Ga0501077_0023492 3300049593 Bacteria 3910
221 Ga0501080_0088430 3300049742 Bacteria 2878
222 Ga0501083_0021422 3300049744 Bacteria 4492
223 Ga0501035_0020953 3300049822 Bacteria 6007
224 Ga0501035_0080168 3300049822 Bacteria 2882
225 Ga0501035_0085027 3300049822 Bacteria 2789
226 Ga0501035_0085973 3300049822 Bacteria 2771
227 Ga0501035_0152572 3300049822 Bacteria 2004
228 Ga0501044_0006493 3300049823 Bacteria 12919
229 Ga0501044_0009569 3300049823 Bacteria 10551
230 Ga0501044_0048933 3300049823 Bacteria 4364
231 Ga0501044_0162438 3300049823 Bacteria 2209
232 Ga0501044_0205809 3300049823 Bacteria 1924
233 Ga0501044_0368449 3300049823 Bacteria 1353
234 Ga0501045_0230882 3300049824 Bacteria 1377
235 nmdc:mga06z11_26062_c1 3300050494 Bacteria 2779
236 nmdc:mga05p37_570026_c1 3300050507 Bacteria 1284
237 nmdc:mga06r32_115726_c1 3300050510 Bacteria 2641
238 Ga0495619_0065116 3300053085 Bacteria 2431
239 Ga0500644_0071979 3300053088 Bacteria 1248
240 Ga0500583_0032634 3300053092 Bacteria 2299
241 Ga0500640_000868 3300053095 Bacteria 8386
242 Ga0500553_082663 3300053101 Bacteria 1439
243 Ga0500614_010752 3300053123 Bacteria 1970
244 Ga0501084_0579088 3300054114 Bacteria 948
245 Ga0466962_0000427 3300061719 Bacteria 18221

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046559 Ga0495667_0180173 Ga0495667_0180173_415_1290 278
2 3300049593 Ga0501077_0023492 Ga0501077_0023492_71_910 279
3 3300049822 Ga0501035_0080168 Ga0501035_0080168_93_932 279
4 3300054114 Ga0501084_0579088 Ga0501084_0579088_60_899 279
5 3300009011 Ga0105251_10166001 Ga0105251_101660011 280
6 3300037471 Ga0395905_0147316 Ga0395905_0147316_1203_2126 287
7 3300046660 Ga0495625_0013660 Ga0495625_0013660_5589_6488 287
8 3300044683 Ga0466965_0036513 Ga0466965_0036513_28_939 289
9 3300041999 Ga0439433_0001595 Ga0439433_0001595_23_955 306
10 3300031456 Ga0307513_10004391 Ga0307513_100043913 309
11 3300041452 Ga0451793_0194435 Ga0451793_0194435_1578_2576 309
12 3300041512 Ga0451853_2017319 Ga0451853_2017319_523_1521 309
13 3300037853 Ga0436364_0253333 Ga0436364_0253333_4399_5466 313
14 3300031995 Ga0307409_100156024 Ga0307409_1001560242 316
15 3300013105 Ga0157369_10217709 Ga0157369_102177092 317
16 3300030521 Ga0307511_10002481 Ga0307511_1000248113 317
17 3300031507 Ga0307509_10035408 Ga0307509_100354084 317
18 3300031730 Ga0307516_10023129 Ga0307516_100231293 317
19 3300047443 Ga0495687_014403 Ga0495687_014403_2001_3005 317
20 3300009092 Ga0105250_10024578 Ga0105250_100245781 319
21 iso_pu_bacteria 2751185782 2753271649 319
22 3300005367 Ga0070667_100037006 Ga0070667_1000370062 320
23 3300005841 Ga0068863_100148722 Ga0068863_1001487222 320
24 3300014968 Ga0157379_10071789 Ga0157379_100717892 320
25 3300025972 Ga0207668_10041080 Ga0207668_100410803 320
26 3300028381 Ga0268264_10021095 Ga0268264_100210954 320
27 3300048911 Ga0496108_0000058 Ga0496108_0000058_118282_119253 320
28 iso_pu_bacteria 3006321560 3006324977 320
29 3300028379 Ga0268266_10172157 Ga0268266_101721572 321
30 3300031507 Ga0307509_10011455 Ga0307509_1001145510 321
31 3300031616 Ga0307508_10018114 Ga0307508_100181145 321
32 3300033179 Ga0307507_10031400 Ga0307507_100314003 321
33 3300033179 Ga0307507_10056830 Ga0307507_100568307 321
34 3300046459 Ga0495629_0034526 Ga0495629_0034526_1134_2138 321
35 3300046462 Ga0495651_0007725 Ga0495651_0007725_2842_3846 321
36 3300046473 Ga0495582_0005299 Ga0495582_0005299_3811_4815 321
37 3300046476 Ga0495662_0003930 Ga0495662_0003930_2663_3667 321
38 3300046477 Ga0495664_0009272 Ga0495664_0009272_3414_4418 321
39 3300046516 Ga0495628_0028057 Ga0495628_0028057_2575_3579 321
40 3300046517 Ga0495630_0012433 Ga0495630_0012433_1959_2963 321
41 3300046535 Ga0495586_0007232 Ga0495586_0007232_2055_3059 321
42 3300046543 Ga0495645_0009285 Ga0495645_0009285_3578_4582 321
43 3300046642 Ga0495634_0007176 Ga0495634_0007176_6497_7501 321
44 3300046663 Ga0495635_0000778 Ga0495635_0000778_14059_15063 321
45 3300046675 Ga0495657_0006812 Ga0495657_0006812_424_1428 321
46 3300046680 Ga0495646_0003309 Ga0495646_0003309_4672_5676 321
47 3300046683 Ga0495658_0050866 Ga0495658_0050866_133_1137 321
48 3300046689 Ga0495613_0003633 Ga0495613_0003633_5059_6063 321
49 3300046690 Ga0495624_0026845 Ga0495624_0026845_1643_2647 321
50 3300046809 Ga0495600_0010419 Ga0495600_0010419_3286_4290 321
51 3300047315 Ga0495581_0235007 Ga0495581_0235007_69_1055 321
52 3300047317 Ga0495604_0000574 Ga0495604_0000574_19988_20992 321
53 3300047321 Ga0495676_0008294 Ga0495676_0008294_3700_4704 321
54 3300047673 Ga0495593_0002367 Ga0495593_0002367_5027_6031 321
55 3300048088 Ga0495602_0024526 Ga0495602_0024526_1672_2676 321
56 3300053085 Ga0495619_0065116 Ga0495619_0065116_921_1925 321
57 3300053092 Ga0500583_0032634 Ga0500583_0032634_416_1396 321
58 3300053095 Ga0500640_000868 Ga0500640_000868_3845_4849 321
59 3300053101 Ga0500553_082663 Ga0500553_082663_188_1192 321
60 3300003320 rootH2_10149265 rootH2_101492652 322
61 iso_pu_bacteria 2767802112 2768646225 322
62 3300031852 Ga0307410_10066541 Ga0307410_100665412 323
63 3300031901 Ga0307406_10030567 Ga0307406_100305672 323
64 3300049568 Ga0501031_0034429 Ga0501031_0034429_86_1063 323
65 3300049570 Ga0501033_0092345 Ga0501033_0092345_394_1371 323
66 3300049571 Ga0501034_0008222 Ga0501034_0008222_109_1086 323
67 3300049572 Ga0501036_0251071 Ga0501036_0251071_197_1174 323
68 3300049580 Ga0501046_0130241 Ga0501046_0130241_677_1654 323
69 3300049581 Ga0501047_0039358 Ga0501047_0039358_2553_3530 323
70 3300049582 Ga0501048_0018458 Ga0501048_0018458_84_1061 323
71 3300049583 Ga0501067_0038394 Ga0501067_0038394_1473_2450 323
72 3300049585 Ga0501069_0019557 Ga0501069_0019557_740_1717 323
73 3300049586 Ga0501070_0254653 Ga0501070_0254653_82_1059 323
74 3300049587 Ga0501071_0000108 Ga0501071_0000108_17869_18846 323
75 3300049588 Ga0501072_0337272 Ga0501072_0337272_190_1167 323
76 3300049589 Ga0501073_0016031 Ga0501073_0016031_712_1689 323
77 3300049590 Ga0501074_0117172 Ga0501074_0117172_82_1059 323
78 3300049744 Ga0501083_0021422 Ga0501083_0021422_55_1032 323
79 3300049822 Ga0501035_0085027 Ga0501035_0085027_1456_2433 323
80 3300049823 Ga0501044_0048933 Ga0501044_0048933_2093_3073 323
81 3300049823 Ga0501044_0368449 Ga0501044_0368449_357_1334 323
82 3300049824 Ga0501045_0230882 Ga0501045_0230882_24_1001 323
83 iso_pu_bacteria 2675903060 2676489738 323
84 iso_pu_bacteria 2997600082 2997602137 323
85 iso_pu_bacteria 8056447290 8056452080 323
86 3300005347 Ga0070668_100000299 Ga0070668_10000029921 324
87 3300005844 Ga0068862_100022074 Ga0068862_1000220742 324
88 3300025972 Ga0207668_10000556 Ga0207668_1000055621 324
89 3300028380 Ga0268265_10146415 Ga0268265_101464152 324
90 iso_pu_bacteria 2784132148 2784587495 324
91 iso_pu_bacteria 2811994879 2812359489 324
92 iso_pu_bacteria 2811994917 2812481622 324
93 iso_pu_bacteria 2873151551 2873156924 324
94 3300005564 Ga0070664_100243737 Ga0070664_1002437372 325
95 3300031456 Ga0307513_10032939 Ga0307513_100329399 325
96 3300046459 Ga0495629_0024457 Ga0495629_0024457_1759_2763 325
97 3300046476 Ga0495662_0036912 Ga0495662_0036912_790_1794 325
98 3300046689 Ga0495613_0040602 Ga0495613_0040602_2136_3140 325
99 iso_pu_bacteria 2895442618 2895447075 325
100 iso_pu_bacteria 8053945823 8053953871 325
101 3300026095 Ga0207676_10309451 Ga0207676_103094512 326
102 3300031649 Ga0307514_10081466 Ga0307514_100814663 326
103 3300046455 Ga0495603_0042146 Ga0495603_0042146_265_1251 326
104 3300046459 Ga0495629_0011794 Ga0495629_0011794_1309_2295 326
105 3300046476 Ga0495662_0040037 Ga0495662_0040037_547_1533 326
106 3300046499 Ga0495594_0017253 Ga0495594_0017253_1590_2576 326
107 3300046674 Ga0495588_0038363 Ga0495588_0038363_1337_2323 326
108 3300046675 Ga0495657_0002550 Ga0495657_0002550_10885_11871 326
109 3300047318 Ga0495636_0013082 Ga0495636_0013082_369_1355 326
110 3300047447 Ga0495685_010500 Ga0495685_010500_2021_3001 326
111 3300048908 Ga0496105_0385502 Ga0496105_0385502_85_1071 326
112 3300053123 Ga0500614_010752 Ga0500614_010752_287_1270 326
113 iso_pu_bacteria 2643221587 2643945053 326
114 iso_pu_bacteria 2643221670 2644387288 326
115 iso_pu_bacteria 2643221677 2644431952 326
116 iso_pu_bacteria 2862574272 2862582804 326
117 iso_pu_bacteria 2918501144 2918503321 326
118 iso_pu_bacteria 2990088156 2990090920 326
119 iso_pu_bacteria 8056829672 8056836538 326
120 3300046454 Ga0495592_0030517 Ga0495592_0030517_2883_3902 327
121 3300046462 Ga0495651_0095016 Ga0495651_0095016_1132_2151 327
122 3300046516 Ga0495628_0177737 Ga0495628_0177737_356_1375 327
123 3300046529 Ga0495652_0278360 Ga0495652_0278360_191_1210 327
124 3300046663 Ga0495635_0017855 Ga0495635_0017855_3837_4856 327
125 3300046692 Ga0495671_0010586 Ga0495671_0010586_2461_3444 327
126 3300047322 Ga0495680_0102778 Ga0495680_0102778_1020_2039 327
127 iso_pu_bacteria 2643221601 2644014737 327
128 iso_pu_bacteria 2643221631 2644176173 327
129 iso_pu_bacteria 2784746763 2785344848 327
130 iso_pu_bacteria 2818991472 2819742066 327
131 iso_pu_bacteria 2862290372 2862296286 327
132 iso_pu_bacteria 2862382967 2862392150 327
133 iso_pu_bacteria 2863404153 2863406081 327
134 iso_pu_bacteria 2947224130 2947230948 327
135 iso_pu_bacteria 2990059506 2990062582 327
136 iso_pu_bacteria 3006486233 3006493822 327
137 iso_pu_bacteria 8008558824 8008562208 327
138 iso_pu_bacteria 8048406513 8048408946 327
139 3300006844 Ga0075428_100137860 Ga0075428_1001378602 328
140 3300006847 Ga0075431_100061286 Ga0075431_1000612867 328
141 3300009147 Ga0114129_10315103 Ga0114129_103151033 328
142 3300028786 Ga0307517_10008284 Ga0307517_1000828414 328
143 3300028794 Ga0307515_10002305 Ga0307515_1000230519 328
144 3300032126 Ga0307415_100005396 Ga0307415_1000053963 328
145 3300033179 Ga0307507_10030552 Ga0307507_100305524 328
146 3300046459 Ga0495629_0015779 Ga0495629_0015779_2265_3257 328
147 3300046660 Ga0495625_0032110 Ga0495625_0032110_1925_2917 328
148 3300049571 Ga0501034_0006102 Ga0501034_0006102_5268_6266 328
149 3300049574 Ga0501038_0017829 Ga0501038_0017829_581_1579 328
150 3300049575 Ga0501039_0059091 Ga0501039_0059091_1164_2162 328
151 3300049578 Ga0501042_0063353 Ga0501042_0063353_425_1423 328
152 3300049581 Ga0501047_0004945 Ga0501047_0004945_5281_6279 328
153 3300049589 Ga0501073_0155328 Ga0501073_0155328_380_1378 328
154 3300049590 Ga0501074_0023147 Ga0501074_0023147_1940_2938 328
155 3300049822 Ga0501035_0152572 Ga0501035_0152572_237_1238 328
156 3300050510 nmdc:mga06r32_115726_c1 nmdc:mga06r32_115726_c1_382_1554 328
157 iso_pu_bacteria 2547132111 2547407646 328
158 iso_pu_bacteria 2643221678 2644435880 328
159 iso_pu_bacteria 2643221714 2644632236 328
160 iso_pu_bacteria 2738543034 2739363183 328
161 iso_pu_bacteria 2784746768 2785368035 328
162 iso_pu_bacteria 2786546132 2786669088 328
163 iso_pu_bacteria 2808606359 2808840691 328
164 iso_pu_bacteria 2808606448 2809231053 328
165 iso_pu_bacteria 2862507626 2862511431 328
166 iso_pu_bacteria 2946064051 2946066430 328
167 iso_pu_bacteria 2946072368 2946074683 328
168 iso_pu_bacteria 2954673503 2954675387 328
169 iso_pu_bacteria 2954682443 2954688745 328
170 iso_pu_bacteria 2954691527 2954698521 328
171 iso_pu_bacteria 2954701450 2954703703 328
172 iso_pu_bacteria 3006493962 3006495637 328
173 iso_pu_bacteria 8023623736 8023628583 328
174 iso_pu_bacteria 8056667051 8056669717 328
175 3300047443 Ga0495687_003611 Ga0495687_003611_8827_9816 329
176 3300047447 Ga0495685_007308 Ga0495685_007308_1530_2519 329
177 iso_pu_bacteria 2582581313 2585306921 329
178 iso_pu_bacteria 2643221647 2644265440 329
179 iso_pu_bacteria 2862281513 2862288573 329
180 iso_pu_bacteria 2867428634 2867428858 329
181 iso_pu_bacteria 2877676314 2877682508 329
182 iso_pu_bacteria 2954380949 2954387709 329
183 iso_pu_bacteria 2954721474 2954727457 329
184 iso_pu_bacteria 2954731030 2954734343 329
185 iso_pu_bacteria 2954740390 2954746354 329
186 iso_pu_bacteria 2954749733 2954753226 329
187 iso_pu_bacteria 2954759201 2954765467 329
188 3300006178 Ga0075367_10018534 Ga0075367_100185342 330
189 3300006844 Ga0075428_100080256 Ga0075428_1000802563 330
190 3300009147 Ga0114129_10071323 Ga0114129_100713236 330
191 3300009147 Ga0114129_10716731 Ga0114129_107167312 330
192 3300011119 Ga0105246_10009190 Ga0105246_100091905 330
193 3300013307 Ga0157372_10351771 Ga0157372_103517711 330
194 3300014497 Ga0182008_10013983 Ga0182008_100139834 330
195 3300015262 Ga0182007_10002380 Ga0182007_100023808 330
196 3300025302 Ga0207426_1026110 Ga0207426_10261102 330
197 3300025302 Ga0207426_1026656 Ga0207426_10266562 330
198 3300031649 Ga0307514_10030219 Ga0307514_100302195 330
199 3300037466 Ga0395898_0003346 Ga0395898_0003346_11146_12198 330
200 3300037466 Ga0395898_0015430 Ga0395898_0015430_829_1821 330
201 3300038443 Ga0395901_0066680 Ga0395901_0066680_1164_2216 330
202 3300041494 Ga0451837_0219355 Ga0451837_0219355_1522_2535 330
203 3300044658 Ga0466972_0012475 Ga0466972_0012475_2352_3344 330
204 3300044683 Ga0466965_0012213 Ga0466965_0012213_1914_2906 330
205 3300044694 Ga0466963_0022087 Ga0466963_0022087_1902_2894 330
206 3300044765 Ga0466970_0036040 Ga0466970_0036040_1216_2208 330
207 3300044842 Ga0466957_0012361 Ga0466957_0012361_2047_3039 330
208 3300045049 Ga0466959_0000608 Ga0466959_0000608_19359_20351 330
209 3300045836 Ga0466958_0022548 Ga0466958_0022548_1664_2656 330
210 3300046455 Ga0495603_0012557 Ga0495603_0012557_2511_3509 330
211 3300046455 Ga0495603_0051952 Ga0495603_0051952_991_1998 330
212 3300046459 Ga0495629_0101227 Ga0495629_0101227_339_1337 330
213 3300046476 Ga0495662_0023960 Ga0495662_0023960_1609_2613 330
214 3300046499 Ga0495594_0121802 Ga0495594_0121802_128_1126 330
215 3300046674 Ga0495588_0016418 Ga0495588_0016418_1450_2454 330
216 3300046794 Ga0495589_0051093 Ga0495589_0051093_742_1749 330
217 3300047321 Ga0495676_0026004 Ga0495676_0026004_210_1217 330
218 3300047444 Ga0495675_0003708 Ga0495675_0003708_8169_9173 330
219 3300047447 Ga0495685_008473 Ga0495685_008473_971_1978 330
220 3300049572 Ga0501036_0154791 Ga0501036_0154791_370_1392 330
221 3300049574 Ga0501038_0120881 Ga0501038_0120881_370_1392 330
222 3300050494 nmdc:mga06z11_26062_c1 nmdc:mga06z11_26062_c1_79_1077 330
223 3300050507 nmdc:mga05p37_570026_c1 nmdc:mga05p37_570026_c1_164_1171 330
224 3300061719 Ga0466962_0000427 Ga0466962_0000427_11846_12838 330
225 iso_pu_bacteria 2616644814 2616694381 330
226 3300045976 Ga0466967_0008671 Ga0466967_0008671_5531_6526 331
227 3300046452 Ga0495617_026161 Ga0495617_026161_147_1160 331
228 3300046453 Ga0495627_049538 Ga0495627_049538_187_1200 331
229 3300046472 Ga0495580_0039283 Ga0495580_0039283_432_1445 331
230 3300046476 Ga0495662_0017599 Ga0495662_0017599_2141_3154 331
231 3300046492 Ga0495585_0079743 Ga0495585_0079743_100_1113 331
232 3300046507 Ga0495606_0032326 Ga0495606_0032326_267_1280 331
233 3300046515 Ga0495620_0002612 Ga0495620_0002612_7992_9005 331
234 3300046515 Ga0495620_0013952 Ga0495620_0013952_770_1783 331
235 3300046518 Ga0495631_0011465 Ga0495631_0011465_2926_3939 331
236 3300046524 Ga0495648_0048936 Ga0495648_0048936_233_1246 331
237 3300046533 Ga0495640_0018106 Ga0495640_0018106_4123_5136 331
238 3300046538 Ga0495609_0030918 Ga0495609_0030918_1354_2367 331
239 3300046542 Ga0495597_0006887 Ga0495597_0006887_249_1262 331
240 3300046542 Ga0495597_0032448 Ga0495597_0032448_1304_2317 331
241 3300046616 Ga0495668_0011861 Ga0495668_0011861_622_1635 331
242 3300046675 Ga0495657_0045661 Ga0495657_0045661_1202_2215 331
243 3300046678 Ga0495599_0107110 Ga0495599_0107110_285_1298 331
244 3300046680 Ga0495646_0111092 Ga0495646_0111092_519_1532 331
245 3300046689 Ga0495613_0027410 Ga0495613_0027410_477_1490 331
246 3300046689 Ga0495613_0059196 Ga0495613_0059196_18_1031 331
247 3300047317 Ga0495604_0051951 Ga0495604_0051951_1411_2424 331
248 3300047318 Ga0495636_0037615 Ga0495636_0037615_858_1871 331
249 3300047321 Ga0495676_0058799 Ga0495676_0058799_252_1265 331
250 3300047447 Ga0495685_028598 Ga0495685_028598_578_1591 331
251 3300047470 Ga0495681_0028443 Ga0495681_0028443_1411_2424 331
252 3300047673 Ga0495593_0018407 Ga0495593_0018407_1466_2479 331
253 3300047673 Ga0495593_0028658 Ga0495593_0028658_417_1430 331
254 3300048091 Ga0495626_0115848 Ga0495626_0115848_64_1077 331
255 3300049571 Ga0501034_0012768 Ga0501034_0012768_4521_5516 331
256 3300049574 Ga0501038_0016041 Ga0501038_0016041_3457_4452 331
257 3300049581 Ga0501047_0018403 Ga0501047_0018403_4889_5884 331
258 3300049581 Ga0501047_0032069 Ga0501047_0032069_1817_2812 331
259 3300049582 Ga0501048_0094955 Ga0501048_0094955_293_1288 331
260 3300049742 Ga0501080_0088430 Ga0501080_0088430_697_1692 331
261 3300049822 Ga0501035_0085973 Ga0501035_0085973_1179_2174 331
262 3300049823 Ga0501044_0009569 Ga0501044_0009569_67_1062 331
263 3300049823 Ga0501044_0205809 Ga0501044_0205809_96_1091 331
264 3300003578 Ga0006562J51391_1185458 Ga0006562J51391_11854582 332
265 3300003578 Ga0006562J51391_1185459 Ga0006562J51391_11854592 332
266 3300003578 Ga0006562J51391_1189894 Ga0006562J51391_11898944 332
267 3300030522 Ga0307512_10001914 Ga0307512_100019145 332
268 3300031507 Ga0307509_10009102 Ga0307509_100091023 332
269 3300031616 Ga0307508_10009294 Ga0307508_100092948 332
270 3300041406 Ga0439439_0004026 Ga0439439_0004026_942_1952 332
271 3300042005 Ga0439448_0016092 Ga0439448_0016092_1145_2146 332
272 3300042007 Ga0439449_0007355 Ga0439449_0007355_2679_3746 332
273 3300042007 Ga0439449_0025365 Ga0439449_0025365_874_1884 332
274 3300042007 Ga0439449_0042043 Ga0439449_0042043_332_1369 332
275 3300042014 Ga0439457_000327 Ga0439457_000327_9866_10876 332
276 3300042133 Ga0450896_003501 Ga0450896_003501_276_1316 332
277 3300042138 Ga0450903_000164 Ga0450903_000164_6707_7705 332
278 3300042157 Ga0439458_0001196 Ga0439458_0001196_4757_5755 332
279 3300044658 Ga0466972_0031326 Ga0466972_0031326_697_1737 332
280 3300044684 Ga0466966_0032168 Ga0466966_0032168_160_1200 332
281 3300044694 Ga0466963_0016926 Ga0466963_0016926_3452_4471 332
282 3300044735 Ga0466968_0008775 Ga0466968_0008775_362_1402 332
283 3300044765 Ga0466970_0027577 Ga0466970_0027577_1165_2298 332
284 3300045049 Ga0466959_0090115 Ga0466959_0090115_302_1342 332
285 3300047315 Ga0495581_0008978 Ga0495581_0008978_4533_5537 332
286 3300049571 Ga0501034_0272447 Ga0501034_0272447_389_1402 332
287 3300049573 Ga0501037_0058132 Ga0501037_0058132_1098_2111 332
288 3300049573 Ga0501037_0123228 Ga0501037_0123228_738_1751 332
289 3300049574 Ga0501038_0008324 Ga0501038_0008324_3131_4144 332
290 3300049578 Ga0501042_0040985 Ga0501042_0040985_1545_2558 332
291 3300049579 Ga0501043_0019381 Ga0501043_0019381_4066_5079 332
292 3300049580 Ga0501046_0028999 Ga0501046_0028999_1545_2558 332
293 3300049580 Ga0501046_0149570 Ga0501046_0149570_547_1560 332
294 3300049581 Ga0501047_0102362 Ga0501047_0102362_1040_2053 332
295 3300049582 Ga0501048_0019928 Ga0501048_0019928_412_1425 332
296 3300049582 Ga0501048_0098203 Ga0501048_0098203_818_1831 332
297 3300049822 Ga0501035_0020953 Ga0501035_0020953_4908_5921 332
298 3300049823 Ga0501044_0006493 Ga0501044_0006493_7968_8981 332
299 3300049823 Ga0501044_0162438 Ga0501044_0162438_253_1266 332
300 3300053088 Ga0500644_0071979 Ga0500644_0071979_95_1099 332
301 3300003316 rootH1_10132885 rootH1_101328852 333
302 3300003320 rootH2_10053425 rootH2_100534251 333
303 3300003322 rootL2_10087164 rootL2_100871641 333
304 3300003323 rootH1_10042401 rootH1_100424011 333
305 3300047447 Ga0495685_016782 Ga0495685_016782_714_1721 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

62

275

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j31-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-396prot) 0.8914 2 32
5x6r-assembly2.cif.gz_B crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 0.8736 1 32
5tui-assembly2.cif.gz_B crystal structure of tetracycline destructase tet(50) in complex with chlortetracycline 0.8348 1 32
2c3c-assembly1.cif.gz_A 2.01 angstrom x-ray crystal structure of a mixed disulfide between coenzyme m and nadph-dependent oxidoreductase 2-ketopropyl coenzyme m carboxylase 0.83 3 32
3pvc-assembly1.cif.gz_A crystal structure of apo mnmc from yersinia pestis 0.8273 3 35
ID Description Score Start End Superfamily
af_P9WHH3_154_271_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9079 2 33 3.50.50.60
af_O06538_2_320_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9053 2 32 3.50.50.60
af_P37906_24_389_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8629 2 35 3.50.50.60
3if9B01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8522 3 35 3.50.50.60
af_B0G160_35_582_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8463 3 33 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A5P0YZK3-F1-model_v4 Reductase 0.9964 1 302
AF-D6X889-F1-model_v4 Reductase 0.9943 1 285
AF-A0A499W294-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9939 78 330
AF-A0A5S4F6A1-F1-model_v4 Reductase 0.9912 145 331
AF-A0A2T0MW63-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9906 1 332

Feature Viewer

pLDDT pTM Quality
96.05 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map