F398162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 305 | 181 | 305 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300026035|Ga0207703_11056803|Ga0207703_110568032 |
| Length | 117 |
| Sequence | VIYGLGTDVVEIHRIEKALERWGDRFAEKVLVESELARFKAHRLAKEAFVKALGTGIRSPANWHGVWVKNLPSGKPVLEYSKALASLLKKRGVTSSHLSLSDEKGVAFATVILECEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 48 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 57 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 105 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 107 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 108 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 109 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 110 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 111 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 113 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 114 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 116 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 117 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 118 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 119 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 122 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 123 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 124 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 125 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 126 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 127 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 128 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 129 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 130 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 131 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 132 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 133 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 134 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 135 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 136 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 145 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 146 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 170 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 100 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10162379 | 3300005295 | Bacteria | 1552 |
| 2 | Ga0070683_100493191 | 3300005329 | Bacteria | 1170 |
| 3 | Ga0070683_102196376 | 3300005329 | Bacteria | 530 |
| 4 | Ga0068869_100056926 | 3300005334 | Bacteria | 2853 |
| 5 | Ga0068869_100276672 | 3300005334 | Bacteria | 1349 |
| 6 | Ga0070680_100092103 | 3300005336 | Bacteria | 2510 |
| 7 | Ga0070680_100241198 | 3300005336 | Bacteria | 1528 |
| 8 | Ga0070680_100998048 | 3300005336 | Bacteria | 723 |
| 9 | Ga0070689_100785080 | 3300005340 | Bacteria | 837 |
| 10 | Ga0070691_10140607 | 3300005341 | Bacteria | 1230 |
| 11 | Ga0070687_100154852 | 3300005343 | Bacteria | 1349 |
| 12 | Ga0070687_100367793 | 3300005343 | Bacteria | 933 |
| 13 | Ga0070692_10014602 | 3300005345 | Bacteria | 3695 |
| 14 | Ga0070692_10924360 | 3300005345 | Bacteria | 605 |
| 15 | Ga0070669_100257013 | 3300005353 | Bacteria | 1392 |
| 16 | Ga0070675_100228825 | 3300005354 | Bacteria | 1621 |
| 17 | Ga0070675_100497803 | 3300005354 | Bacteria | 1098 |
| 18 | Ga0070674_100039601 | 3300005356 | Bacteria | 3184 |
| 19 | Ga0070674_100725333 | 3300005356 | Bacteria | 852 |
| 20 | Ga0070673_101161174 | 3300005364 | Bacteria | 723 |
| 21 | Ga0070673_101813616 | 3300005364 | Bacteria | 578 |
| 22 | Ga0070688_100116955 | 3300005365 | Bacteria | 1781 |
| 23 | Ga0070714_100110391 | 3300005435 | Bacteria | 2434 |
| 24 | Ga0070701_11162168 | 3300005438 | Bacteria | 546 |
| 25 | Ga0070711_100670539 | 3300005439 | Bacteria | 871 |
| 26 | Ga0070711_100757371 | 3300005439 | Bacteria | 821 |
| 27 | Ga0070705_101176292 | 3300005440 | Bacteria | 631 |
| 28 | Ga0070700_100005092 | 3300005441 | Bacteria | 6935 |
| 29 | Ga0070694_100122660 | 3300005444 | Bacteria | 1866 |
| 30 | Ga0070681_10352923 | 3300005458 | Bacteria | 1381 |
| 31 | Ga0070681_10683108 | 3300005458 | Bacteria | 942 |
| 32 | Ga0070685_10105651 | 3300005466 | Bacteria | 1726 |
| 33 | Ga0070698_100225792 | 3300005471 | Bacteria | 1806 |
| 34 | Ga0070699_102106257 | 3300005518 | Bacteria | 515 |
| 35 | Ga0070679_101450026 | 3300005530 | Bacteria | 633 |
| 36 | Ga0070684_100030581 | 3300005535 | Bacteria | 4576 |
| 37 | Ga0070697_101502724 | 3300005536 | Bacteria | 602 |
| 38 | Ga0070672_100178685 | 3300005543 | Bacteria | 1768 |
| 39 | Ga0070672_101389594 | 3300005543 | Bacteria | 628 |
| 40 | Ga0070672_101521149 | 3300005543 | Bacteria | 600 |
| 41 | Ga0070686_100052785 | 3300005544 | Bacteria | 2594 |
| 42 | Ga0070686_100908109 | 3300005544 | Bacteria | 717 |
| 43 | Ga0070695_100066442 | 3300005545 | Bacteria | 2350 |
| 44 | Ga0070696_100076007 | 3300005546 | Bacteria | 2370 |
| 45 | Ga0070696_100080212 | 3300005546 | Bacteria | 2310 |
| 46 | Ga0070696_100285843 | 3300005546 | Bacteria | 1259 |
| 47 | Ga0070696_100550728 | 3300005546 | Bacteria | 924 |
| 48 | Ga0070696_101480073 | 3300005546 | Bacteria | 581 |
| 49 | Ga0070696_101774667 | 3300005546 | Bacteria | 533 |
| 50 | Ga0070693_100097442 | 3300005547 | Bacteria | 1785 |
| 51 | Ga0070693_100746017 | 3300005547 | Bacteria | 721 |
| 52 | Ga0070704_100087303 | 3300005549 | Bacteria | 2314 |
| 53 | Ga0070704_101481711 | 3300005549 | Bacteria | 624 |
| 54 | Ga0068855_101090984 | 3300005563 | Bacteria | 835 |
| 55 | Ga0068856_100190567 | 3300005614 | Bacteria | 2064 |
| 56 | Ga0068856_100854683 | 3300005614 | Bacteria | 929 |
| 57 | Ga0070702_100347272 | 3300005615 | Bacteria | 1044 |
| 58 | Ga0068859_100533454 | 3300005617 | Bacteria | 1268 |
| 59 | Ga0068864_100017560 | 3300005618 | Bacteria | 5964 |
| 60 | Ga0068861_100012149 | 3300005719 | Bacteria | 6001 |
| 61 | Ga0068863_102272517 | 3300005841 | Bacteria | 552 |
| 62 | Ga0068858_100009976 | 3300005842 | Bacteria | 9020 |
| 63 | Ga0068858_100861500 | 3300005842 | Bacteria | 885 |
| 64 | Ga0068858_102127325 | 3300005842 | Bacteria | 555 |
| 65 | Ga0068860_100956551 | 3300005843 | Bacteria | 874 |
| 66 | Ga0068860_101711437 | 3300005843 | Bacteria | 651 |
| 67 | Ga0068860_102456641 | 3300005843 | Bacteria | 541 |
| 68 | Ga0068862_100121086 | 3300005844 | Bacteria | 2306 |
| 69 | Ga0068862_100320550 | 3300005844 | Bacteria | 1430 |
| 70 | Ga0068862_100410418 | 3300005844 | Bacteria | 1269 |
| 71 | Ga0068862_101936726 | 3300005844 | Bacteria | 600 |
| 72 | Ga0081538_10157173 | 3300005981 | Bacteria | 1017 |
| 73 | Ga0070715_10046596 | 3300006163 | Bacteria | 1844 |
| 74 | Ga0068871_100004681 | 3300006358 | Bacteria | 9565 |
| 75 | Ga0068871_101720002 | 3300006358 | Bacteria | 595 |
| 76 | Ga0075428_100275227 | 3300006844 | Bacteria | 1811 |
| 77 | Ga0075428_101076081 | 3300006844 | Bacteria | 850 |
| 78 | Ga0075430_100064337 | 3300006846 | Bacteria | 3081 |
| 79 | Ga0075431_100009421 | 3300006847 | Bacteria | 9802 |
| 80 | Ga0075431_100344002 | 3300006847 | Bacteria | 1500 |
| 81 | Ga0075431_100489203 | 3300006847 | Bacteria | 1222 |
| 82 | Ga0075433_10007931 | 3300006852 | Bacteria | 8450 |
| 83 | Ga0075433_10182247 | 3300006852 | Bacteria | 1869 |
| 84 | Ga0075434_100000004 | 3300006871 | Bacteria | 112839 |
| 85 | Ga0075434_100002226 | 3300006871 | Bacteria | 16934 |
| 86 | Ga0075429_101573823 | 3300006880 | Bacteria | 571 |
| 87 | Ga0068865_101144826 | 3300006881 | Bacteria | 687 |
| 88 | Ga0068865_101177190 | 3300006881 | Bacteria | 678 |
| 89 | Ga0075436_100180779 | 3300006914 | Bacteria | 1491 |
| 90 | Ga0075436_101234243 | 3300006914 | Bacteria | 565 |
| 91 | Ga0097620_100533479 | 3300006931 | Bacteria | 1268 |
| 92 | Ga0075435_100000806 | 3300007076 | Bacteria | 19514 |
| 93 | Ga0075435_100024375 | 3300007076 | Bacteria | 4695 |
| 94 | Ga0075435_101592069 | 3300007076 | Bacteria | 573 |
| 95 | Ga0099794_10107965 | 3300007265 | Bacteria | 1393 |
| 96 | Ga0099795_10160140 | 3300007788 | Bacteria | 928 |
| 97 | Ga0111539_10067651 | 3300009094 | Bacteria | 4218 |
| 98 | Ga0111539_10199812 | 3300009094 | Bacteria | 2331 |
| 99 | Ga0111539_10226564 | 3300009094 | Bacteria | 2177 |
| 100 | Ga0111539_10319958 | 3300009094 | Bacteria | 1805 |
| 101 | Ga0111539_10504671 | 3300009094 | Bacteria | 1409 |
| 102 | Ga0111539_10983687 | 3300009094 | Bacteria | 981 |
| 103 | Ga0114129_10405421 | 3300009147 | Bacteria | 1796 |
| 104 | Ga0105243_10005293 | 3300009148 | Bacteria | 10086 |
| 105 | Ga0105243_11889601 | 3300009148 | Bacteria | 630 |
| 106 | Ga0105242_10188167 | 3300009176 | Bacteria | 1826 |
| 107 | Ga0105248_11149455 | 3300009177 | Bacteria | 878 |
| 108 | Ga0105249_10005738 | 3300009553 | Bacteria | 10735 |
| 109 | Ga0157378_13315698 | 3300013297 | Unclassified | 500 |
| 110 | Ga0157372_10226192 | 3300013307 | Bacteria | 2169 |
| 111 | Ga0157380_10019432 | 3300014326 | Bacteria | 5063 |
| 112 | Ga0157380_11446018 | 3300014326 | Bacteria | 739 |
| 113 | Ga0157377_10459035 | 3300014745 | Bacteria | 881 |
| 114 | Ga0157379_11304972 | 3300014968 | Bacteria | 701 |
| 115 | Ga0157376_10306561 | 3300014969 | Bacteria | 1505 |
| 116 | Ga0207642_10086513 | 3300025899 | Bacteria | 1536 |
| 117 | Ga0207688_10051243 | 3300025901 | Bacteria | 2312 |
| 118 | Ga0207680_10521979 | 3300025903 | Bacteria | 847 |
| 119 | Ga0207685_10086148 | 3300025905 | Bacteria | 1312 |
| 120 | Ga0207643_10140579 | 3300025908 | Bacteria | 1442 |
| 121 | Ga0207707_10472944 | 3300025912 | Bacteria | 1071 |
| 122 | Ga0207660_10083733 | 3300025917 | Bacteria | 2349 |
| 123 | Ga0207660_10324654 | 3300025917 | Bacteria | 1230 |
| 124 | Ga0207660_10429432 | 3300025917 | Bacteria | 1067 |
| 125 | Ga0207662_10179912 | 3300025918 | Bacteria | 1360 |
| 126 | Ga0207662_10247320 | 3300025918 | Bacteria | 1169 |
| 127 | Ga0207662_10645252 | 3300025918 | Bacteria | 739 |
| 128 | Ga0207652_11321321 | 3300025921 | Bacteria | 624 |
| 129 | Ga0207650_10722777 | 3300025925 | Bacteria | 842 |
| 130 | Ga0207659_10028933 | 3300025926 | Bacteria | 3770 |
| 131 | Ga0207687_10191710 | 3300025927 | Bacteria | 1591 |
| 132 | Ga0207664_10410498 | 3300025929 | Bacteria | 1205 |
| 133 | Ga0207706_10487028 | 3300025933 | Bacteria | 1065 |
| 134 | Ga0207670_10582557 | 3300025936 | Bacteria | 917 |
| 135 | Ga0207704_10003767 | 3300025938 | Bacteria | 6904 |
| 136 | Ga0207704_10213370 | 3300025938 | Bacteria | 1422 |
| 137 | Ga0207691_10104311 | 3300025940 | Bacteria | 2527 |
| 138 | Ga0207691_10692310 | 3300025940 | Bacteria | 860 |
| 139 | Ga0207711_11125575 | 3300025941 | Bacteria | 726 |
| 140 | Ga0207689_10033284 | 3300025942 | Bacteria | 4283 |
| 141 | Ga0207689_10325754 | 3300025942 | Bacteria | 1275 |
| 142 | Ga0207661_10022463 | 3300025944 | Bacteria | 4753 |
| 143 | Ga0207667_10907079 | 3300025949 | Bacteria | 873 |
| 144 | Ga0207712_10003362 | 3300025961 | Bacteria | 10122 |
| 145 | Ga0207668_10020270 | 3300025972 | Bacteria | 4221 |
| 146 | Ga0207703_10021862 | 3300026035 | Bacteria | 5009 |
| 147 | Ga0207703_10406568 | 3300026035 | Bacteria | 1264 |
| 148 | Ga0207703_11056803 | 3300026035 | Bacteria | 779 |
| 149 | Ga0207708_10003562 | 3300026075 | Bacteria | 11479 |
| 150 | Ga0207702_10253420 | 3300026078 | Bacteria | 1654 |
| 151 | Ga0207702_11153391 | 3300026078 | Bacteria | 769 |
| 152 | Ga0207648_10000792 | 3300026089 | Bacteria | 35602 |
| 153 | Ga0207676_10250130 | 3300026095 | Bacteria | 1595 |
| 154 | Ga0207675_100011216 | 3300026118 | Bacteria | 8392 |
| 155 | Ga0209981_1013558 | 3300027378 | Bacteria | 1134 |
| 156 | Ga0209974_10115843 | 3300027876 | Bacteria | 946 |
| 157 | Ga0207428_10030468 | 3300027907 | Bacteria | 4459 |
| 158 | Ga0207428_10054369 | 3300027907 | Bacteria | 3189 |
| 159 | Ga0268265_10002153 | 3300028380 | Bacteria | 15253 |
| 160 | Ga0268265_10300839 | 3300028380 | Bacteria | 1444 |
| 161 | Ga0268264_11109136 | 3300028381 | Bacteria | 800 |
| 162 | Ga0307408_100735391 | 3300031548 | Bacteria | 890 |
| 163 | Ga0307405_10786924 | 3300031731 | Bacteria | 796 |
| 164 | Ga0307407_10642152 | 3300031903 | Bacteria | 794 |
| 165 | Ga0307416_100185225 | 3300032002 | Bacteria | 1956 |
| 166 | Ga0307416_100272466 | 3300032002 | Bacteria | 1663 |
| 167 | Ga0307416_100376934 | 3300032002 | Bacteria | 1447 |
| 168 | Ga0307416_101613078 | 3300032002 | Bacteria | 754 |
| 169 | Ga0307416_102324214 | 3300032002 | Bacteria | 636 |
| 170 | Ga0307411_10078780 | 3300032005 | Bacteria | 2260 |
| 171 | Ga0307411_10504978 | 3300032005 | Bacteria | 1023 |
| 172 | Ga0373934_0087970 | 3300035086 | Bacteria | 1251 |
| 173 | Ga0373923_0102767 | 3300035111 | Bacteria | 1262 |
| 174 | Ga0373923_0195290 | 3300035111 | Bacteria | 934 |
| 175 | Ga0373955_0367219 | 3300035172 | Bacteria | 873 |
| 176 | Ga0373961_0012796 | 3300035241 | Bacteria | 2106 |
| 177 | Ga0373924_0270624 | 3300035410 | Bacteria | 753 |
| 178 | Ga0373931_0011345 | 3300035691 | Bacteria | 4305 |
| 179 | Ga0373931_0199823 | 3300035691 | Bacteria | 1194 |
| 180 | Ga0373931_0216653 | 3300035691 | Bacteria | 1151 |
| 181 | Ga0373931_0481257 | 3300035691 | Bacteria | 798 |
| 182 | Ga0373935_0002419 | 3300035692 | Bacteria | 10687 |
| 183 | Ga0373927_0245702 | 3300035695 | Bacteria | 1176 |
| 184 | Ga0373933_0504539 | 3300035724 | Bacteria | 793 |
| 185 | Ga0373947_0279777 | 3300035725 | Bacteria | 1109 |
| 186 | Ga0373937_0132579 | 3300036401 | Bacteria | 2328 |
| 187 | Ga0373937_0263864 | 3300036401 | Bacteria | 1624 |
| 188 | Ga0373937_1228684 | 3300036401 | Bacteria | 698 |
| 189 | Ga0373925_0032804 | 3300037068 | Bacteria | 3824 |
| 190 | Ga0242420_078737 | 3300038996 | Bacteria | 679 |
| 191 | Ga0439439_0177075 | 3300041406 | Bacteria | 613 |
| 192 | Ga0439441_008709 | 3300042001 | Bacteria | 1664 |
| 193 | Ga0439441_137926 | 3300042001 | Bacteria | 568 |
| 194 | Ga0439443_003575 | 3300042003 | Bacteria | 1971 |
| 195 | Ga0450888_028358 | 3300042126 | Bacteria | 741 |
| 196 | Ga0450902_067944 | 3300042137 | Bacteria | 620 |
| 197 | Ga0439458_0206601 | 3300042157 | Bacteria | 538 |
| 198 | Ga0439435_0006034 | 3300042436 | Bacteria | 2703 |
| 199 | Ga0439444_0005615 | 3300042437 | Bacteria | 1870 |
| 200 | Ga0439460_0000698 | 3300042461 | Bacteria | 7457 |
| 201 | Ga0450918_105624 | 3300042531 | Bacteria | 554 |
| 202 | Ga0450893_0062331 | 3300042532 | Bacteria | 713 |
| 203 | Ga0466964_0016152 | 3300044706 | Bacteria | 2847 |
| 204 | Ga0451576_0873030 | 3300045051 | Bacteria | 944 |
| 205 | Ga0466967_0026733 | 3300045976 | Bacteria | 4787 |
| 206 | Ga0495652_0117714 | 3300046529 | Bacteria | 2125 |
| 207 | Ga0495598_0209814 | 3300046537 | Bacteria | 707 |
| 208 | Ga0495621_0135357 | 3300046539 | Bacteria | 961 |
| 209 | Ga0495621_0221294 | 3300046539 | Bacteria | 766 |
| 210 | Ga0495635_0509348 | 3300046663 | Bacteria | 792 |
| 211 | Ga0495657_0458481 | 3300046675 | Bacteria | 746 |
| 212 | Ga0495623_0170478 | 3300046679 | Bacteria | 1272 |
| 213 | Ga0495669_0413245 | 3300046684 | Bacteria | 654 |
| 214 | Ga0495675_0154329 | 3300047444 | Bacteria | 1417 |
| 215 | Ga0501292_011316 | 3300049515 | Bacteria | 1349 |
| 216 | Ga0501292_098764 | 3300049515 | Bacteria | 576 |
| 217 | Ga0501298_063699 | 3300049521 | Bacteria | 785 |
| 218 | Ga0501031_0504291 | 3300049568 | Bacteria | 780 |
| 219 | Ga0501032_0834388 | 3300049569 | Bacteria | 581 |
| 220 | Ga0501033_0304975 | 3300049570 | Bacteria | 1120 |
| 221 | Ga0501036_0216232 | 3300049572 | Bacteria | 1610 |
| 222 | Ga0501038_0131892 | 3300049574 | Bacteria | 2051 |
| 223 | Ga0501038_1363394 | 3300049574 | Bacteria | 510 |
| 224 | Ga0501039_0018478 | 3300049575 | Bacteria | 5352 |
| 225 | Ga0501039_0569682 | 3300049575 | Bacteria | 888 |
| 226 | Ga0501039_1404077 | 3300049575 | Bacteria | 537 |
| 227 | Ga0501040_0008397 | 3300049576 | Bacteria | 6712 |
| 228 | Ga0501040_0052963 | 3300049576 | Bacteria | 2778 |
| 229 | Ga0501040_0058788 | 3300049576 | Bacteria | 2641 |
| 230 | Ga0501040_0147937 | 3300049576 | Bacteria | 1656 |
| 231 | Ga0501040_0418689 | 3300049576 | Bacteria | 963 |
| 232 | Ga0501040_0452706 | 3300049576 | Bacteria | 924 |
| 233 | Ga0501040_0903675 | 3300049576 | Bacteria | 640 |
| 234 | Ga0501041_0006388 | 3300049577 | Bacteria | 6897 |
| 235 | Ga0501041_0016271 | 3300049577 | Bacteria | 4422 |
| 236 | Ga0501041_0055946 | 3300049577 | Bacteria | 2409 |
| 237 | Ga0501041_0775430 | 3300049577 | Bacteria | 614 |
| 238 | Ga0501042_0048238 | 3300049578 | Bacteria | 3037 |
| 239 | Ga0501042_0230496 | 3300049578 | Bacteria | 1336 |
| 240 | Ga0501042_0863888 | 3300049578 | Bacteria | 659 |
| 241 | Ga0501046_0050181 | 3300049580 | Bacteria | 3297 |
| 242 | Ga0501048_0018109 | 3300049582 | Bacteria | 5182 |
| 243 | Ga0501048_0485027 | 3300049582 | Bacteria | 886 |
| 244 | Ga0501048_0652243 | 3300049582 | Bacteria | 756 |
| 245 | Ga0501048_1085501 | 3300049582 | Bacteria | 576 |
| 246 | Ga0501068_0176624 | 3300049584 | Bacteria | 1350 |
| 247 | Ga0501068_0592586 | 3300049584 | Bacteria | 722 |
| 248 | Ga0501068_0608816 | 3300049584 | Bacteria | 712 |
| 249 | Ga0501068_0638952 | 3300049584 | Bacteria | 694 |
| 250 | Ga0501069_0640007 | 3300049585 | Bacteria | 639 |
| 251 | Ga0501071_0001985 | 3300049587 | Bacteria | 12236 |
| 252 | Ga0501072_0001942 | 3300049588 | Bacteria | 15415 |
| 253 | Ga0501072_0003633 | 3300049588 | Bacteria | 11606 |
| 254 | Ga0501073_0077616 | 3300049589 | Bacteria | 2311 |
| 255 | Ga0501073_0848633 | 3300049589 | Bacteria | 629 |
| 256 | Ga0501074_0421862 | 3300049590 | Bacteria | 946 |
| 257 | Ga0501074_0457106 | 3300049590 | Bacteria | 905 |
| 258 | Ga0501075_0010210 | 3300049591 | Bacteria | 6594 |
| 259 | Ga0501075_0155727 | 3300049591 | Bacteria | 1742 |
| 260 | Ga0501075_0732083 | 3300049591 | Bacteria | 753 |
| 261 | Ga0501076_0000390 | 3300049592 | Bacteria | 27421 |
| 262 | Ga0501076_0080849 | 3300049592 | Bacteria | 2609 |
| 263 | Ga0501076_0549757 | 3300049592 | Bacteria | 952 |
| 264 | Ga0501077_0026854 | 3300049593 | Bacteria | 3655 |
| 265 | Ga0501077_0460602 | 3300049593 | Bacteria | 814 |
| 266 | Ga0501079_0000671 | 3300049741 | Bacteria | 22952 |
| 267 | Ga0501079_0045389 | 3300049741 | Bacteria | 3391 |
| 268 | Ga0501080_0001393 | 3300049742 | Bacteria | 20224 |
| 269 | Ga0501080_0047890 | 3300049742 | Bacteria | 3980 |
| 270 | Ga0501080_0211128 | 3300049742 | Bacteria | 1779 |
| 271 | Ga0501080_1171901 | 3300049742 | Bacteria | 661 |
| 272 | Ga0501081_0003605 | 3300049743 | Bacteria | 9900 |
| 273 | Ga0501081_0039970 | 3300049743 | Bacteria | 3211 |
| 274 | Ga0501081_0279879 | 3300049743 | Bacteria | 1221 |
| 275 | Ga0501081_0629338 | 3300049743 | Bacteria | 804 |
| 276 | Ga0501283_055143 | 3300049779 | Bacteria | 710 |
| 277 | Ga0501045_0006961 | 3300049824 | Bacteria | 7839 |
| 278 | Ga0501045_0142675 | 3300049824 | Bacteria | 1781 |
| 279 | nmdc:mga09592_453214_c1 | 3300050508 | Bacteria | 1107 |
| 280 | nmdc:mga0qj67_24839_c1 | 3300050509 | Bacteria | 4624 |
| 281 | nmdc:mga0qj67_2695_c1 | 3300050509 | Bacteria | 12739 |
| 282 | nmdc:mga0qj67_425549_c1 | 3300050509 | Bacteria | 1070 |
| 283 | nmdc:mga0qj67_884168_c1 | 3300050509 | Bacteria | 705 |
| 284 | nmdc:mga06r32_458482_c1 | 3300050510 | Bacteria | 1254 |
| 285 | nmdc:mga06r32_48672_c1 | 3300050510 | Bacteria | 4053 |
| 286 | nmdc:mga08y16_19320_c1 | 3300050511 | Bacteria | 7182 |
| 287 | nmdc:mga08y16_651186_c1 | 3300050511 | Bacteria | 1058 |
| 288 | nmdc:mga08y16_90843_c1 | 3300050511 | Bacteria | 3183 |
| 289 | nmdc:mga0n895_14255_c1 | 3300050512 | Bacteria | 7213 |
| 290 | nmdc:mga0n895_68049_c1 | 3300050512 | Bacteria | 3528 |
| 291 | nmdc:mga0rr50_12859_c1 | 3300050513 | Bacteria | 5426 |
| 292 | nmdc:mga08x19_7175_c1 | 3300050514 | Bacteria | 6621 |
| 293 | nmdc:mga08x19_9954_c1 | 3300050514 | Bacteria | 5699 |
| 294 | nmdc:mga0a205_30309_c1 | 3300050515 | Bacteria | 5178 |
| 295 | nmdc:mga0a205_839954_c1 | 3300050515 | Bacteria | 766 |
| 296 | Ga0501084_0051017 | 3300054114 | Bacteria | 3462 |
| 297 | Ga0501084_0281692 | 3300054114 | Bacteria | 1404 |
| 298 | Ga0501084_0397429 | 3300054114 | Bacteria | 1165 |
| 299 | Ga0501084_0505432 | 3300054114 | Bacteria | 1021 |
| 300 | Ga0501084_1445292 | 3300054114 | Bacteria | 576 |
| 301 | Ga0501084_1555284 | 3300054114 | Bacteria | 553 |
| 302 | Ga0501082_0033793 | 3300060353 | Bacteria | 4411 |
| 303 | Ga0501082_0270405 | 3300060353 | Bacteria | 1479 |
| 304 | Ga0530510_0006841 | 3300061734 | Bacteria | 7946 |
| 305 | Ga0530510_0564361 | 3300061734 | Bacteria | 865 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035111 | Ga0373923_0195290 | Ga0373923_0195290_107_421 | 104 |
| 2 | 3300038996 | Ga0242420_078737 | Ga0242420_078737_16_339 | 107 |
| 3 | 3300005438 | Ga0070701_11162168 | Ga0070701_111621682 | 112 |
| 4 | 3300005842 | Ga0068858_102127325 | Ga0068858_1021273252 | 117 |
| 5 | 3300026035 | Ga0207703_11056803 | Ga0207703_110568032 | 117 |
| 6 | 3300009094 | Ga0111539_10504671 | Ga0111539_105046712 | 118 |
| 7 | 3300035691 | Ga0373931_0216653 | Ga0373931_0216653_753_1109 | 118 |
| 8 | 3300041406 | Ga0439439_0177075 | Ga0439439_0177075_151_507 | 118 |
| 9 | 3300031548 | Ga0307408_100735391 | Ga0307408_1007353912 | 119 |
| 10 | 3300005329 | Ga0070683_100493191 | Ga0070683_1004931912 | 122 |
| 11 | 3300005458 | Ga0070681_10683108 | Ga0070681_106831081 | 122 |
| 12 | 3300005530 | Ga0070679_101450026 | Ga0070679_1014500261 | 122 |
| 13 | 3300013307 | Ga0157372_10226192 | Ga0157372_102261923 | 122 |
| 14 | 3300035691 | Ga0373931_0199823 | Ga0373931_0199823_325_702 | 125 |
| 15 | 3300006852 | Ga0075433_10182247 | Ga0075433_101822473 | 126 |
| 16 | 3300006871 | Ga0075434_100000004 | Ga0075434_100000004117 | 126 |
| 17 | 3300006914 | Ga0075436_101234243 | Ga0075436_1012342431 | 126 |
| 18 | 3300007076 | Ga0075435_100024375 | Ga0075435_1000243757 | 126 |
| 19 | 3300050512 | nmdc:mga0n895_68049_c1 | nmdc:mga0n895_68049_c1_2748_3128 | 126 |
| 20 | 3300050515 | nmdc:mga0a205_839954_c1 | nmdc:mga0a205_839954_c1_256_636 | 126 |
| 21 | 3300005295 | Ga0065707_10162379 | Ga0065707_101623791 | 127 |
| 22 | 3300005329 | Ga0070683_102196376 | Ga0070683_1021963761 | 127 |
| 23 | 3300005334 | Ga0068869_100056926 | Ga0068869_1000569264 | 127 |
| 24 | 3300005334 | Ga0068869_100276672 | Ga0068869_1002766722 | 127 |
| 25 | 3300005336 | Ga0070680_100092103 | Ga0070680_1000921032 | 127 |
| 26 | 3300005336 | Ga0070680_100241198 | Ga0070680_1002411981 | 127 |
| 27 | 3300005336 | Ga0070680_100998048 | Ga0070680_1009980482 | 127 |
| 28 | 3300005340 | Ga0070689_100785080 | Ga0070689_1007850802 | 127 |
| 29 | 3300005341 | Ga0070691_10140607 | Ga0070691_101406071 | 127 |
| 30 | 3300005343 | Ga0070687_100154852 | Ga0070687_1001548522 | 127 |
| 31 | 3300005343 | Ga0070687_100367793 | Ga0070687_1003677932 | 127 |
| 32 | 3300005345 | Ga0070692_10014602 | Ga0070692_100146022 | 127 |
| 33 | 3300005345 | Ga0070692_10924360 | Ga0070692_109243601 | 127 |
| 34 | 3300005353 | Ga0070669_100257013 | Ga0070669_1002570132 | 127 |
| 35 | 3300005354 | Ga0070675_100228825 | Ga0070675_1002288252 | 127 |
| 36 | 3300005354 | Ga0070675_100497803 | Ga0070675_1004978032 | 127 |
| 37 | 3300005356 | Ga0070674_100039601 | Ga0070674_1000396012 | 127 |
| 38 | 3300005356 | Ga0070674_100725333 | Ga0070674_1007253332 | 127 |
| 39 | 3300005364 | Ga0070673_101161174 | Ga0070673_1011611742 | 127 |
| 40 | 3300005364 | Ga0070673_101813616 | Ga0070673_1018136161 | 127 |
| 41 | 3300005365 | Ga0070688_100116955 | Ga0070688_1001169552 | 127 |
| 42 | 3300005435 | Ga0070714_100110391 | Ga0070714_1001103911 | 127 |
| 43 | 3300005439 | Ga0070711_100670539 | Ga0070711_1006705391 | 127 |
| 44 | 3300005439 | Ga0070711_100757371 | Ga0070711_1007573711 | 127 |
| 45 | 3300005440 | Ga0070705_101176292 | Ga0070705_1011762921 | 127 |
| 46 | 3300005441 | Ga0070700_100005092 | Ga0070700_1000050925 | 127 |
| 47 | 3300005444 | Ga0070694_100122660 | Ga0070694_1001226602 | 127 |
| 48 | 3300005458 | Ga0070681_10352923 | Ga0070681_103529232 | 127 |
| 49 | 3300005466 | Ga0070685_10105651 | Ga0070685_101056513 | 127 |
| 50 | 3300005471 | Ga0070698_100225792 | Ga0070698_1002257922 | 127 |
| 51 | 3300005518 | Ga0070699_102106257 | Ga0070699_1021062571 | 127 |
| 52 | 3300005535 | Ga0070684_100030581 | Ga0070684_1000305814 | 127 |
| 53 | 3300005536 | Ga0070697_101502724 | Ga0070697_1015027242 | 127 |
| 54 | 3300005543 | Ga0070672_100178685 | Ga0070672_1001786852 | 127 |
| 55 | 3300005543 | Ga0070672_101389594 | Ga0070672_1013895942 | 127 |
| 56 | 3300005543 | Ga0070672_101521149 | Ga0070672_1015211491 | 127 |
| 57 | 3300005544 | Ga0070686_100052785 | Ga0070686_1000527853 | 127 |
| 58 | 3300005544 | Ga0070686_100908109 | Ga0070686_1009081091 | 127 |
| 59 | 3300005545 | Ga0070695_100066442 | Ga0070695_1000664422 | 127 |
| 60 | 3300005546 | Ga0070696_100076007 | Ga0070696_1000760073 | 127 |
| 61 | 3300005546 | Ga0070696_100080212 | Ga0070696_1000802122 | 127 |
| 62 | 3300005546 | Ga0070696_100285843 | Ga0070696_1002858432 | 127 |
| 63 | 3300005546 | Ga0070696_100550728 | Ga0070696_1005507281 | 127 |
| 64 | 3300005546 | Ga0070696_101480073 | Ga0070696_1014800731 | 127 |
| 65 | 3300005546 | Ga0070696_101774667 | Ga0070696_1017746671 | 127 |
| 66 | 3300005547 | Ga0070693_100097442 | Ga0070693_1000974422 | 127 |
| 67 | 3300005547 | Ga0070693_100746017 | Ga0070693_1007460172 | 127 |
| 68 | 3300005549 | Ga0070704_100087303 | Ga0070704_1000873032 | 127 |
| 69 | 3300005549 | Ga0070704_101481711 | Ga0070704_1014817112 | 127 |
| 70 | 3300005563 | Ga0068855_101090984 | Ga0068855_1010909842 | 127 |
| 71 | 3300005614 | Ga0068856_100190567 | Ga0068856_1001905673 | 127 |
| 72 | 3300005614 | Ga0068856_100854683 | Ga0068856_1008546832 | 127 |
| 73 | 3300005615 | Ga0070702_100347272 | Ga0070702_1003472722 | 127 |
| 74 | 3300005617 | Ga0068859_100533454 | Ga0068859_1005334542 | 127 |
| 75 | 3300005618 | Ga0068864_100017560 | Ga0068864_1000175606 | 127 |
| 76 | 3300005719 | Ga0068861_100012149 | Ga0068861_1000121494 | 127 |
| 77 | 3300005841 | Ga0068863_102272517 | Ga0068863_1022725171 | 127 |
| 78 | 3300005842 | Ga0068858_100009976 | Ga0068858_1000099767 | 127 |
| 79 | 3300005842 | Ga0068858_100861500 | Ga0068858_1008615002 | 127 |
| 80 | 3300005843 | Ga0068860_100956551 | Ga0068860_1009565512 | 127 |
| 81 | 3300005843 | Ga0068860_101711437 | Ga0068860_1017114372 | 127 |
| 82 | 3300005843 | Ga0068860_102456641 | Ga0068860_1024566412 | 127 |
| 83 | 3300005844 | Ga0068862_100121086 | Ga0068862_1001210863 | 127 |
| 84 | 3300005844 | Ga0068862_100320550 | Ga0068862_1003205502 | 127 |
| 85 | 3300005844 | Ga0068862_100410418 | Ga0068862_1004104182 | 127 |
| 86 | 3300005844 | Ga0068862_101936726 | Ga0068862_1019367262 | 127 |
| 87 | 3300005981 | Ga0081538_10157173 | Ga0081538_101571732 | 127 |
| 88 | 3300006163 | Ga0070715_10046596 | Ga0070715_100465963 | 127 |
| 89 | 3300006358 | Ga0068871_100004681 | Ga0068871_1000046814 | 127 |
| 90 | 3300006358 | Ga0068871_101720002 | Ga0068871_1017200022 | 127 |
| 91 | 3300006844 | Ga0075428_100275227 | Ga0075428_1002752272 | 127 |
| 92 | 3300006844 | Ga0075428_101076081 | Ga0075428_1010760812 | 127 |
| 93 | 3300006846 | Ga0075430_100064337 | Ga0075430_1000643375 | 127 |
| 94 | 3300006847 | Ga0075431_100009421 | Ga0075431_1000094213 | 127 |
| 95 | 3300006847 | Ga0075431_100344002 | Ga0075431_1003440022 | 127 |
| 96 | 3300006847 | Ga0075431_100489203 | Ga0075431_1004892032 | 127 |
| 97 | 3300006852 | Ga0075433_10007931 | Ga0075433_100079313 | 127 |
| 98 | 3300006871 | Ga0075434_100002226 | Ga0075434_1000022263 | 127 |
| 99 | 3300006880 | Ga0075429_101573823 | Ga0075429_1015738232 | 127 |
| 100 | 3300006881 | Ga0068865_101144826 | Ga0068865_1011448262 | 127 |
| 101 | 3300006881 | Ga0068865_101177190 | Ga0068865_1011771902 | 127 |
| 102 | 3300006914 | Ga0075436_100180779 | Ga0075436_1001807792 | 127 |
| 103 | 3300006931 | Ga0097620_100533479 | Ga0097620_1005334792 | 127 |
| 104 | 3300007076 | Ga0075435_100000806 | Ga0075435_10000080623 | 127 |
| 105 | 3300007076 | Ga0075435_101592069 | Ga0075435_1015920692 | 127 |
| 106 | 3300007265 | Ga0099794_10107965 | Ga0099794_101079651 | 127 |
| 107 | 3300007788 | Ga0099795_10160140 | Ga0099795_101601402 | 127 |
| 108 | 3300009094 | Ga0111539_10067651 | Ga0111539_100676513 | 127 |
| 109 | 3300009094 | Ga0111539_10199812 | Ga0111539_101998122 | 127 |
| 110 | 3300009094 | Ga0111539_10226564 | Ga0111539_102265643 | 127 |
| 111 | 3300009094 | Ga0111539_10319958 | Ga0111539_103199583 | 127 |
| 112 | 3300009094 | Ga0111539_10983687 | Ga0111539_109836872 | 127 |
| 113 | 3300009147 | Ga0114129_10405421 | Ga0114129_104054212 | 127 |
| 114 | 3300009148 | Ga0105243_10005293 | Ga0105243_100052938 | 127 |
| 115 | 3300009148 | Ga0105243_11889601 | Ga0105243_118896011 | 127 |
| 116 | 3300009176 | Ga0105242_10188167 | Ga0105242_101881673 | 127 |
| 117 | 3300009177 | Ga0105248_11149455 | Ga0105248_111494552 | 127 |
| 118 | 3300009553 | Ga0105249_10005738 | Ga0105249_100057388 | 127 |
| 119 | 3300013297 | Ga0157378_13315698 | Ga0157378_133156982 | 127 |
| 120 | 3300014326 | Ga0157380_10019432 | Ga0157380_100194324 | 127 |
| 121 | 3300014326 | Ga0157380_11446018 | Ga0157380_114460182 | 127 |
| 122 | 3300014745 | Ga0157377_10459035 | Ga0157377_104590351 | 127 |
| 123 | 3300014968 | Ga0157379_11304972 | Ga0157379_113049722 | 127 |
| 124 | 3300014969 | Ga0157376_10306561 | Ga0157376_103065613 | 127 |
| 125 | 3300025899 | Ga0207642_10086513 | Ga0207642_100865132 | 127 |
| 126 | 3300025901 | Ga0207688_10051243 | Ga0207688_100512433 | 127 |
| 127 | 3300025903 | Ga0207680_10521979 | Ga0207680_105219791 | 127 |
| 128 | 3300025905 | Ga0207685_10086148 | Ga0207685_100861483 | 127 |
| 129 | 3300025908 | Ga0207643_10140579 | Ga0207643_101405792 | 127 |
| 130 | 3300025912 | Ga0207707_10472944 | Ga0207707_104729442 | 127 |
| 131 | 3300025917 | Ga0207660_10083733 | Ga0207660_100837332 | 127 |
| 132 | 3300025917 | Ga0207660_10324654 | Ga0207660_103246542 | 127 |
| 133 | 3300025917 | Ga0207660_10429432 | Ga0207660_104294322 | 127 |
| 134 | 3300025918 | Ga0207662_10179912 | Ga0207662_101799122 | 127 |
| 135 | 3300025918 | Ga0207662_10247320 | Ga0207662_102473202 | 127 |
| 136 | 3300025918 | Ga0207662_10645252 | Ga0207662_106452522 | 127 |
| 137 | 3300025921 | Ga0207652_11321321 | Ga0207652_113213211 | 127 |
| 138 | 3300025925 | Ga0207650_10722777 | Ga0207650_107227771 | 127 |
| 139 | 3300025926 | Ga0207659_10028933 | Ga0207659_100289332 | 127 |
| 140 | 3300025927 | Ga0207687_10191710 | Ga0207687_101917102 | 127 |
| 141 | 3300025929 | Ga0207664_10410498 | Ga0207664_104104982 | 127 |
| 142 | 3300025933 | Ga0207706_10487028 | Ga0207706_104870282 | 127 |
| 143 | 3300025936 | Ga0207670_10582557 | Ga0207670_105825572 | 127 |
| 144 | 3300025938 | Ga0207704_10003767 | Ga0207704_100037677 | 127 |
| 145 | 3300025938 | Ga0207704_10213370 | Ga0207704_102133702 | 127 |
| 146 | 3300025940 | Ga0207691_10104311 | Ga0207691_101043113 | 127 |
| 147 | 3300025940 | Ga0207691_10692310 | Ga0207691_106923102 | 127 |
| 148 | 3300025941 | Ga0207711_11125575 | Ga0207711_111255752 | 127 |
| 149 | 3300025942 | Ga0207689_10033284 | Ga0207689_100332848 | 127 |
| 150 | 3300025942 | Ga0207689_10325754 | Ga0207689_103257542 | 127 |
| 151 | 3300025944 | Ga0207661_10022463 | Ga0207661_100224632 | 127 |
| 152 | 3300025949 | Ga0207667_10907079 | Ga0207667_109070792 | 127 |
| 153 | 3300025961 | Ga0207712_10003362 | Ga0207712_1000336211 | 127 |
| 154 | 3300025972 | Ga0207668_10020270 | Ga0207668_100202706 | 127 |
| 155 | 3300026035 | Ga0207703_10021862 | Ga0207703_100218627 | 127 |
| 156 | 3300026035 | Ga0207703_10406568 | Ga0207703_104065682 | 127 |
| 157 | 3300026075 | Ga0207708_10003562 | Ga0207708_1000356210 | 127 |
| 158 | 3300026078 | Ga0207702_10253420 | Ga0207702_102534202 | 127 |
| 159 | 3300026078 | Ga0207702_11153391 | Ga0207702_111533912 | 127 |
| 160 | 3300026089 | Ga0207648_10000792 | Ga0207648_1000079226 | 127 |
| 161 | 3300026095 | Ga0207676_10250130 | Ga0207676_102501302 | 127 |
| 162 | 3300026118 | Ga0207675_100011216 | Ga0207675_1000112168 | 127 |
| 163 | 3300027378 | Ga0209981_1013558 | Ga0209981_10135582 | 127 |
| 164 | 3300027876 | Ga0209974_10115843 | Ga0209974_101158432 | 127 |
| 165 | 3300027907 | Ga0207428_10030468 | Ga0207428_100304682 | 127 |
| 166 | 3300027907 | Ga0207428_10054369 | Ga0207428_100543692 | 127 |
| 167 | 3300028380 | Ga0268265_10002153 | Ga0268265_1000215314 | 127 |
| 168 | 3300028380 | Ga0268265_10300839 | Ga0268265_103008392 | 127 |
| 169 | 3300028381 | Ga0268264_11109136 | Ga0268264_111091362 | 127 |
| 170 | 3300031731 | Ga0307405_10786924 | Ga0307405_107869242 | 127 |
| 171 | 3300031903 | Ga0307407_10642152 | Ga0307407_106421522 | 127 |
| 172 | 3300032002 | Ga0307416_100185225 | Ga0307416_1001852253 | 127 |
| 173 | 3300032002 | Ga0307416_100272466 | Ga0307416_1002724663 | 127 |
| 174 | 3300032002 | Ga0307416_100376934 | Ga0307416_1003769342 | 127 |
| 175 | 3300032002 | Ga0307416_101613078 | Ga0307416_1016130782 | 127 |
| 176 | 3300032002 | Ga0307416_102324214 | Ga0307416_1023242142 | 127 |
| 177 | 3300032005 | Ga0307411_10078780 | Ga0307411_100787803 | 127 |
| 178 | 3300032005 | Ga0307411_10504978 | Ga0307411_105049782 | 127 |
| 179 | 3300035086 | Ga0373934_0087970 | Ga0373934_0087970_42_425 | 127 |
| 180 | 3300035111 | Ga0373923_0102767 | Ga0373923_0102767_237_620 | 127 |
| 181 | 3300035172 | Ga0373955_0367219 | Ga0373955_0367219_386_769 | 127 |
| 182 | 3300035241 | Ga0373961_0012796 | Ga0373961_0012796_928_1311 | 127 |
| 183 | 3300035410 | Ga0373924_0270624 | Ga0373924_0270624_206_589 | 127 |
| 184 | 3300035691 | Ga0373931_0011345 | Ga0373931_0011345_640_1023 | 127 |
| 185 | 3300035691 | Ga0373931_0481257 | Ga0373931_0481257_45_428 | 127 |
| 186 | 3300035692 | Ga0373935_0002419 | Ga0373935_0002419_3494_3877 | 127 |
| 187 | 3300035695 | Ga0373927_0245702 | Ga0373927_0245702_143_526 | 127 |
| 188 | 3300035724 | Ga0373933_0504539 | Ga0373933_0504539_151_534 | 127 |
| 189 | 3300035725 | Ga0373947_0279777 | Ga0373947_0279777_280_663 | 127 |
| 190 | 3300036401 | Ga0373937_0132579 | Ga0373937_0132579_1213_1596 | 127 |
| 191 | 3300036401 | Ga0373937_0263864 | Ga0373937_0263864_358_741 | 127 |
| 192 | 3300036401 | Ga0373937_1228684 | Ga0373937_1228684_160_543 | 127 |
| 193 | 3300037068 | Ga0373925_0032804 | Ga0373925_0032804_3223_3606 | 127 |
| 194 | 3300042001 | Ga0439441_008709 | Ga0439441_008709_733_1116 | 127 |
| 195 | 3300042001 | Ga0439441_137926 | Ga0439441_137926_138_521 | 127 |
| 196 | 3300042003 | Ga0439443_003575 | Ga0439443_003575_1465_1848 | 127 |
| 197 | 3300042126 | Ga0450888_028358 | Ga0450888_028358_287_670 | 127 |
| 198 | 3300042137 | Ga0450902_067944 | Ga0450902_067944_177_560 | 127 |
| 199 | 3300042157 | Ga0439458_0206601 | Ga0439458_0206601_128_511 | 127 |
| 200 | 3300042436 | Ga0439435_0006034 | Ga0439435_0006034_2257_2640 | 127 |
| 201 | 3300042437 | Ga0439444_0005615 | Ga0439444_0005615_293_676 | 127 |
| 202 | 3300042461 | Ga0439460_0000698 | Ga0439460_0000698_2243_2626 | 127 |
| 203 | 3300042531 | Ga0450918_105624 | Ga0450918_105624_59_442 | 127 |
| 204 | 3300042532 | Ga0450893_0062331 | Ga0450893_0062331_206_589 | 127 |
| 205 | 3300044706 | Ga0466964_0016152 | Ga0466964_0016152_1345_1728 | 127 |
| 206 | 3300045051 | Ga0451576_0873030 | Ga0451576_0873030_325_708 | 127 |
| 207 | 3300045976 | Ga0466967_0026733 | Ga0466967_0026733_1398_1781 | 127 |
| 208 | 3300046529 | Ga0495652_0117714 | Ga0495652_0117714_479_862 | 127 |
| 209 | 3300046537 | Ga0495598_0209814 | Ga0495598_0209814_63_446 | 127 |
| 210 | 3300046539 | Ga0495621_0135357 | Ga0495621_0135357_528_911 | 127 |
| 211 | 3300046539 | Ga0495621_0221294 | Ga0495621_0221294_306_689 | 127 |
| 212 | 3300046663 | Ga0495635_0509348 | Ga0495635_0509348_323_706 | 127 |
| 213 | 3300046675 | Ga0495657_0458481 | Ga0495657_0458481_304_687 | 127 |
| 214 | 3300046679 | Ga0495623_0170478 | Ga0495623_0170478_743_1126 | 127 |
| 215 | 3300046684 | Ga0495669_0413245 | Ga0495669_0413245_166_549 | 127 |
| 216 | 3300047444 | Ga0495675_0154329 | Ga0495675_0154329_288_671 | 127 |
| 217 | 3300049515 | Ga0501292_011316 | Ga0501292_011316_645_1028 | 127 |
| 218 | 3300049515 | Ga0501292_098764 | Ga0501292_098764_50_433 | 127 |
| 219 | 3300049521 | Ga0501298_063699 | Ga0501298_063699_80_463 | 127 |
| 220 | 3300049568 | Ga0501031_0504291 | Ga0501031_0504291_293_676 | 127 |
| 221 | 3300049569 | Ga0501032_0834388 | Ga0501032_0834388_60_443 | 127 |
| 222 | 3300049570 | Ga0501033_0304975 | Ga0501033_0304975_76_459 | 127 |
| 223 | 3300049572 | Ga0501036_0216232 | Ga0501036_0216232_507_890 | 127 |
| 224 | 3300049574 | Ga0501038_0131892 | Ga0501038_0131892_1333_1716 | 127 |
| 225 | 3300049574 | Ga0501038_1363394 | Ga0501038_1363394_42_425 | 127 |
| 226 | 3300049575 | Ga0501039_0018478 | Ga0501039_0018478_1944_2327 | 127 |
| 227 | 3300049575 | Ga0501039_0569682 | Ga0501039_0569682_435_818 | 127 |
| 228 | 3300049575 | Ga0501039_1404077 | Ga0501039_1404077_120_503 | 127 |
| 229 | 3300049576 | Ga0501040_0008397 | Ga0501040_0008397_640_1023 | 127 |
| 230 | 3300049576 | Ga0501040_0052963 | Ga0501040_0052963_597_980 | 127 |
| 231 | 3300049576 | Ga0501040_0058788 | Ga0501040_0058788_963_1346 | 127 |
| 232 | 3300049576 | Ga0501040_0147937 | Ga0501040_0147937_964_1347 | 127 |
| 233 | 3300049576 | Ga0501040_0418689 | Ga0501040_0418689_239_622 | 127 |
| 234 | 3300049576 | Ga0501040_0452706 | Ga0501040_0452706_167_550 | 127 |
| 235 | 3300049576 | Ga0501040_0903675 | Ga0501040_0903675_185_568 | 127 |
| 236 | 3300049577 | Ga0501041_0006388 | Ga0501041_0006388_2067_2450 | 127 |
| 237 | 3300049577 | Ga0501041_0016271 | Ga0501041_0016271_3740_4123 | 127 |
| 238 | 3300049577 | Ga0501041_0055946 | Ga0501041_0055946_882_1265 | 127 |
| 239 | 3300049577 | Ga0501041_0775430 | Ga0501041_0775430_196_579 | 127 |
| 240 | 3300049578 | Ga0501042_0048238 | Ga0501042_0048238_2558_2941 | 127 |
| 241 | 3300049578 | Ga0501042_0230496 | Ga0501042_0230496_611_994 | 127 |
| 242 | 3300049578 | Ga0501042_0863888 | Ga0501042_0863888_101_484 | 127 |
| 243 | 3300049580 | Ga0501046_0050181 | Ga0501046_0050181_1129_1512 | 127 |
| 244 | 3300049582 | Ga0501048_0018109 | Ga0501048_0018109_875_1258 | 127 |
| 245 | 3300049582 | Ga0501048_0485027 | Ga0501048_0485027_134_517 | 127 |
| 246 | 3300049582 | Ga0501048_0652243 | Ga0501048_0652243_312_695 | 127 |
| 247 | 3300049582 | Ga0501048_1085501 | Ga0501048_1085501_59_448 | 127 |
| 248 | 3300049584 | Ga0501068_0176624 | Ga0501068_0176624_291_674 | 127 |
| 249 | 3300049584 | Ga0501068_0592586 | Ga0501068_0592586_244_627 | 127 |
| 250 | 3300049584 | Ga0501068_0608816 | Ga0501068_0608816_194_577 | 127 |
| 251 | 3300049584 | Ga0501068_0638952 | Ga0501068_0638952_123_506 | 127 |
| 252 | 3300049585 | Ga0501069_0640007 | Ga0501069_0640007_227_610 | 127 |
| 253 | 3300049587 | Ga0501071_0001985 | Ga0501071_0001985_4176_4559 | 127 |
| 254 | 3300049588 | Ga0501072_0001942 | Ga0501072_0001942_5543_5926 | 127 |
| 255 | 3300049588 | Ga0501072_0003633 | Ga0501072_0003633_9335_9718 | 127 |
| 256 | 3300049589 | Ga0501073_0077616 | Ga0501073_0077616_1822_2205 | 127 |
| 257 | 3300049589 | Ga0501073_0848633 | Ga0501073_0848633_46_429 | 127 |
| 258 | 3300049590 | Ga0501074_0421862 | Ga0501074_0421862_426_809 | 127 |
| 259 | 3300049590 | Ga0501074_0457106 | Ga0501074_0457106_448_831 | 127 |
| 260 | 3300049591 | Ga0501075_0010210 | Ga0501075_0010210_3506_3889 | 127 |
| 261 | 3300049591 | Ga0501075_0155727 | Ga0501075_0155727_502_885 | 127 |
| 262 | 3300049591 | Ga0501075_0732083 | Ga0501075_0732083_40_423 | 127 |
| 263 | 3300049592 | Ga0501076_0000390 | Ga0501076_0000390_25123_25506 | 127 |
| 264 | 3300049592 | Ga0501076_0080849 | Ga0501076_0080849_613_996 | 127 |
| 265 | 3300049592 | Ga0501076_0549757 | Ga0501076_0549757_278_661 | 127 |
| 266 | 3300049593 | Ga0501077_0026854 | Ga0501077_0026854_2203_2586 | 127 |
| 267 | 3300049593 | Ga0501077_0460602 | Ga0501077_0460602_382_765 | 127 |
| 268 | 3300049741 | Ga0501079_0000671 | Ga0501079_0000671_1959_2342 | 127 |
| 269 | 3300049741 | Ga0501079_0045389 | Ga0501079_0045389_715_1098 | 127 |
| 270 | 3300049742 | Ga0501080_0001393 | Ga0501080_0001393_19304_19687 | 127 |
| 271 | 3300049742 | Ga0501080_0047890 | Ga0501080_0047890_598_981 | 127 |
| 272 | 3300049742 | Ga0501080_0211128 | Ga0501080_0211128_937_1320 | 127 |
| 273 | 3300049742 | Ga0501080_1171901 | Ga0501080_1171901_18_401 | 127 |
| 274 | 3300049743 | Ga0501081_0003605 | Ga0501081_0003605_5377_5760 | 127 |
| 275 | 3300049743 | Ga0501081_0039970 | Ga0501081_0039970_2817_3200 | 127 |
| 276 | 3300049743 | Ga0501081_0279879 | Ga0501081_0279879_562_945 | 127 |
| 277 | 3300049743 | Ga0501081_0629338 | Ga0501081_0629338_336_719 | 127 |
| 278 | 3300049779 | Ga0501283_055143 | Ga0501283_055143_79_462 | 127 |
| 279 | 3300049824 | Ga0501045_0006961 | Ga0501045_0006961_2537_2920 | 127 |
| 280 | 3300049824 | Ga0501045_0142675 | Ga0501045_0142675_382_765 | 127 |
| 281 | 3300050508 | nmdc:mga09592_453214_c1 | nmdc:mga09592_453214_c1_617_1000 | 127 |
| 282 | 3300050509 | nmdc:mga0qj67_24839_c1 | nmdc:mga0qj67_24839_c1_2043_2426 | 127 |
| 283 | 3300050509 | nmdc:mga0qj67_2695_c1 | nmdc:mga0qj67_2695_c1_3672_4055 | 127 |
| 284 | 3300050509 | nmdc:mga0qj67_425549_c1 | nmdc:mga0qj67_425549_c1_627_1010 | 127 |
| 285 | 3300050509 | nmdc:mga0qj67_884168_c1 | nmdc:mga0qj67_884168_c1_104_487 | 127 |
| 286 | 3300050510 | nmdc:mga06r32_458482_c1 | nmdc:mga06r32_458482_c1_727_1110 | 127 |
| 287 | 3300050510 | nmdc:mga06r32_48672_c1 | nmdc:mga06r32_48672_c1_2559_2942 | 127 |
| 288 | 3300050511 | nmdc:mga08y16_19320_c1 | nmdc:mga08y16_19320_c1_2834_3217 | 127 |
| 289 | 3300050511 | nmdc:mga08y16_651186_c1 | nmdc:mga08y16_651186_c1_91_474 | 127 |
| 290 | 3300050511 | nmdc:mga08y16_90843_c1 | nmdc:mga08y16_90843_c1_1164_1547 | 127 |
| 291 | 3300050512 | nmdc:mga0n895_14255_c1 | nmdc:mga0n895_14255_c1_4761_5144 | 127 |
| 292 | 3300050513 | nmdc:mga0rr50_12859_c1 | nmdc:mga0rr50_12859_c1_4145_4528 | 127 |
| 293 | 3300050514 | nmdc:mga08x19_7175_c1 | nmdc:mga08x19_7175_c1_4336_4719 | 127 |
| 294 | 3300050514 | nmdc:mga08x19_9954_c1 | nmdc:mga08x19_9954_c1_4416_4799 | 127 |
| 295 | 3300050515 | nmdc:mga0a205_30309_c1 | nmdc:mga0a205_30309_c1_2244_2627 | 127 |
| 296 | 3300054114 | Ga0501084_0051017 | Ga0501084_0051017_3068_3451 | 127 |
| 297 | 3300054114 | Ga0501084_0281692 | Ga0501084_0281692_502_885 | 127 |
| 298 | 3300054114 | Ga0501084_0397429 | Ga0501084_0397429_47_430 | 127 |
| 299 | 3300054114 | Ga0501084_0505432 | Ga0501084_0505432_316_699 | 127 |
| 300 | 3300054114 | Ga0501084_1445292 | Ga0501084_1445292_101_484 | 127 |
| 301 | 3300054114 | Ga0501084_1555284 | Ga0501084_1555284_99_482 | 127 |
| 302 | 3300060353 | Ga0501082_0033793 | Ga0501082_0033793_871_1254 | 127 |
| 303 | 3300060353 | Ga0501082_0270405 | Ga0501082_0270405_635_1018 | 127 |
| 304 | 3300061734 | Ga0530510_0006841 | Ga0530510_0006841_2103_2486 | 127 |
| 305 | 3300061734 | Ga0530510_0564361 | Ga0530510_0564361_217_600 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5cmo-assembly1.cif.gz_B | crystal structure of holo-[acyl-carrier-protein] synthase (acps) from neisseria meningitidis | 0.9748 | 1 | 124 |
| 5xuh-assembly1.cif.gz_C | crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa | 0.961 | 1 | 124 |
| 5cmo-assembly1.cif.gz_B | crystal structure of holo-[acyl-carrier-protein] synthase (acps) from neisseria meningitidis | 0.9597 | 1 | 124 |
| 5xu7-assembly1.cif.gz_A | crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) | 0.9575 | 1 | 124 |
| 5xuh-assembly1.cif.gz_B | crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa | 0.9564 | 1 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5cmoC00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9701 | 1 | 124 | 3.90.470.20 |
| 5xuhB00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9564 | 1 | 124 | 3.90.470.20 |
| 5cmoC00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9551 | 1 | 124 | 3.90.470.20 |
| 5xuhB00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9407 | 1 | 124 | 3.90.470.20 |
| af_Q552R4_1_166_3.90.470.20 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9264 | 1 | 126 | 3.90.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6F8VE28-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9907 | 1 | 124 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-A0A3S0K3Y0-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9907 | 1 | 124 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-A0A7Y4ZYK8-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9886 | 1 | 124 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-A0A809RK48-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9863 | 1 | 126 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-B6BUJ1-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9855 | 1 | 124 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar