F398172
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 305 | 199 | 294 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300028573|Ga0265334_10247247|Ga0265334_102472472 |
| Length | 137 |
| Sequence | MANAPLRRLIDLPGIAELEDKALMKPRYADDDARSEFPEIDECSTALFGLTADEADDVPRPEGWDRIERKPVREQVDAFEVTDNKRRPLRMFGHFNVQLWLAVRGVAGSLPFHVEKEPDELKASLAKEAAIFLRNRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 2 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 3 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 4 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 5 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 6 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 7 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 8 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 9 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 10 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 65 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 99 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 102 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 103 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 104 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 109 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 110 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 111 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 112 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 113 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 114 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 115 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 122 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 123 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 124 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 125 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 126 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 155 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 156 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 157 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 158 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 159 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 160 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 163 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 164 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 165 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 166 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 167 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 168 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 169 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 170 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 171 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 172 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 173 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 174 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 175 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 176 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 177 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 178 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 179 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 180 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 181 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 182 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 183 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 184 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 185 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 186 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 187 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 188 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 189 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 190 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 191 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 192 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 193 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 194 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 195 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 196 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 197 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 198 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 199 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.39 |
| Metatranscriptomes | 0 |
| Isolates | 3.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.69 |
| Nodule | 0 |
| Rhizoplane | 2.95 |
| Rhizosphere | 71.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10128565 | 3300005327 | Bacteria | 2110 |
| 2 | Ga0070658_10223438 | 3300005327 | Bacteria | 1593 |
| 3 | Ga0070658_10232969 | 3300005327 | Bacteria | 1559 |
| 4 | Ga0070658_10314158 | 3300005327 | Bacteria | 1337 |
| 5 | Ga0070658_10493640 | 3300005327 | Bacteria | 1057 |
| 6 | Ga0070670_101191554 | 3300005331 | Unclassified | 696 |
| 7 | Ga0068869_100178877 | 3300005334 | Bacteria | 1662 |
| 8 | Ga0068869_101628952 | 3300005334 | Bacteria | 575 |
| 9 | Ga0070666_10154051 | 3300005335 | Bacteria | 1604 |
| 10 | Ga0070680_100083850 | 3300005336 | Bacteria | 2632 |
| 11 | Ga0068868_101004934 | 3300005338 | Bacteria | 763 |
| 12 | Ga0070660_100007360 | 3300005339 | Bacteria | 7669 |
| 13 | Ga0070660_100217154 | 3300005339 | Bacteria | 1553 |
| 14 | Ga0070692_10354681 | 3300005345 | Bacteria | 912 |
| 15 | Ga0070668_100000072 | 3300005347 | Bacteria | 62530 |
| 16 | Ga0070668_100005766 | 3300005347 | Bacteria | 9186 |
| 17 | Ga0070669_100236715 | 3300005353 | Bacteria | 1449 |
| 18 | Ga0070669_100328678 | 3300005353 | Bacteria | 1236 |
| 19 | Ga0070671_100008640 | 3300005355 | Bacteria | 8169 |
| 20 | Ga0070671_100024817 | 3300005355 | Bacteria | 4912 |
| 21 | Ga0070671_100127621 | 3300005355 | Bacteria | 2142 |
| 22 | Ga0070659_100070916 | 3300005366 | Bacteria | 2769 |
| 23 | Ga0070667_100017228 | 3300005367 | Bacteria | 5984 |
| 24 | Ga0070667_100041596 | 3300005367 | Bacteria | 3856 |
| 25 | Ga0070667_100469959 | 3300005367 | Unclassified | 1151 |
| 26 | Ga0070681_10029241 | 3300005458 | Bacteria | 5532 |
| 27 | Ga0070679_100005491 | 3300005530 | Bacteria | 11751 |
| 28 | Ga0070679_101310455 | 3300005530 | Unclassified | 670 |
| 29 | Ga0068853_100020057 | 3300005539 | Bacteria | 5555 |
| 30 | Ga0068853_100752913 | 3300005539 | Bacteria | 931 |
| 31 | Ga0070665_100000176 | 3300005548 | Bacteria | 113398 |
| 32 | Ga0070665_100056184 | 3300005548 | Bacteria | 3947 |
| 33 | Ga0070665_100536436 | 3300005548 | Bacteria | 1182 |
| 34 | Ga0070665_102657604 | 3300005548 | Bacteria | 501 |
| 35 | Ga0068855_100010885 | 3300005563 | Bacteria | 10980 |
| 36 | Ga0068857_100599449 | 3300005577 | Bacteria | 1041 |
| 37 | Ga0068854_100083067 | 3300005578 | Bacteria | 2368 |
| 38 | Ga0068856_101032879 | 3300005614 | Bacteria | 840 |
| 39 | Ga0068859_100005357 | 3300005617 | Bacteria | 13054 |
| 40 | Ga0068859_100060864 | 3300005617 | Bacteria | 3804 |
| 41 | Ga0068864_100446625 | 3300005618 | Bacteria | 1236 |
| 42 | Ga0068864_101092297 | 3300005618 | Bacteria | 794 |
| 43 | Ga0068861_100232890 | 3300005719 | Bacteria | 1563 |
| 44 | Ga0068861_100735635 | 3300005719 | Bacteria | 920 |
| 45 | Ga0068863_100006189 | 3300005841 | Bacteria | 11737 |
| 46 | Ga0068858_100048907 | 3300005842 | Bacteria | 3916 |
| 47 | Ga0068860_100000032 | 3300005843 | Bacteria | 251624 |
| 48 | Ga0068860_100124240 | 3300005843 | Bacteria | 2473 |
| 49 | Ga0068860_100656920 | 3300005843 | Bacteria | 1056 |
| 50 | Ga0068862_100000644 | 3300005844 | Bacteria | 36054 |
| 51 | Ga0068862_100056849 | 3300005844 | Bacteria | 3353 |
| 52 | Ga0068862_101058490 | 3300005844 | Bacteria | 805 |
| 53 | Ga0070717_10287344 | 3300006028 | Bacteria | 1460 |
| 54 | Ga0075365_10319219 | 3300006038 | Bacteria | 1094 |
| 55 | Ga0075368_10001687 | 3300006042 | Bacteria | 7093 |
| 56 | Ga0075364_10003820 | 3300006051 | Bacteria | 8623 |
| 57 | Ga0075367_10006644 | 3300006178 | Bacteria | 5863 |
| 58 | Ga0075369_10205589 | 3300006186 | Bacteria | 909 |
| 59 | Ga0075366_10020258 | 3300006195 | Bacteria | 3857 |
| 60 | Ga0075370_10001352 | 3300006353 | Bacteria | 10559 |
| 61 | Ga0075370_10509481 | 3300006353 | Bacteria | 726 |
| 62 | Ga0068865_100001189 | 3300006881 | Bacteria | 15136 |
| 63 | Ga0097620_100005357 | 3300006931 | Bacteria | 13054 |
| 64 | Ga0097620_100060862 | 3300006931 | Bacteria | 3804 |
| 65 | Ga0105240_10006128 | 3300009093 | Bacteria | 17734 |
| 66 | Ga0105240_10008257 | 3300009093 | Bacteria | 14906 |
| 67 | Ga0105240_10098492 | 3300009093 | Bacteria | 3561 |
| 68 | Ga0105240_10159299 | 3300009093 | Bacteria | 2683 |
| 69 | Ga0105240_11454700 | 3300009093 | Bacteria | 719 |
| 70 | Ga0105240_11680920 | 3300009093 | Bacteria | 663 |
| 71 | Ga0105245_11067538 | 3300009098 | Bacteria | 853 |
| 72 | Ga0105245_12005921 | 3300009098 | Bacteria | 632 |
| 73 | Ga0105247_10207249 | 3300009101 | Bacteria | 1320 |
| 74 | Ga0105247_10358595 | 3300009101 | Bacteria | 1027 |
| 75 | Ga0105241_10552254 | 3300009174 | Bacteria | 1034 |
| 76 | Ga0105241_11004443 | 3300009174 | Bacteria | 781 |
| 77 | Ga0105241_12002779 | 3300009174 | Bacteria | 570 |
| 78 | Ga0105242_10758891 | 3300009176 | Bacteria | 956 |
| 79 | Ga0105242_10861831 | 3300009176 | Bacteria | 902 |
| 80 | Ga0105248_10001071 | 3300009177 | Bacteria | 30268 |
| 81 | Ga0105248_10005911 | 3300009177 | Bacteria | 13452 |
| 82 | Ga0105248_11793150 | 3300009177 | Bacteria | 696 |
| 83 | Ga0105238_10186939 | 3300009551 | Bacteria | 2048 |
| 84 | Ga0105238_10274766 | 3300009551 | Bacteria | 1665 |
| 85 | Ga0105238_10347894 | 3300009551 | Bacteria | 1471 |
| 86 | Ga0105238_12064051 | 3300009551 | Bacteria | 604 |
| 87 | Ga0105238_12768098 | 3300009551 | Archaea | 527 |
| 88 | Ga0105249_12744881 | 3300009553 | Bacteria | 564 |
| 89 | Ga0105239_10045681 | 3300010375 | Bacteria | 4800 |
| 90 | Ga0105239_10464300 | 3300010375 | Bacteria | 1437 |
| 91 | Ga0163162_10202761 | 3300013306 | Bacteria | 2113 |
| 92 | Ga0163162_10407904 | 3300013306 | Bacteria | 1491 |
| 93 | Ga0163162_12375162 | 3300013306 | Bacteria | 609 |
| 94 | Ga0157375_10343588 | 3300013308 | Bacteria | 1658 |
| 95 | Ga0163163_10021342 | 3300014325 | Bacteria | 6110 |
| 96 | Ga0163163_10103443 | 3300014325 | Bacteria | 2872 |
| 97 | Ga0157379_10064431 | 3300014968 | Bacteria | 3275 |
| 98 | Ga0157376_10840587 | 3300014969 | Bacteria | 933 |
| 99 | Ga0182007_10109692 | 3300015262 | Bacteria | 917 |
| 100 | Ga0213872_10015499 | 3300021361 | Bacteria | 3542 |
| 101 | Ga0207645_10836895 | 3300025907 | Bacteria | 625 |
| 102 | Ga0207705_10000525 | 3300025909 | Bacteria | 32608 |
| 103 | Ga0207705_10326078 | 3300025909 | Bacteria | 1180 |
| 104 | Ga0207705_10922228 | 3300025909 | Bacteria | 676 |
| 105 | Ga0207707_10083212 | 3300025912 | Bacteria | 2794 |
| 106 | Ga0207695_10003533 | 3300025913 | Bacteria | 21899 |
| 107 | Ga0207695_10004836 | 3300025913 | Bacteria | 18184 |
| 108 | Ga0207695_10086815 | 3300025913 | Bacteria | 3153 |
| 109 | Ga0207660_10001073 | 3300025917 | Bacteria | 18191 |
| 110 | Ga0207657_10001371 | 3300025919 | Bacteria | 25987 |
| 111 | Ga0207657_10103672 | 3300025919 | Bacteria | 2357 |
| 112 | Ga0207652_10010559 | 3300025921 | Bacteria | 7433 |
| 113 | Ga0207681_10077461 | 3300025923 | Bacteria | 2337 |
| 114 | Ga0207681_10465752 | 3300025923 | Unclassified | 1030 |
| 115 | Ga0207694_10108229 | 3300025924 | Bacteria | 2208 |
| 116 | Ga0207694_10412950 | 3300025924 | Bacteria | 1124 |
| 117 | Ga0207694_10487548 | 3300025924 | Bacteria | 1031 |
| 118 | Ga0207694_10920261 | 3300025924 | Bacteria | 739 |
| 119 | Ga0207650_10020185 | 3300025925 | Bacteria | 4696 |
| 120 | Ga0207650_10282599 | 3300025925 | Bacteria | 1352 |
| 121 | Ga0207650_10452762 | 3300025925 | Bacteria | 1068 |
| 122 | Ga0207687_11127308 | 3300025927 | Unclassified | 674 |
| 123 | Ga0207644_10011096 | 3300025931 | Bacteria | 5953 |
| 124 | Ga0207690_10081441 | 3300025932 | Bacteria | 2262 |
| 125 | Ga0207686_10485052 | 3300025934 | Bacteria | 956 |
| 126 | Ga0207704_10000668 | 3300025938 | Bacteria | 15195 |
| 127 | Ga0207711_10000434 | 3300025941 | Bacteria | 43493 |
| 128 | Ga0207711_10008323 | 3300025941 | Bacteria | 8683 |
| 129 | Ga0207689_10127644 | 3300025942 | Bacteria | 2092 |
| 130 | Ga0207667_10004763 | 3300025949 | Bacteria | 16596 |
| 131 | Ga0207712_11098893 | 3300025961 | Bacteria | 708 |
| 132 | Ga0207668_10004234 | 3300025972 | Bacteria | 8412 |
| 133 | Ga0207668_10005371 | 3300025972 | Bacteria | 7538 |
| 134 | Ga0207668_10084728 | 3300025972 | Bacteria | 2310 |
| 135 | Ga0207658_10027873 | 3300025986 | Bacteria | 3973 |
| 136 | Ga0207703_10033865 | 3300026035 | Bacteria | 4051 |
| 137 | Ga0207703_10034177 | 3300026035 | Bacteria | 4034 |
| 138 | Ga0207639_10065017 | 3300026041 | Bacteria | 2830 |
| 139 | Ga0207639_10555299 | 3300026041 | Bacteria | 1055 |
| 140 | Ga0207702_11060800 | 3300026078 | Bacteria | 804 |
| 141 | Ga0207641_10002251 | 3300026088 | Bacteria | 18000 |
| 142 | Ga0207641_11458517 | 3300026088 | Bacteria | 686 |
| 143 | Ga0207676_10446488 | 3300026095 | Bacteria | 1218 |
| 144 | Ga0207676_10909221 | 3300026095 | Bacteria | 864 |
| 145 | Ga0207674_10345532 | 3300026116 | Bacteria | 1438 |
| 146 | Ga0207675_100081065 | 3300026118 | Bacteria | 3042 |
| 147 | Ga0207675_100412871 | 3300026118 | Bacteria | 1332 |
| 148 | Ga0207675_100857078 | 3300026118 | Bacteria | 924 |
| 149 | Ga0207698_11495984 | 3300026142 | Bacteria | 690 |
| 150 | Ga0209813_10066185 | 3300027866 | Bacteria | 1165 |
| 151 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 152 | Ga0268265_10001386 | 3300028380 | Bacteria | 20547 |
| 153 | Ga0268265_10515502 | 3300028380 | Bacteria | 1129 |
| 154 | Ga0268265_10838687 | 3300028380 | Bacteria | 898 |
| 155 | Ga0268264_10000045 | 3300028381 | Bacteria | 364764 |
| 156 | Ga0268264_10862584 | 3300028381 | Bacteria | 907 |
| 157 | Ga0265334_10247247 | 3300028573 | Bacteria | 614 |
| 158 | Ga0307517_10070835 | 3300028786 | Bacteria | 3134 |
| 159 | Ga0265338_10039888 | 3300028800 | Bacteria | 4420 |
| 160 | Ga0265338_10055307 | 3300028800 | Bacteria | 3531 |
| 161 | Ga0265338_10067783 | 3300028800 | Bacteria | 3079 |
| 162 | Ga0265338_10146118 | 3300028800 | Bacteria | 1844 |
| 163 | Ga0265338_10241591 | 3300028800 | Bacteria | 1337 |
| 164 | Ga0265329_10349416 | 3300031242 | Bacteria | 506 |
| 165 | Ga0265340_10024950 | 3300031247 | Bacteria | 3033 |
| 166 | Ga0265327_10001920 | 3300031251 | Bacteria | 23989 |
| 167 | Ga0265327_10054026 | 3300031251 | Bacteria | 2081 |
| 168 | Ga0265327_10115274 | 3300031251 | Bacteria | 1279 |
| 169 | Ga0307513_10010389 | 3300031456 | Bacteria | 11673 |
| 170 | Ga0307513_10017686 | 3300031456 | Bacteria | 8539 |
| 171 | Ga0307513_10626335 | 3300031456 | Bacteria | 784 |
| 172 | Ga0307408_100198845 | 3300031548 | Bacteria | 1621 |
| 173 | Ga0307508_10417072 | 3300031616 | Bacteria | 934 |
| 174 | Ga0265314_10081746 | 3300031711 | Bacteria | 2127 |
| 175 | Ga0307516_10000022 | 3300031730 | Bacteria | 191854 |
| 176 | Ga0307413_10639755 | 3300031824 | Bacteria | 876 |
| 177 | Ga0307510_10282954 | 3300033180 | Bacteria | 1128 |
| 178 | Ga0373936_0032533 | 3300035113 | Bacteria | 2063 |
| 179 | Ga0373939_0093691 | 3300035114 | Bacteria | 1019 |
| 180 | Ga0373931_0123387 | 3300035691 | Bacteria | 1483 |
| 181 | Ga0373933_0378571 | 3300035724 | Bacteria | 922 |
| 182 | Ga0373937_0456261 | 3300036401 | Bacteria | 1214 |
| 183 | Ga0373937_1620204 | 3300036401 | Bacteria | 594 |
| 184 | Ga0373925_0163820 | 3300037068 | Bacteria | 1753 |
| 185 | Ga0373925_1020624 | 3300037068 | Bacteria | 681 |
| 186 | Ga0395899_0000016 | 3300037312 | Bacteria | 468322 |
| 187 | Ga0395899_0152194 | 3300037312 | Bacteria | 1638 |
| 188 | Ga0395900_0114841 | 3300037418 | Bacteria | 2763 |
| 189 | Ga0395898_0112454 | 3300037466 | Bacteria | 2610 |
| 190 | Ga0395905_0132007 | 3300037471 | Bacteria | 2349 |
| 191 | Ga0395905_0496872 | 3300037471 | Bacteria | 1120 |
| 192 | Ga0436365_0487284 | 3300039437 | Bacteria | 1281 |
| 193 | Ga0436365_1504068 | 3300039437 | Bacteria | 1435 |
| 194 | Ga0436361_0195157 | 3300039447 | Bacteria | 6146 |
| 195 | Ga0436361_0250096 | 3300039447 | Bacteria | 1607 |
| 196 | Ga0436361_0903973 | 3300039447 | Bacteria | 1017 |
| 197 | Ga0436361_1168976 | 3300039447 | Bacteria | 1698 |
| 198 | Ga0436361_1192202 | 3300039447 | Bacteria | 1521 |
| 199 | Ga0439431_0045374 | 3300041997 | Bacteria | 1129 |
| 200 | Ga0439445_0068822 | 3300042004 | Bacteria | 977 |
| 201 | Ga0466959_0330390 | 3300045049 | Bacteria | 1041 |
| 202 | Ga0495638_0134601 | 3300046460 | Bacteria | 1449 |
| 203 | Ga0495580_0860212 | 3300046472 | Bacteria | 585 |
| 204 | Ga0495606_0654294 | 3300046507 | Bacteria | 508 |
| 205 | Ga0495620_0146222 | 3300046515 | Unclassified | 923 |
| 206 | Ga0495620_0200046 | 3300046515 | Bacteria | 769 |
| 207 | Ga0495628_0331727 | 3300046516 | Bacteria | 1121 |
| 208 | Ga0495637_0086036 | 3300046520 | Bacteria | 1247 |
| 209 | Ga0495637_0337563 | 3300046520 | Bacteria | 530 |
| 210 | Ga0495643_0013207 | 3300046522 | Bacteria | 4952 |
| 211 | Ga0495648_0293032 | 3300046524 | Bacteria | 766 |
| 212 | Ga0495642_0039794 | 3300046528 | Bacteria | 1908 |
| 213 | Ga0495652_0111643 | 3300046529 | Bacteria | 2198 |
| 214 | Ga0495609_0072338 | 3300046538 | Bacteria | 1514 |
| 215 | Ga0495597_0002237 | 3300046542 | Bacteria | 12636 |
| 216 | Ga0495597_0259012 | 3300046542 | Bacteria | 682 |
| 217 | Ga0495622_0005534 | 3300046557 | Bacteria | 5855 |
| 218 | Ga0495668_0124980 | 3300046616 | Bacteria | 1408 |
| 219 | Ga0495668_0216416 | 3300046616 | Bacteria | 1049 |
| 220 | Ga0495611_0005668 | 3300046648 | Bacteria | 5329 |
| 221 | Ga0495625_0099276 | 3300046660 | Bacteria | 2002 |
| 222 | Ga0495625_0214177 | 3300046660 | Bacteria | 1265 |
| 223 | Ga0495635_0215095 | 3300046663 | Bacteria | 1301 |
| 224 | Ga0495669_0000005 | 3300046684 | Bacteria | 193971 |
| 225 | Ga0495613_0001199 | 3300046689 | Bacteria | 19784 |
| 226 | Ga0495624_0537736 | 3300046690 | Bacteria | 698 |
| 227 | Ga0495581_0041881 | 3300047315 | Bacteria | 2651 |
| 228 | Ga0495672_0055520 | 3300047320 | Bacteria | 2311 |
| 229 | Ga0495687_037418 | 3300047443 | Bacteria | 2162 |
| 230 | Ga0495677_0221076 | 3300047445 | Unclassified | 738 |
| 231 | Ga0495686_0053022 | 3300047472 | Bacteria | 2542 |
| 232 | Ga0495593_0001938 | 3300047673 | Bacteria | 12334 |
| 233 | Ga0495615_0005446 | 3300048090 | Bacteria | 2290 |
| 234 | Ga0496101_0410711 | 3300048904 | Unclassified | 1067 |
| 235 | Ga0496106_0744487 | 3300048909 | Bacteria | 779 |
| 236 | Ga0496112_0199421 | 3300048915 | Bacteria | 1961 |
| 237 | Ga0496114_1547835 | 3300048917 | Bacteria | 551 |
| 238 | Ga0496115_0002327 | 3300048918 | Bacteria | 13618 |
| 239 | Ga0496115_0014726 | 3300048918 | Bacteria | 5925 |
| 240 | Ga0496115_0020272 | 3300048918 | Bacteria | 5128 |
| 241 | Ga0496115_0152281 | 3300048918 | Bacteria | 1910 |
| 242 | Ga0496115_0152688 | 3300048918 | Bacteria | 1907 |
| 243 | Ga0496119_0028053 | 3300048922 | Bacteria | 3853 |
| 244 | Ga0496121_0000035 | 3300048924 | Bacteria | 374316 |
| 245 | Ga0501036_0711304 | 3300049572 | Unclassified | 830 |
| 246 | Ga0501044_0095010 | 3300049823 | Bacteria | 3005 |
| 247 | nmdc:mga03683_24666_c1 | 3300050489 | Bacteria | 2355 |
| 248 | nmdc:mga03n38_772312_c1 | 3300050490 | Bacteria | 558 |
| 249 | nmdc:mga00v17_6139_c1 | 3300050491 | Bacteria | 6011 |
| 250 | nmdc:mga0k408_121091_c1 | 3300050493 | Bacteria | 1550 |
| 251 | nmdc:mga06z11_12913_c1 | 3300050494 | Bacteria | 3648 |
| 252 | nmdc:mga04h51_78846_c1 | 3300050495 | Bacteria | 1165 |
| 253 | nmdc:mga07m45_287780_c1 | 3300050496 | Bacteria | 956 |
| 254 | nmdc:mga07m45_37190_c1 | 3300050496 | Bacteria | 2715 |
| 255 | nmdc:mga0sz30_215700_c1 | 3300050516 | Bacteria | 853 |
| 256 | Ga0500643_000303 | 3300053087 | Bacteria | 41173 |
| 257 | Ga0500643_007630 | 3300053087 | Bacteria | 4334 |
| 258 | Ga0500643_011376 | 3300053087 | Bacteria | 3250 |
| 259 | Ga0500643_012886 | 3300053087 | Bacteria | 2979 |
| 260 | Ga0500647_0015544 | 3300053091 | Bacteria | 3483 |
| 261 | Ga0500583_0019914 | 3300053092 | Bacteria | 2760 |
| 262 | Ga0500651_0030693 | 3300053093 | Bacteria | 3383 |
| 263 | Ga0500566_0043523 | 3300053094 | Bacteria | 2587 |
| 264 | Ga0500641_0000212 | 3300053096 | Bacteria | 21879 |
| 265 | Ga0500650_0351679 | 3300053098 | Unclassified | 644 |
| 266 | Ga0500555_002048 | 3300053103 | Bacteria | 5931 |
| 267 | Ga0500556_0013744 | 3300053104 | Bacteria | 2457 |
| 268 | Ga0500569_005407 | 3300053109 | Bacteria | 2745 |
| 269 | Ga0500572_000611 | 3300053111 | Bacteria | 12013 |
| 270 | Ga0500572_035931 | 3300053111 | Bacteria | 1412 |
| 271 | Ga0500595_007611 | 3300053119 | Bacteria | 4484 |
| 272 | Ga0500597_110244 | 3300053120 | Bacteria | 1195 |
| 273 | Ga0500607_108730 | 3300053121 | Bacteria | 1363 |
| 274 | Ga0500608_023326 | 3300053122 | Bacteria | 2879 |
| 275 | Ga0500614_004094 | 3300053123 | Bacteria | 3100 |
| 276 | Ga0500614_034957 | 3300053123 | Bacteria | 1250 |
| 277 | Ga0500642_0032633 | 3300053130 | Bacteria | 2186 |
| 278 | Ga0500642_0335869 | 3300053130 | Bacteria | 674 |
| 279 | Ga0500658_0026869 | 3300053134 | Bacteria | 2221 |
| 280 | Ga0500559_0000042 | 3300053136 | Bacteria | 101570 |
| 281 | Ga0500559_0021561 | 3300053136 | Bacteria | 2731 |
| 282 | Ga0500590_001960 | 3300053148 | Bacteria | 8846 |
| 283 | Ga0500616_0033516 | 3300053153 | Bacteria | 2802 |
| 284 | Ga0500619_002786 | 3300053154 | Bacteria | 3444 |
| 285 | Ga0500620_097471 | 3300053155 | Bacteria | 1027 |
| 286 | Ga0500622_0022034 | 3300053156 | Bacteria | 3380 |
| 287 | Ga0500622_0033092 | 3300053156 | Bacteria | 2710 |
| 288 | Ga0500636_0011176 | 3300053177 | Bacteria | 5253 |
| 289 | Ga0500636_0088154 | 3300053177 | Bacteria | 1780 |
| 290 | Ga0500637_0047943 | 3300053178 | Bacteria | 2428 |
| 291 | Ga0500576_169291 | 3300053725 | Bacteria | 788 |
| 292 | Ga0500625_040729 | 3300053729 | Bacteria | 2185 |
| 293 | Ga0500552_005238 | 3300053733 | Unclassified | 1404 |
| 294 | Ga0500596_007428 | 3300053735 | Bacteria | 1796 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009176 | Ga0105242_10861831 | Ga0105242_108618311 | 132 |
| 2 | iso_pu_bacteria | 2643221614 | 2644088220 | 134 |
| 3 | iso_pu_bacteria | 2643221661 | 2644343458 | 134 |
| 4 | iso_pu_bacteria | 2643221666 | 2644369065 | 134 |
| 5 | 3300028573 | Ga0265334_10247247 | Ga0265334_102472472 | 135 |
| 6 | 3300031251 | Ga0265327_10115274 | Ga0265327_101152742 | 135 |
| 7 | 3300031711 | Ga0265314_10081746 | Ga0265314_100817463 | 135 |
| 8 | 3300013308 | Ga0157375_10343588 | Ga0157375_103435882 | 136 |
| 9 | 3300053087 | Ga0500643_011376 | Ga0500643_011376_360_785 | 136 |
| 10 | 3300053096 | Ga0500641_0000212 | Ga0500641_0000212_2185_2610 | 136 |
| 11 | iso_pu_bacteria | 2643221598 | 2644001441 | 137 |
| 12 | 3300005327 | Ga0070658_10493640 | Ga0070658_104936401 | 138 |
| 13 | 3300005338 | Ga0068868_101004934 | Ga0068868_1010049342 | 138 |
| 14 | 3300005530 | Ga0070679_101310455 | Ga0070679_1013104552 | 138 |
| 15 | 3300009093 | Ga0105240_11454700 | Ga0105240_114547002 | 138 |
| 16 | 3300009551 | Ga0105238_10186939 | Ga0105238_101869392 | 138 |
| 17 | 3300013306 | Ga0163162_12375162 | Ga0163162_123751622 | 138 |
| 18 | 3300025907 | Ga0207645_10836895 | Ga0207645_108368952 | 138 |
| 19 | 3300025909 | Ga0207705_10922228 | Ga0207705_109222282 | 138 |
| 20 | 3300025924 | Ga0207694_10412950 | Ga0207694_104129502 | 138 |
| 21 | 3300037312 | Ga0395899_0152194 | Ga0395899_0152194_1179_1607 | 138 |
| 22 | 3300037418 | Ga0395900_0114841 | Ga0395900_0114841_1481_1909 | 138 |
| 23 | 3300037466 | Ga0395898_0112454 | Ga0395898_0112454_588_1016 | 138 |
| 24 | 3300037471 | Ga0395905_0132007 | Ga0395905_0132007_500_928 | 138 |
| 25 | 3300046529 | Ga0495652_0111643 | Ga0495652_0111643_781_1209 | 138 |
| 26 | 3300046689 | Ga0495613_0001199 | Ga0495613_0001199_12716_13144 | 138 |
| 27 | 3300048909 | Ga0496106_0744487 | Ga0496106_0744487_213_641 | 138 |
| 28 | 3300048917 | Ga0496114_1547835 | Ga0496114_1547835_22_450 | 138 |
| 29 | 3300053111 | Ga0500572_000611 | Ga0500572_000611_2418_2846 | 138 |
| 30 | 3300053120 | Ga0500597_110244 | Ga0500597_110244_436_864 | 138 |
| 31 | 3300053733 | Ga0500552_005238 | Ga0500552_005238_815_1243 | 138 |
| 32 | iso_pu_bacteria | 2585428106 | 2587919545 | 138 |
| 33 | iso_pu_bacteria | 2643221574 | 2643882323 | 138 |
| 34 | iso_pu_bacteria | 2643221640 | 2644226523 | 138 |
| 35 | iso_pu_bacteria | 2643221642 | 2644236011 | 138 |
| 36 | iso_pu_bacteria | 2643221699 | 2644548687 | 138 |
| 37 | iso_pu_bacteria | 2643221699 | 2644549236 | 138 |
| 38 | iso_pu_bacteria | 2857504554 | 2857506002 | 138 |
| 39 | 3300005327 | Ga0070658_10223438 | Ga0070658_102234382 | 139 |
| 40 | 3300005327 | Ga0070658_10232969 | Ga0070658_102329692 | 139 |
| 41 | 3300005336 | Ga0070680_100083850 | Ga0070680_1000838502 | 139 |
| 42 | 3300005339 | Ga0070660_100007360 | Ga0070660_1000073604 | 139 |
| 43 | 3300005339 | Ga0070660_100217154 | Ga0070660_1002171542 | 139 |
| 44 | 3300005366 | Ga0070659_100070916 | Ga0070659_1000709162 | 139 |
| 45 | 3300005458 | Ga0070681_10029241 | Ga0070681_100292413 | 139 |
| 46 | 3300005530 | Ga0070679_100005491 | Ga0070679_1000054913 | 139 |
| 47 | 3300005539 | Ga0068853_100020057 | Ga0068853_1000200572 | 139 |
| 48 | 3300005548 | Ga0070665_100000176 | Ga0070665_10000017682 | 139 |
| 49 | 3300005563 | Ga0068855_100010885 | Ga0068855_1000108854 | 139 |
| 50 | 3300006028 | Ga0070717_10287344 | Ga0070717_102873441 | 139 |
| 51 | 3300009093 | Ga0105240_10098492 | Ga0105240_100984921 | 139 |
| 52 | 3300009174 | Ga0105241_11004443 | Ga0105241_110044432 | 139 |
| 53 | 3300009177 | Ga0105248_10001071 | Ga0105248_1000107113 | 139 |
| 54 | 3300009553 | Ga0105249_12744881 | Ga0105249_127448812 | 139 |
| 55 | 3300010375 | Ga0105239_10464300 | Ga0105239_104643003 | 139 |
| 56 | 3300025909 | Ga0207705_10000525 | Ga0207705_1000052530 | 139 |
| 57 | 3300025909 | Ga0207705_10326078 | Ga0207705_103260782 | 139 |
| 58 | 3300025912 | Ga0207707_10083212 | Ga0207707_100832123 | 139 |
| 59 | 3300025917 | Ga0207660_10001073 | Ga0207660_1000107316 | 139 |
| 60 | 3300025919 | Ga0207657_10001371 | Ga0207657_1000137113 | 139 |
| 61 | 3300025919 | Ga0207657_10103672 | Ga0207657_101036722 | 139 |
| 62 | 3300025921 | Ga0207652_10010559 | Ga0207652_100105595 | 139 |
| 63 | 3300025924 | Ga0207694_10108229 | Ga0207694_101082294 | 139 |
| 64 | 3300025932 | Ga0207690_10081441 | Ga0207690_100814413 | 139 |
| 65 | 3300025941 | Ga0207711_10000434 | Ga0207711_1000043429 | 139 |
| 66 | 3300025949 | Ga0207667_10004763 | Ga0207667_100047634 | 139 |
| 67 | 3300026041 | Ga0207639_10065017 | Ga0207639_100650172 | 139 |
| 68 | 3300026116 | Ga0207674_10345532 | Ga0207674_103455323 | 139 |
| 69 | 3300026142 | Ga0207698_11495984 | Ga0207698_114959842 | 139 |
| 70 | 3300028379 | Ga0268266_10000005 | Ga0268266_100000051285 | 139 |
| 71 | 3300031616 | Ga0307508_10417072 | Ga0307508_104170723 | 139 |
| 72 | 3300033180 | Ga0307510_10282954 | Ga0307510_102829542 | 139 |
| 73 | 3300035113 | Ga0373936_0032533 | Ga0373936_0032533_29_448 | 139 |
| 74 | 3300048918 | Ga0496115_0014726 | Ga0496115_0014726_1721_2140 | 139 |
| 75 | 3300048918 | Ga0496115_0152281 | Ga0496115_0152281_1048_1467 | 139 |
| 76 | 3300053091 | Ga0500647_0015544 | Ga0500647_0015544_1510_1941 | 139 |
| 77 | 3300053123 | Ga0500614_034957 | Ga0500614_034957_713_1144 | 139 |
| 78 | 3300053156 | Ga0500622_0033092 | Ga0500622_0033092_652_1083 | 139 |
| 79 | 3300005331 | Ga0070670_101191554 | Ga0070670_1011915541 | 140 |
| 80 | 3300005334 | Ga0068869_100178877 | Ga0068869_1001788772 | 140 |
| 81 | 3300005355 | Ga0070671_100008640 | Ga0070671_1000086405 | 140 |
| 82 | 3300005548 | Ga0070665_100056184 | Ga0070665_1000561843 | 140 |
| 83 | 3300009101 | Ga0105247_10358595 | Ga0105247_103585952 | 140 |
| 84 | 3300025931 | Ga0207644_10011096 | Ga0207644_100110966 | 140 |
| 85 | 3300025942 | Ga0207689_10127644 | Ga0207689_101276444 | 140 |
| 86 | 3300028800 | Ga0265338_10055307 | Ga0265338_100553071 | 140 |
| 87 | 3300031456 | Ga0307513_10010389 | Ga0307513_100103894 | 140 |
| 88 | 3300031456 | Ga0307513_10017686 | Ga0307513_100176864 | 140 |
| 89 | 3300046515 | Ga0495620_0146222 | Ga0495620_0146222_429_857 | 140 |
| 90 | 3300046524 | Ga0495648_0293032 | Ga0495648_0293032_292_714 | 140 |
| 91 | 3300046616 | Ga0495668_0216416 | Ga0495668_0216416_345_773 | 140 |
| 92 | 3300046648 | Ga0495611_0005668 | Ga0495611_0005668_1795_2223 | 140 |
| 93 | 3300047320 | Ga0495672_0055520 | Ga0495672_0055520_357_779 | 140 |
| 94 | 3300047445 | Ga0495677_0221076 | Ga0495677_0221076_78_506 | 140 |
| 95 | 3300053087 | Ga0500643_000303 | Ga0500643_000303_12791_13219 | 140 |
| 96 | 3300005327 | Ga0070658_10314158 | Ga0070658_103141581 | 141 |
| 97 | 3300005577 | Ga0068857_100599449 | Ga0068857_1005994491 | 141 |
| 98 | 3300005618 | Ga0068864_101092297 | Ga0068864_1010922972 | 141 |
| 99 | 3300006881 | Ga0068865_100001189 | Ga0068865_10000118913 | 141 |
| 100 | 3300009098 | Ga0105245_12005921 | Ga0105245_120059211 | 141 |
| 101 | 3300009177 | Ga0105248_11793150 | Ga0105248_117931502 | 141 |
| 102 | 3300013306 | Ga0163162_10202761 | Ga0163162_102027612 | 141 |
| 103 | 3300015262 | Ga0182007_10109692 | Ga0182007_101096922 | 141 |
| 104 | 3300025938 | Ga0207704_10000668 | Ga0207704_1000066814 | 141 |
| 105 | 3300026088 | Ga0207641_11458517 | Ga0207641_114585171 | 141 |
| 106 | 3300026095 | Ga0207676_10909221 | Ga0207676_109092212 | 141 |
| 107 | 3300028800 | Ga0265338_10039888 | Ga0265338_100398883 | 141 |
| 108 | 3300028800 | Ga0265338_10067783 | Ga0265338_100677832 | 141 |
| 109 | 3300028800 | Ga0265338_10241591 | Ga0265338_102415912 | 141 |
| 110 | 3300031247 | Ga0265340_10024950 | Ga0265340_100249502 | 141 |
| 111 | 3300031456 | Ga0307513_10626335 | Ga0307513_106263352 | 141 |
| 112 | 3300031548 | Ga0307408_100198845 | Ga0307408_1001988452 | 141 |
| 113 | 3300031824 | Ga0307413_10639755 | Ga0307413_106397552 | 141 |
| 114 | 3300035724 | Ga0373933_0378571 | Ga0373933_0378571_30_461 | 141 |
| 115 | 3300036401 | Ga0373937_0456261 | Ga0373937_0456261_617_1042 | 141 |
| 116 | 3300036401 | Ga0373937_1620204 | Ga0373937_1620204_120_551 | 141 |
| 117 | 3300037471 | Ga0395905_0496872 | Ga0395905_0496872_625_1056 | 141 |
| 118 | 3300039437 | Ga0436365_0487284 | Ga0436365_0487284_572_1000 | 141 |
| 119 | 3300039437 | Ga0436365_1504068 | Ga0436365_1504068_419_850 | 141 |
| 120 | 3300046472 | Ga0495580_0860212 | Ga0495580_0860212_70_501 | 141 |
| 121 | 3300046516 | Ga0495628_0331727 | Ga0495628_0331727_76_501 | 141 |
| 122 | 3300048915 | Ga0496112_0199421 | Ga0496112_0199421_710_1135 | 141 |
| 123 | 3300048918 | Ga0496115_0152688 | Ga0496115_0152688_1255_1689 | 141 |
| 124 | 3300049572 | Ga0501036_0711304 | Ga0501036_0711304_62_490 | 141 |
| 125 | 3300049823 | Ga0501044_0095010 | Ga0501044_0095010_1705_2133 | 141 |
| 126 | 3300053087 | Ga0500643_007630 | Ga0500643_007630_3858_4283 | 141 |
| 127 | 3300053136 | Ga0500559_0000042 | Ga0500559_0000042_79887_80318 | 141 |
| 128 | 3300053136 | Ga0500559_0021561 | Ga0500559_0021561_483_914 | 141 |
| 129 | 3300053177 | Ga0500636_0011176 | Ga0500636_0011176_4587_5018 | 141 |
| 130 | 3300005327 | Ga0070658_10128565 | Ga0070658_101285653 | 142 |
| 131 | 3300005334 | Ga0068869_101628952 | Ga0068869_1016289521 | 142 |
| 132 | 3300005335 | Ga0070666_10154051 | Ga0070666_101540512 | 142 |
| 133 | 3300005345 | Ga0070692_10354681 | Ga0070692_103546812 | 142 |
| 134 | 3300005347 | Ga0070668_100000072 | Ga0070668_10000007213 | 142 |
| 135 | 3300005347 | Ga0070668_100005766 | Ga0070668_10000576610 | 142 |
| 136 | 3300005353 | Ga0070669_100236715 | Ga0070669_1002367152 | 142 |
| 137 | 3300005353 | Ga0070669_100328678 | Ga0070669_1003286781 | 142 |
| 138 | 3300005355 | Ga0070671_100024817 | Ga0070671_1000248178 | 142 |
| 139 | 3300005355 | Ga0070671_100127621 | Ga0070671_1001276213 | 142 |
| 140 | 3300005367 | Ga0070667_100017228 | Ga0070667_1000172283 | 142 |
| 141 | 3300005367 | Ga0070667_100041596 | Ga0070667_1000415962 | 142 |
| 142 | 3300005367 | Ga0070667_100469959 | Ga0070667_1004699591 | 142 |
| 143 | 3300005539 | Ga0068853_100752913 | Ga0068853_1007529133 | 142 |
| 144 | 3300005548 | Ga0070665_100536436 | Ga0070665_1005364362 | 142 |
| 145 | 3300005548 | Ga0070665_102657604 | Ga0070665_1026576041 | 142 |
| 146 | 3300005578 | Ga0068854_100083067 | Ga0068854_1000830673 | 142 |
| 147 | 3300005614 | Ga0068856_101032879 | Ga0068856_1010328793 | 142 |
| 148 | 3300005617 | Ga0068859_100005357 | Ga0068859_10000535712 | 142 |
| 149 | 3300005617 | Ga0068859_100060864 | Ga0068859_1000608642 | 142 |
| 150 | 3300005618 | Ga0068864_100446625 | Ga0068864_1004466252 | 142 |
| 151 | 3300005719 | Ga0068861_100232890 | Ga0068861_1002328901 | 142 |
| 152 | 3300005719 | Ga0068861_100735635 | Ga0068861_1007356351 | 142 |
| 153 | 3300005841 | Ga0068863_100006189 | Ga0068863_1000061894 | 142 |
| 154 | 3300005842 | Ga0068858_100048907 | Ga0068858_1000489075 | 142 |
| 155 | 3300005843 | Ga0068860_100000032 | Ga0068860_100000032232 | 142 |
| 156 | 3300005843 | Ga0068860_100124240 | Ga0068860_1001242402 | 142 |
| 157 | 3300005843 | Ga0068860_100656920 | Ga0068860_1006569201 | 142 |
| 158 | 3300005844 | Ga0068862_100000644 | Ga0068862_10000064435 | 142 |
| 159 | 3300005844 | Ga0068862_100056849 | Ga0068862_1000568492 | 142 |
| 160 | 3300005844 | Ga0068862_101058490 | Ga0068862_1010584901 | 142 |
| 161 | 3300006038 | Ga0075365_10319219 | Ga0075365_103192192 | 142 |
| 162 | 3300006042 | Ga0075368_10001687 | Ga0075368_100016876 | 142 |
| 163 | 3300006051 | Ga0075364_10003820 | Ga0075364_100038205 | 142 |
| 164 | 3300006178 | Ga0075367_10006644 | Ga0075367_100066445 | 142 |
| 165 | 3300006186 | Ga0075369_10205589 | Ga0075369_102055892 | 142 |
| 166 | 3300006195 | Ga0075366_10020258 | Ga0075366_100202584 | 142 |
| 167 | 3300006353 | Ga0075370_10001352 | Ga0075370_1000135211 | 142 |
| 168 | 3300006353 | Ga0075370_10509481 | Ga0075370_105094811 | 142 |
| 169 | 3300006931 | Ga0097620_100005357 | Ga0097620_1000053572 | 142 |
| 170 | 3300006931 | Ga0097620_100060862 | Ga0097620_1000608622 | 142 |
| 171 | 3300009093 | Ga0105240_10006128 | Ga0105240_100061287 | 142 |
| 172 | 3300009093 | Ga0105240_10008257 | Ga0105240_1000825711 | 142 |
| 173 | 3300009093 | Ga0105240_10159299 | Ga0105240_101592994 | 142 |
| 174 | 3300009093 | Ga0105240_11680920 | Ga0105240_116809201 | 142 |
| 175 | 3300009098 | Ga0105245_11067538 | Ga0105245_110675383 | 142 |
| 176 | 3300009101 | Ga0105247_10207249 | Ga0105247_102072492 | 142 |
| 177 | 3300009174 | Ga0105241_10552254 | Ga0105241_105522542 | 142 |
| 178 | 3300009174 | Ga0105241_12002779 | Ga0105241_120027791 | 142 |
| 179 | 3300009176 | Ga0105242_10758891 | Ga0105242_107588912 | 142 |
| 180 | 3300009177 | Ga0105248_10005911 | Ga0105248_1000591110 | 142 |
| 181 | 3300009551 | Ga0105238_10274766 | Ga0105238_102747662 | 142 |
| 182 | 3300009551 | Ga0105238_10347894 | Ga0105238_103478942 | 142 |
| 183 | 3300009551 | Ga0105238_12064051 | Ga0105238_120640511 | 142 |
| 184 | 3300009551 | Ga0105238_12768098 | Ga0105238_127680981 | 142 |
| 185 | 3300010375 | Ga0105239_10045681 | Ga0105239_100456814 | 142 |
| 186 | 3300013306 | Ga0163162_10407904 | Ga0163162_104079041 | 142 |
| 187 | 3300014325 | Ga0163163_10021342 | Ga0163163_100213429 | 142 |
| 188 | 3300014325 | Ga0163163_10103443 | Ga0163163_101034435 | 142 |
| 189 | 3300014968 | Ga0157379_10064431 | Ga0157379_100644316 | 142 |
| 190 | 3300014969 | Ga0157376_10840587 | Ga0157376_108405872 | 142 |
| 191 | 3300021361 | Ga0213872_10015499 | Ga0213872_100154995 | 142 |
| 192 | 3300025913 | Ga0207695_10003533 | Ga0207695_1000353315 | 142 |
| 193 | 3300025913 | Ga0207695_10004836 | Ga0207695_1000483612 | 142 |
| 194 | 3300025913 | Ga0207695_10086815 | Ga0207695_100868154 | 142 |
| 195 | 3300025923 | Ga0207681_10077461 | Ga0207681_100774613 | 142 |
| 196 | 3300025923 | Ga0207681_10465752 | Ga0207681_104657521 | 142 |
| 197 | 3300025924 | Ga0207694_10487548 | Ga0207694_104875481 | 142 |
| 198 | 3300025924 | Ga0207694_10920261 | Ga0207694_109202612 | 142 |
| 199 | 3300025925 | Ga0207650_10020185 | Ga0207650_100201852 | 142 |
| 200 | 3300025925 | Ga0207650_10282599 | Ga0207650_102825993 | 142 |
| 201 | 3300025925 | Ga0207650_10452762 | Ga0207650_104527622 | 142 |
| 202 | 3300025927 | Ga0207687_11127308 | Ga0207687_111273082 | 142 |
| 203 | 3300025934 | Ga0207686_10485052 | Ga0207686_104850522 | 142 |
| 204 | 3300025941 | Ga0207711_10008323 | Ga0207711_100083239 | 142 |
| 205 | 3300025961 | Ga0207712_11098893 | Ga0207712_110988931 | 142 |
| 206 | 3300025972 | Ga0207668_10004234 | Ga0207668_100042346 | 142 |
| 207 | 3300025972 | Ga0207668_10005371 | Ga0207668_100053719 | 142 |
| 208 | 3300025972 | Ga0207668_10084728 | Ga0207668_100847281 | 142 |
| 209 | 3300025986 | Ga0207658_10027873 | Ga0207658_100278733 | 142 |
| 210 | 3300026035 | Ga0207703_10033865 | Ga0207703_100338654 | 142 |
| 211 | 3300026035 | Ga0207703_10034177 | Ga0207703_100341772 | 142 |
| 212 | 3300026041 | Ga0207639_10555299 | Ga0207639_105552993 | 142 |
| 213 | 3300026078 | Ga0207702_11060800 | Ga0207702_110608001 | 142 |
| 214 | 3300026088 | Ga0207641_10002251 | Ga0207641_1000225114 | 142 |
| 215 | 3300026095 | Ga0207676_10446488 | Ga0207676_104464881 | 142 |
| 216 | 3300026118 | Ga0207675_100081065 | Ga0207675_1000810652 | 142 |
| 217 | 3300026118 | Ga0207675_100412871 | Ga0207675_1004128713 | 142 |
| 218 | 3300026118 | Ga0207675_100857078 | Ga0207675_1008570781 | 142 |
| 219 | 3300027866 | Ga0209813_10066185 | Ga0209813_100661852 | 142 |
| 220 | 3300028380 | Ga0268265_10001386 | Ga0268265_100013866 | 142 |
| 221 | 3300028380 | Ga0268265_10515502 | Ga0268265_105155022 | 142 |
| 222 | 3300028380 | Ga0268265_10838687 | Ga0268265_108386871 | 142 |
| 223 | 3300028381 | Ga0268264_10000045 | Ga0268264_10000045121 | 142 |
| 224 | 3300028381 | Ga0268264_10862584 | Ga0268264_108625842 | 142 |
| 225 | 3300028786 | Ga0307517_10070835 | Ga0307517_100708352 | 142 |
| 226 | 3300028800 | Ga0265338_10146118 | Ga0265338_101461182 | 142 |
| 227 | 3300031242 | Ga0265329_10349416 | Ga0265329_103494161 | 142 |
| 228 | 3300031251 | Ga0265327_10001920 | Ga0265327_100019204 | 142 |
| 229 | 3300031251 | Ga0265327_10054026 | Ga0265327_100540264 | 142 |
| 230 | 3300031730 | Ga0307516_10000022 | Ga0307516_1000002219 | 142 |
| 231 | 3300035114 | Ga0373939_0093691 | Ga0373939_0093691_357_788 | 142 |
| 232 | 3300035691 | Ga0373931_0123387 | Ga0373931_0123387_228_659 | 142 |
| 233 | 3300037068 | Ga0373925_0163820 | Ga0373925_0163820_531_962 | 142 |
| 234 | 3300037068 | Ga0373925_1020624 | Ga0373925_1020624_140_571 | 142 |
| 235 | 3300037312 | Ga0395899_0000016 | Ga0395899_0000016_389074_389502 | 142 |
| 236 | 3300039447 | Ga0436361_0195157 | Ga0436361_0195157_5023_5451 | 142 |
| 237 | 3300039447 | Ga0436361_0250096 | Ga0436361_0250096_208_636 | 142 |
| 238 | 3300039447 | Ga0436361_0903973 | Ga0436361_0903973_70_498 | 142 |
| 239 | 3300039447 | Ga0436361_1168976 | Ga0436361_1168976_293_721 | 142 |
| 240 | 3300039447 | Ga0436361_1192202 | Ga0436361_1192202_1059_1487 | 142 |
| 241 | 3300041997 | Ga0439431_0045374 | Ga0439431_0045374_679_1107 | 142 |
| 242 | 3300042004 | Ga0439445_0068822 | Ga0439445_0068822_430_858 | 142 |
| 243 | 3300045049 | Ga0466959_0330390 | Ga0466959_0330390_545_973 | 142 |
| 244 | 3300046460 | Ga0495638_0134601 | Ga0495638_0134601_46_477 | 142 |
| 245 | 3300046507 | Ga0495606_0654294 | Ga0495606_0654294_44_475 | 142 |
| 246 | 3300046515 | Ga0495620_0200046 | Ga0495620_0200046_110_541 | 142 |
| 247 | 3300046520 | Ga0495637_0086036 | Ga0495637_0086036_559_990 | 142 |
| 248 | 3300046520 | Ga0495637_0337563 | Ga0495637_0337563_46_477 | 142 |
| 249 | 3300046522 | Ga0495643_0013207 | Ga0495643_0013207_3169_3600 | 142 |
| 250 | 3300046528 | Ga0495642_0039794 | Ga0495642_0039794_1337_1771 | 142 |
| 251 | 3300046538 | Ga0495609_0072338 | Ga0495609_0072338_262_693 | 142 |
| 252 | 3300046542 | Ga0495597_0002237 | Ga0495597_0002237_1779_2210 | 142 |
| 253 | 3300046542 | Ga0495597_0259012 | Ga0495597_0259012_133_564 | 142 |
| 254 | 3300046557 | Ga0495622_0005534 | Ga0495622_0005534_1536_1967 | 142 |
| 255 | 3300046616 | Ga0495668_0124980 | Ga0495668_0124980_947_1378 | 142 |
| 256 | 3300046660 | Ga0495625_0099276 | Ga0495625_0099276_317_748 | 142 |
| 257 | 3300046660 | Ga0495625_0214177 | Ga0495625_0214177_666_1100 | 142 |
| 258 | 3300046663 | Ga0495635_0215095 | Ga0495635_0215095_740_1171 | 142 |
| 259 | 3300046684 | Ga0495669_0000005 | Ga0495669_0000005_135382_135816 | 142 |
| 260 | 3300046690 | Ga0495624_0537736 | Ga0495624_0537736_20_451 | 142 |
| 261 | 3300047315 | Ga0495581_0041881 | Ga0495581_0041881_450_881 | 142 |
| 262 | 3300047443 | Ga0495687_037418 | Ga0495687_037418_377_808 | 142 |
| 263 | 3300047472 | Ga0495686_0053022 | Ga0495686_0053022_1726_2157 | 142 |
| 264 | 3300047673 | Ga0495593_0001938 | Ga0495593_0001938_4665_5096 | 142 |
| 265 | 3300048090 | Ga0495615_0005446 | Ga0495615_0005446_1734_2162 | 142 |
| 266 | 3300048904 | Ga0496101_0410711 | Ga0496101_0410711_301_729 | 142 |
| 267 | 3300048918 | Ga0496115_0002327 | Ga0496115_0002327_10253_10681 | 142 |
| 268 | 3300048918 | Ga0496115_0020272 | Ga0496115_0020272_2143_2571 | 142 |
| 269 | 3300048922 | Ga0496119_0028053 | Ga0496119_0028053_2057_2485 | 142 |
| 270 | 3300048924 | Ga0496121_0000035 | Ga0496121_0000035_116157_116585 | 142 |
| 271 | 3300050489 | nmdc:mga03683_24666_c1 | nmdc:mga03683_24666_c1_622_1053 | 142 |
| 272 | 3300050490 | nmdc:mga03n38_772312_c1 | nmdc:mga03n38_772312_c1_45_476 | 142 |
| 273 | 3300050491 | nmdc:mga00v17_6139_c1 | nmdc:mga00v17_6139_c1_571_1002 | 142 |
| 274 | 3300050493 | nmdc:mga0k408_121091_c1 | nmdc:mga0k408_121091_c1_1080_1511 | 142 |
| 275 | 3300050494 | nmdc:mga06z11_12913_c1 | nmdc:mga06z11_12913_c1_2351_2782 | 142 |
| 276 | 3300050495 | nmdc:mga04h51_78846_c1 | nmdc:mga04h51_78846_c1_315_746 | 142 |
| 277 | 3300050496 | nmdc:mga07m45_287780_c1 | nmdc:mga07m45_287780_c1_191_622 | 142 |
| 278 | 3300050496 | nmdc:mga07m45_37190_c1 | nmdc:mga07m45_37190_c1_330_761 | 142 |
| 279 | 3300050516 | nmdc:mga0sz30_215700_c1 | nmdc:mga0sz30_215700_c1_179_610 | 142 |
| 280 | 3300053087 | Ga0500643_012886 | Ga0500643_012886_2514_2942 | 142 |
| 281 | 3300053092 | Ga0500583_0019914 | Ga0500583_0019914_1465_1896 | 142 |
| 282 | 3300053093 | Ga0500651_0030693 | Ga0500651_0030693_1436_1867 | 142 |
| 283 | 3300053094 | Ga0500566_0043523 | Ga0500566_0043523_1656_2087 | 142 |
| 284 | 3300053098 | Ga0500650_0351679 | Ga0500650_0351679_70_501 | 142 |
| 285 | 3300053103 | Ga0500555_002048 | Ga0500555_002048_3321_3752 | 142 |
| 286 | 3300053104 | Ga0500556_0013744 | Ga0500556_0013744_52_483 | 142 |
| 287 | 3300053109 | Ga0500569_005407 | Ga0500569_005407_828_1259 | 142 |
| 288 | 3300053111 | Ga0500572_035931 | Ga0500572_035931_727_1158 | 142 |
| 289 | 3300053119 | Ga0500595_007611 | Ga0500595_007611_2567_2998 | 142 |
| 290 | 3300053121 | Ga0500607_108730 | Ga0500607_108730_183_614 | 142 |
| 291 | 3300053122 | Ga0500608_023326 | Ga0500608_023326_1558_1989 | 142 |
| 292 | 3300053123 | Ga0500614_004094 | Ga0500614_004094_1213_1644 | 142 |
| 293 | 3300053130 | Ga0500642_0032633 | Ga0500642_0032633_1563_1994 | 142 |
| 294 | 3300053130 | Ga0500642_0335869 | Ga0500642_0335869_99_530 | 142 |
| 295 | 3300053134 | Ga0500658_0026869 | Ga0500658_0026869_1511_1942 | 142 |
| 296 | 3300053148 | Ga0500590_001960 | Ga0500590_001960_7483_7914 | 142 |
| 297 | 3300053153 | Ga0500616_0033516 | Ga0500616_0033516_1207_1635 | 142 |
| 298 | 3300053154 | Ga0500619_002786 | Ga0500619_002786_2857_3288 | 142 |
| 299 | 3300053155 | Ga0500620_097471 | Ga0500620_097471_150_581 | 142 |
| 300 | 3300053156 | Ga0500622_0022034 | Ga0500622_0022034_591_1022 | 142 |
| 301 | 3300053177 | Ga0500636_0088154 | Ga0500636_0088154_1308_1739 | 142 |
| 302 | 3300053178 | Ga0500637_0047943 | Ga0500637_0047943_1151_1582 | 142 |
| 303 | 3300053725 | Ga0500576_169291 | Ga0500576_169291_83_514 | 142 |
| 304 | 3300053729 | Ga0500625_040729 | Ga0500625_040729_924_1355 | 142 |
| 305 | 3300053735 | Ga0500596_007428 | Ga0500596_007428_1012_1443 | 142 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jor-assembly1.cif.gz_A | ensemble structures for unligated staphylococcal nuclease-h124l | 0.307 | 86 | 140 |
| 3itp-assembly1.cif.gz_A | crystal structure of staphylococcal nuclease variant delta+phs f34k at cryogenic temperature | 0.3013 | 86 | 140 |
| 4p3m-assembly1.cif.gz_A | crystal structure of serine hydroxymethyltransferase from psychromonas ingrahamii | 0.3008 | 22 | 109 |
| 4p3m-assembly1.cif.gz_A | crystal structure of serine hydroxymethyltransferase from psychromonas ingrahamii | 0.2055 | 22 | 109 |
| 2kq3-assembly1.cif.gz_A | solution structure of snase140 | 0.204 | 58 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4uacA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.2787 | 89 | 137 | 3.40.190.10 |
| 2y0yT00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 | 0.266 | 17 | 117 | 1.20.58.110 |
| af_Q03603_1_98_1.10.238.110 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;Diacylglycerol kinase alpha. | 0.2483 | 31 | 137 | 1.10.238.110 |
| 2y0yT00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 | 0.2443 | 17 | 117 | 1.20.58.110 |
| 2aqcA00 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2;H/ACA ribonucleoprotein complex, subunit Nop10 | 0.2405 | 113 | 134 | 2.20.28.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840A3A0-F1-model_v4 | Uncharacterized protein | 0.8248 | 6 | 141 |
|
| AF-A0A7W9CFE2-F1-model_v4 | Uncharacterized protein | 0.8185 | 1 | 70 |
|
| AF-A0A840A3A0-F1-model_v4 | Uncharacterized protein | 0.7905 | 6 | 141 |
|
| AF-A0A7W9CFE2-F1-model_v4 | Uncharacterized protein | 0.7578 | 1 | 70 |
|
| AF-A0A6B3UIR3-F1-model_v4 | Uncharacterized protein | 0.7335 | 26 | 141 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar