F398172

General Info

Members Datasets Scaffolds Average Seq Length
305 199 294 142

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10247247|Ga0265334_102472472
Length 137
Sequence MANAPLRRLIDLPGIAELEDKALMKPRYADDDARSEFPEIDECSTALFGLTADEADDVPRPEGWDRIERKPVREQVDAFEVTDNKRRPLRMFGHFNVQLWLAVRGVAGSLPFHVEKEPDELKASLAKEAAIFLRNRR

Samples

Sample ID Description Type Environment
1 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
2 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
3 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
4 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
5 2643221640 Caulobacter sp. Root342 Isolate Unclassified
6 2643221642 Caulobacter sp. Root343 Isolate Unclassified
7 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
8 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
9 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
10 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
124 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
170 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
171 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
172 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
173 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
174 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
175 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
176 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
177 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
178 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
179 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
180 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
181 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
182 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
183 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
184 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
185 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
186 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
192 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
195 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
196 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
197 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
198 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
199 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.39
Metatranscriptomes 0
Isolates 3.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.69
Nodule 0
Rhizoplane 2.95
Rhizosphere 71.48
Stem 0
Stem Tuber 0
Unclassified 6.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10128565 3300005327 Bacteria 2110
2 Ga0070658_10223438 3300005327 Bacteria 1593
3 Ga0070658_10232969 3300005327 Bacteria 1559
4 Ga0070658_10314158 3300005327 Bacteria 1337
5 Ga0070658_10493640 3300005327 Bacteria 1057
6 Ga0070670_101191554 3300005331 Unclassified 696
7 Ga0068869_100178877 3300005334 Bacteria 1662
8 Ga0068869_101628952 3300005334 Bacteria 575
9 Ga0070666_10154051 3300005335 Bacteria 1604
10 Ga0070680_100083850 3300005336 Bacteria 2632
11 Ga0068868_101004934 3300005338 Bacteria 763
12 Ga0070660_100007360 3300005339 Bacteria 7669
13 Ga0070660_100217154 3300005339 Bacteria 1553
14 Ga0070692_10354681 3300005345 Bacteria 912
15 Ga0070668_100000072 3300005347 Bacteria 62530
16 Ga0070668_100005766 3300005347 Bacteria 9186
17 Ga0070669_100236715 3300005353 Bacteria 1449
18 Ga0070669_100328678 3300005353 Bacteria 1236
19 Ga0070671_100008640 3300005355 Bacteria 8169
20 Ga0070671_100024817 3300005355 Bacteria 4912
21 Ga0070671_100127621 3300005355 Bacteria 2142
22 Ga0070659_100070916 3300005366 Bacteria 2769
23 Ga0070667_100017228 3300005367 Bacteria 5984
24 Ga0070667_100041596 3300005367 Bacteria 3856
25 Ga0070667_100469959 3300005367 Unclassified 1151
26 Ga0070681_10029241 3300005458 Bacteria 5532
27 Ga0070679_100005491 3300005530 Bacteria 11751
28 Ga0070679_101310455 3300005530 Unclassified 670
29 Ga0068853_100020057 3300005539 Bacteria 5555
30 Ga0068853_100752913 3300005539 Bacteria 931
31 Ga0070665_100000176 3300005548 Bacteria 113398
32 Ga0070665_100056184 3300005548 Bacteria 3947
33 Ga0070665_100536436 3300005548 Bacteria 1182
34 Ga0070665_102657604 3300005548 Bacteria 501
35 Ga0068855_100010885 3300005563 Bacteria 10980
36 Ga0068857_100599449 3300005577 Bacteria 1041
37 Ga0068854_100083067 3300005578 Bacteria 2368
38 Ga0068856_101032879 3300005614 Bacteria 840
39 Ga0068859_100005357 3300005617 Bacteria 13054
40 Ga0068859_100060864 3300005617 Bacteria 3804
41 Ga0068864_100446625 3300005618 Bacteria 1236
42 Ga0068864_101092297 3300005618 Bacteria 794
43 Ga0068861_100232890 3300005719 Bacteria 1563
44 Ga0068861_100735635 3300005719 Bacteria 920
45 Ga0068863_100006189 3300005841 Bacteria 11737
46 Ga0068858_100048907 3300005842 Bacteria 3916
47 Ga0068860_100000032 3300005843 Bacteria 251624
48 Ga0068860_100124240 3300005843 Bacteria 2473
49 Ga0068860_100656920 3300005843 Bacteria 1056
50 Ga0068862_100000644 3300005844 Bacteria 36054
51 Ga0068862_100056849 3300005844 Bacteria 3353
52 Ga0068862_101058490 3300005844 Bacteria 805
53 Ga0070717_10287344 3300006028 Bacteria 1460
54 Ga0075365_10319219 3300006038 Bacteria 1094
55 Ga0075368_10001687 3300006042 Bacteria 7093
56 Ga0075364_10003820 3300006051 Bacteria 8623
57 Ga0075367_10006644 3300006178 Bacteria 5863
58 Ga0075369_10205589 3300006186 Bacteria 909
59 Ga0075366_10020258 3300006195 Bacteria 3857
60 Ga0075370_10001352 3300006353 Bacteria 10559
61 Ga0075370_10509481 3300006353 Bacteria 726
62 Ga0068865_100001189 3300006881 Bacteria 15136
63 Ga0097620_100005357 3300006931 Bacteria 13054
64 Ga0097620_100060862 3300006931 Bacteria 3804
65 Ga0105240_10006128 3300009093 Bacteria 17734
66 Ga0105240_10008257 3300009093 Bacteria 14906
67 Ga0105240_10098492 3300009093 Bacteria 3561
68 Ga0105240_10159299 3300009093 Bacteria 2683
69 Ga0105240_11454700 3300009093 Bacteria 719
70 Ga0105240_11680920 3300009093 Bacteria 663
71 Ga0105245_11067538 3300009098 Bacteria 853
72 Ga0105245_12005921 3300009098 Bacteria 632
73 Ga0105247_10207249 3300009101 Bacteria 1320
74 Ga0105247_10358595 3300009101 Bacteria 1027
75 Ga0105241_10552254 3300009174 Bacteria 1034
76 Ga0105241_11004443 3300009174 Bacteria 781
77 Ga0105241_12002779 3300009174 Bacteria 570
78 Ga0105242_10758891 3300009176 Bacteria 956
79 Ga0105242_10861831 3300009176 Bacteria 902
80 Ga0105248_10001071 3300009177 Bacteria 30268
81 Ga0105248_10005911 3300009177 Bacteria 13452
82 Ga0105248_11793150 3300009177 Bacteria 696
83 Ga0105238_10186939 3300009551 Bacteria 2048
84 Ga0105238_10274766 3300009551 Bacteria 1665
85 Ga0105238_10347894 3300009551 Bacteria 1471
86 Ga0105238_12064051 3300009551 Bacteria 604
87 Ga0105238_12768098 3300009551 Archaea 527
88 Ga0105249_12744881 3300009553 Bacteria 564
89 Ga0105239_10045681 3300010375 Bacteria 4800
90 Ga0105239_10464300 3300010375 Bacteria 1437
91 Ga0163162_10202761 3300013306 Bacteria 2113
92 Ga0163162_10407904 3300013306 Bacteria 1491
93 Ga0163162_12375162 3300013306 Bacteria 609
94 Ga0157375_10343588 3300013308 Bacteria 1658
95 Ga0163163_10021342 3300014325 Bacteria 6110
96 Ga0163163_10103443 3300014325 Bacteria 2872
97 Ga0157379_10064431 3300014968 Bacteria 3275
98 Ga0157376_10840587 3300014969 Bacteria 933
99 Ga0182007_10109692 3300015262 Bacteria 917
100 Ga0213872_10015499 3300021361 Bacteria 3542
101 Ga0207645_10836895 3300025907 Bacteria 625
102 Ga0207705_10000525 3300025909 Bacteria 32608
103 Ga0207705_10326078 3300025909 Bacteria 1180
104 Ga0207705_10922228 3300025909 Bacteria 676
105 Ga0207707_10083212 3300025912 Bacteria 2794
106 Ga0207695_10003533 3300025913 Bacteria 21899
107 Ga0207695_10004836 3300025913 Bacteria 18184
108 Ga0207695_10086815 3300025913 Bacteria 3153
109 Ga0207660_10001073 3300025917 Bacteria 18191
110 Ga0207657_10001371 3300025919 Bacteria 25987
111 Ga0207657_10103672 3300025919 Bacteria 2357
112 Ga0207652_10010559 3300025921 Bacteria 7433
113 Ga0207681_10077461 3300025923 Bacteria 2337
114 Ga0207681_10465752 3300025923 Unclassified 1030
115 Ga0207694_10108229 3300025924 Bacteria 2208
116 Ga0207694_10412950 3300025924 Bacteria 1124
117 Ga0207694_10487548 3300025924 Bacteria 1031
118 Ga0207694_10920261 3300025924 Bacteria 739
119 Ga0207650_10020185 3300025925 Bacteria 4696
120 Ga0207650_10282599 3300025925 Bacteria 1352
121 Ga0207650_10452762 3300025925 Bacteria 1068
122 Ga0207687_11127308 3300025927 Unclassified 674
123 Ga0207644_10011096 3300025931 Bacteria 5953
124 Ga0207690_10081441 3300025932 Bacteria 2262
125 Ga0207686_10485052 3300025934 Bacteria 956
126 Ga0207704_10000668 3300025938 Bacteria 15195
127 Ga0207711_10000434 3300025941 Bacteria 43493
128 Ga0207711_10008323 3300025941 Bacteria 8683
129 Ga0207689_10127644 3300025942 Bacteria 2092
130 Ga0207667_10004763 3300025949 Bacteria 16596
131 Ga0207712_11098893 3300025961 Bacteria 708
132 Ga0207668_10004234 3300025972 Bacteria 8412
133 Ga0207668_10005371 3300025972 Bacteria 7538
134 Ga0207668_10084728 3300025972 Bacteria 2310
135 Ga0207658_10027873 3300025986 Bacteria 3973
136 Ga0207703_10033865 3300026035 Bacteria 4051
137 Ga0207703_10034177 3300026035 Bacteria 4034
138 Ga0207639_10065017 3300026041 Bacteria 2830
139 Ga0207639_10555299 3300026041 Bacteria 1055
140 Ga0207702_11060800 3300026078 Bacteria 804
141 Ga0207641_10002251 3300026088 Bacteria 18000
142 Ga0207641_11458517 3300026088 Bacteria 686
143 Ga0207676_10446488 3300026095 Bacteria 1218
144 Ga0207676_10909221 3300026095 Bacteria 864
145 Ga0207674_10345532 3300026116 Bacteria 1438
146 Ga0207675_100081065 3300026118 Bacteria 3042
147 Ga0207675_100412871 3300026118 Bacteria 1332
148 Ga0207675_100857078 3300026118 Bacteria 924
149 Ga0207698_11495984 3300026142 Bacteria 690
150 Ga0209813_10066185 3300027866 Bacteria 1165
151 Ga0268266_10000005 3300028379 Bacteria 1448194
152 Ga0268265_10001386 3300028380 Bacteria 20547
153 Ga0268265_10515502 3300028380 Bacteria 1129
154 Ga0268265_10838687 3300028380 Bacteria 898
155 Ga0268264_10000045 3300028381 Bacteria 364764
156 Ga0268264_10862584 3300028381 Bacteria 907
157 Ga0265334_10247247 3300028573 Bacteria 614
158 Ga0307517_10070835 3300028786 Bacteria 3134
159 Ga0265338_10039888 3300028800 Bacteria 4420
160 Ga0265338_10055307 3300028800 Bacteria 3531
161 Ga0265338_10067783 3300028800 Bacteria 3079
162 Ga0265338_10146118 3300028800 Bacteria 1844
163 Ga0265338_10241591 3300028800 Bacteria 1337
164 Ga0265329_10349416 3300031242 Bacteria 506
165 Ga0265340_10024950 3300031247 Bacteria 3033
166 Ga0265327_10001920 3300031251 Bacteria 23989
167 Ga0265327_10054026 3300031251 Bacteria 2081
168 Ga0265327_10115274 3300031251 Bacteria 1279
169 Ga0307513_10010389 3300031456 Bacteria 11673
170 Ga0307513_10017686 3300031456 Bacteria 8539
171 Ga0307513_10626335 3300031456 Bacteria 784
172 Ga0307408_100198845 3300031548 Bacteria 1621
173 Ga0307508_10417072 3300031616 Bacteria 934
174 Ga0265314_10081746 3300031711 Bacteria 2127
175 Ga0307516_10000022 3300031730 Bacteria 191854
176 Ga0307413_10639755 3300031824 Bacteria 876
177 Ga0307510_10282954 3300033180 Bacteria 1128
178 Ga0373936_0032533 3300035113 Bacteria 2063
179 Ga0373939_0093691 3300035114 Bacteria 1019
180 Ga0373931_0123387 3300035691 Bacteria 1483
181 Ga0373933_0378571 3300035724 Bacteria 922
182 Ga0373937_0456261 3300036401 Bacteria 1214
183 Ga0373937_1620204 3300036401 Bacteria 594
184 Ga0373925_0163820 3300037068 Bacteria 1753
185 Ga0373925_1020624 3300037068 Bacteria 681
186 Ga0395899_0000016 3300037312 Bacteria 468322
187 Ga0395899_0152194 3300037312 Bacteria 1638
188 Ga0395900_0114841 3300037418 Bacteria 2763
189 Ga0395898_0112454 3300037466 Bacteria 2610
190 Ga0395905_0132007 3300037471 Bacteria 2349
191 Ga0395905_0496872 3300037471 Bacteria 1120
192 Ga0436365_0487284 3300039437 Bacteria 1281
193 Ga0436365_1504068 3300039437 Bacteria 1435
194 Ga0436361_0195157 3300039447 Bacteria 6146
195 Ga0436361_0250096 3300039447 Bacteria 1607
196 Ga0436361_0903973 3300039447 Bacteria 1017
197 Ga0436361_1168976 3300039447 Bacteria 1698
198 Ga0436361_1192202 3300039447 Bacteria 1521
199 Ga0439431_0045374 3300041997 Bacteria 1129
200 Ga0439445_0068822 3300042004 Bacteria 977
201 Ga0466959_0330390 3300045049 Bacteria 1041
202 Ga0495638_0134601 3300046460 Bacteria 1449
203 Ga0495580_0860212 3300046472 Bacteria 585
204 Ga0495606_0654294 3300046507 Bacteria 508
205 Ga0495620_0146222 3300046515 Unclassified 923
206 Ga0495620_0200046 3300046515 Bacteria 769
207 Ga0495628_0331727 3300046516 Bacteria 1121
208 Ga0495637_0086036 3300046520 Bacteria 1247
209 Ga0495637_0337563 3300046520 Bacteria 530
210 Ga0495643_0013207 3300046522 Bacteria 4952
211 Ga0495648_0293032 3300046524 Bacteria 766
212 Ga0495642_0039794 3300046528 Bacteria 1908
213 Ga0495652_0111643 3300046529 Bacteria 2198
214 Ga0495609_0072338 3300046538 Bacteria 1514
215 Ga0495597_0002237 3300046542 Bacteria 12636
216 Ga0495597_0259012 3300046542 Bacteria 682
217 Ga0495622_0005534 3300046557 Bacteria 5855
218 Ga0495668_0124980 3300046616 Bacteria 1408
219 Ga0495668_0216416 3300046616 Bacteria 1049
220 Ga0495611_0005668 3300046648 Bacteria 5329
221 Ga0495625_0099276 3300046660 Bacteria 2002
222 Ga0495625_0214177 3300046660 Bacteria 1265
223 Ga0495635_0215095 3300046663 Bacteria 1301
224 Ga0495669_0000005 3300046684 Bacteria 193971
225 Ga0495613_0001199 3300046689 Bacteria 19784
226 Ga0495624_0537736 3300046690 Bacteria 698
227 Ga0495581_0041881 3300047315 Bacteria 2651
228 Ga0495672_0055520 3300047320 Bacteria 2311
229 Ga0495687_037418 3300047443 Bacteria 2162
230 Ga0495677_0221076 3300047445 Unclassified 738
231 Ga0495686_0053022 3300047472 Bacteria 2542
232 Ga0495593_0001938 3300047673 Bacteria 12334
233 Ga0495615_0005446 3300048090 Bacteria 2290
234 Ga0496101_0410711 3300048904 Unclassified 1067
235 Ga0496106_0744487 3300048909 Bacteria 779
236 Ga0496112_0199421 3300048915 Bacteria 1961
237 Ga0496114_1547835 3300048917 Bacteria 551
238 Ga0496115_0002327 3300048918 Bacteria 13618
239 Ga0496115_0014726 3300048918 Bacteria 5925
240 Ga0496115_0020272 3300048918 Bacteria 5128
241 Ga0496115_0152281 3300048918 Bacteria 1910
242 Ga0496115_0152688 3300048918 Bacteria 1907
243 Ga0496119_0028053 3300048922 Bacteria 3853
244 Ga0496121_0000035 3300048924 Bacteria 374316
245 Ga0501036_0711304 3300049572 Unclassified 830
246 Ga0501044_0095010 3300049823 Bacteria 3005
247 nmdc:mga03683_24666_c1 3300050489 Bacteria 2355
248 nmdc:mga03n38_772312_c1 3300050490 Bacteria 558
249 nmdc:mga00v17_6139_c1 3300050491 Bacteria 6011
250 nmdc:mga0k408_121091_c1 3300050493 Bacteria 1550
251 nmdc:mga06z11_12913_c1 3300050494 Bacteria 3648
252 nmdc:mga04h51_78846_c1 3300050495 Bacteria 1165
253 nmdc:mga07m45_287780_c1 3300050496 Bacteria 956
254 nmdc:mga07m45_37190_c1 3300050496 Bacteria 2715
255 nmdc:mga0sz30_215700_c1 3300050516 Bacteria 853
256 Ga0500643_000303 3300053087 Bacteria 41173
257 Ga0500643_007630 3300053087 Bacteria 4334
258 Ga0500643_011376 3300053087 Bacteria 3250
259 Ga0500643_012886 3300053087 Bacteria 2979
260 Ga0500647_0015544 3300053091 Bacteria 3483
261 Ga0500583_0019914 3300053092 Bacteria 2760
262 Ga0500651_0030693 3300053093 Bacteria 3383
263 Ga0500566_0043523 3300053094 Bacteria 2587
264 Ga0500641_0000212 3300053096 Bacteria 21879
265 Ga0500650_0351679 3300053098 Unclassified 644
266 Ga0500555_002048 3300053103 Bacteria 5931
267 Ga0500556_0013744 3300053104 Bacteria 2457
268 Ga0500569_005407 3300053109 Bacteria 2745
269 Ga0500572_000611 3300053111 Bacteria 12013
270 Ga0500572_035931 3300053111 Bacteria 1412
271 Ga0500595_007611 3300053119 Bacteria 4484
272 Ga0500597_110244 3300053120 Bacteria 1195
273 Ga0500607_108730 3300053121 Bacteria 1363
274 Ga0500608_023326 3300053122 Bacteria 2879
275 Ga0500614_004094 3300053123 Bacteria 3100
276 Ga0500614_034957 3300053123 Bacteria 1250
277 Ga0500642_0032633 3300053130 Bacteria 2186
278 Ga0500642_0335869 3300053130 Bacteria 674
279 Ga0500658_0026869 3300053134 Bacteria 2221
280 Ga0500559_0000042 3300053136 Bacteria 101570
281 Ga0500559_0021561 3300053136 Bacteria 2731
282 Ga0500590_001960 3300053148 Bacteria 8846
283 Ga0500616_0033516 3300053153 Bacteria 2802
284 Ga0500619_002786 3300053154 Bacteria 3444
285 Ga0500620_097471 3300053155 Bacteria 1027
286 Ga0500622_0022034 3300053156 Bacteria 3380
287 Ga0500622_0033092 3300053156 Bacteria 2710
288 Ga0500636_0011176 3300053177 Bacteria 5253
289 Ga0500636_0088154 3300053177 Bacteria 1780
290 Ga0500637_0047943 3300053178 Bacteria 2428
291 Ga0500576_169291 3300053725 Bacteria 788
292 Ga0500625_040729 3300053729 Bacteria 2185
293 Ga0500552_005238 3300053733 Unclassified 1404
294 Ga0500596_007428 3300053735 Bacteria 1796

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10861831 Ga0105242_108618311 132
2 iso_pu_bacteria 2643221614 2644088220 134
3 iso_pu_bacteria 2643221661 2644343458 134
4 iso_pu_bacteria 2643221666 2644369065 134
5 3300028573 Ga0265334_10247247 Ga0265334_102472472 135
6 3300031251 Ga0265327_10115274 Ga0265327_101152742 135
7 3300031711 Ga0265314_10081746 Ga0265314_100817463 135
8 3300013308 Ga0157375_10343588 Ga0157375_103435882 136
9 3300053087 Ga0500643_011376 Ga0500643_011376_360_785 136
10 3300053096 Ga0500641_0000212 Ga0500641_0000212_2185_2610 136
11 iso_pu_bacteria 2643221598 2644001441 137
12 3300005327 Ga0070658_10493640 Ga0070658_104936401 138
13 3300005338 Ga0068868_101004934 Ga0068868_1010049342 138
14 3300005530 Ga0070679_101310455 Ga0070679_1013104552 138
15 3300009093 Ga0105240_11454700 Ga0105240_114547002 138
16 3300009551 Ga0105238_10186939 Ga0105238_101869392 138
17 3300013306 Ga0163162_12375162 Ga0163162_123751622 138
18 3300025907 Ga0207645_10836895 Ga0207645_108368952 138
19 3300025909 Ga0207705_10922228 Ga0207705_109222282 138
20 3300025924 Ga0207694_10412950 Ga0207694_104129502 138
21 3300037312 Ga0395899_0152194 Ga0395899_0152194_1179_1607 138
22 3300037418 Ga0395900_0114841 Ga0395900_0114841_1481_1909 138
23 3300037466 Ga0395898_0112454 Ga0395898_0112454_588_1016 138
24 3300037471 Ga0395905_0132007 Ga0395905_0132007_500_928 138
25 3300046529 Ga0495652_0111643 Ga0495652_0111643_781_1209 138
26 3300046689 Ga0495613_0001199 Ga0495613_0001199_12716_13144 138
27 3300048909 Ga0496106_0744487 Ga0496106_0744487_213_641 138
28 3300048917 Ga0496114_1547835 Ga0496114_1547835_22_450 138
29 3300053111 Ga0500572_000611 Ga0500572_000611_2418_2846 138
30 3300053120 Ga0500597_110244 Ga0500597_110244_436_864 138
31 3300053733 Ga0500552_005238 Ga0500552_005238_815_1243 138
32 iso_pu_bacteria 2585428106 2587919545 138
33 iso_pu_bacteria 2643221574 2643882323 138
34 iso_pu_bacteria 2643221640 2644226523 138
35 iso_pu_bacteria 2643221642 2644236011 138
36 iso_pu_bacteria 2643221699 2644548687 138
37 iso_pu_bacteria 2643221699 2644549236 138
38 iso_pu_bacteria 2857504554 2857506002 138
39 3300005327 Ga0070658_10223438 Ga0070658_102234382 139
40 3300005327 Ga0070658_10232969 Ga0070658_102329692 139
41 3300005336 Ga0070680_100083850 Ga0070680_1000838502 139
42 3300005339 Ga0070660_100007360 Ga0070660_1000073604 139
43 3300005339 Ga0070660_100217154 Ga0070660_1002171542 139
44 3300005366 Ga0070659_100070916 Ga0070659_1000709162 139
45 3300005458 Ga0070681_10029241 Ga0070681_100292413 139
46 3300005530 Ga0070679_100005491 Ga0070679_1000054913 139
47 3300005539 Ga0068853_100020057 Ga0068853_1000200572 139
48 3300005548 Ga0070665_100000176 Ga0070665_10000017682 139
49 3300005563 Ga0068855_100010885 Ga0068855_1000108854 139
50 3300006028 Ga0070717_10287344 Ga0070717_102873441 139
51 3300009093 Ga0105240_10098492 Ga0105240_100984921 139
52 3300009174 Ga0105241_11004443 Ga0105241_110044432 139
53 3300009177 Ga0105248_10001071 Ga0105248_1000107113 139
54 3300009553 Ga0105249_12744881 Ga0105249_127448812 139
55 3300010375 Ga0105239_10464300 Ga0105239_104643003 139
56 3300025909 Ga0207705_10000525 Ga0207705_1000052530 139
57 3300025909 Ga0207705_10326078 Ga0207705_103260782 139
58 3300025912 Ga0207707_10083212 Ga0207707_100832123 139
59 3300025917 Ga0207660_10001073 Ga0207660_1000107316 139
60 3300025919 Ga0207657_10001371 Ga0207657_1000137113 139
61 3300025919 Ga0207657_10103672 Ga0207657_101036722 139
62 3300025921 Ga0207652_10010559 Ga0207652_100105595 139
63 3300025924 Ga0207694_10108229 Ga0207694_101082294 139
64 3300025932 Ga0207690_10081441 Ga0207690_100814413 139
65 3300025941 Ga0207711_10000434 Ga0207711_1000043429 139
66 3300025949 Ga0207667_10004763 Ga0207667_100047634 139
67 3300026041 Ga0207639_10065017 Ga0207639_100650172 139
68 3300026116 Ga0207674_10345532 Ga0207674_103455323 139
69 3300026142 Ga0207698_11495984 Ga0207698_114959842 139
70 3300028379 Ga0268266_10000005 Ga0268266_100000051285 139
71 3300031616 Ga0307508_10417072 Ga0307508_104170723 139
72 3300033180 Ga0307510_10282954 Ga0307510_102829542 139
73 3300035113 Ga0373936_0032533 Ga0373936_0032533_29_448 139
74 3300048918 Ga0496115_0014726 Ga0496115_0014726_1721_2140 139
75 3300048918 Ga0496115_0152281 Ga0496115_0152281_1048_1467 139
76 3300053091 Ga0500647_0015544 Ga0500647_0015544_1510_1941 139
77 3300053123 Ga0500614_034957 Ga0500614_034957_713_1144 139
78 3300053156 Ga0500622_0033092 Ga0500622_0033092_652_1083 139
79 3300005331 Ga0070670_101191554 Ga0070670_1011915541 140
80 3300005334 Ga0068869_100178877 Ga0068869_1001788772 140
81 3300005355 Ga0070671_100008640 Ga0070671_1000086405 140
82 3300005548 Ga0070665_100056184 Ga0070665_1000561843 140
83 3300009101 Ga0105247_10358595 Ga0105247_103585952 140
84 3300025931 Ga0207644_10011096 Ga0207644_100110966 140
85 3300025942 Ga0207689_10127644 Ga0207689_101276444 140
86 3300028800 Ga0265338_10055307 Ga0265338_100553071 140
87 3300031456 Ga0307513_10010389 Ga0307513_100103894 140
88 3300031456 Ga0307513_10017686 Ga0307513_100176864 140
89 3300046515 Ga0495620_0146222 Ga0495620_0146222_429_857 140
90 3300046524 Ga0495648_0293032 Ga0495648_0293032_292_714 140
91 3300046616 Ga0495668_0216416 Ga0495668_0216416_345_773 140
92 3300046648 Ga0495611_0005668 Ga0495611_0005668_1795_2223 140
93 3300047320 Ga0495672_0055520 Ga0495672_0055520_357_779 140
94 3300047445 Ga0495677_0221076 Ga0495677_0221076_78_506 140
95 3300053087 Ga0500643_000303 Ga0500643_000303_12791_13219 140
96 3300005327 Ga0070658_10314158 Ga0070658_103141581 141
97 3300005577 Ga0068857_100599449 Ga0068857_1005994491 141
98 3300005618 Ga0068864_101092297 Ga0068864_1010922972 141
99 3300006881 Ga0068865_100001189 Ga0068865_10000118913 141
100 3300009098 Ga0105245_12005921 Ga0105245_120059211 141
101 3300009177 Ga0105248_11793150 Ga0105248_117931502 141
102 3300013306 Ga0163162_10202761 Ga0163162_102027612 141
103 3300015262 Ga0182007_10109692 Ga0182007_101096922 141
104 3300025938 Ga0207704_10000668 Ga0207704_1000066814 141
105 3300026088 Ga0207641_11458517 Ga0207641_114585171 141
106 3300026095 Ga0207676_10909221 Ga0207676_109092212 141
107 3300028800 Ga0265338_10039888 Ga0265338_100398883 141
108 3300028800 Ga0265338_10067783 Ga0265338_100677832 141
109 3300028800 Ga0265338_10241591 Ga0265338_102415912 141
110 3300031247 Ga0265340_10024950 Ga0265340_100249502 141
111 3300031456 Ga0307513_10626335 Ga0307513_106263352 141
112 3300031548 Ga0307408_100198845 Ga0307408_1001988452 141
113 3300031824 Ga0307413_10639755 Ga0307413_106397552 141
114 3300035724 Ga0373933_0378571 Ga0373933_0378571_30_461 141
115 3300036401 Ga0373937_0456261 Ga0373937_0456261_617_1042 141
116 3300036401 Ga0373937_1620204 Ga0373937_1620204_120_551 141
117 3300037471 Ga0395905_0496872 Ga0395905_0496872_625_1056 141
118 3300039437 Ga0436365_0487284 Ga0436365_0487284_572_1000 141
119 3300039437 Ga0436365_1504068 Ga0436365_1504068_419_850 141
120 3300046472 Ga0495580_0860212 Ga0495580_0860212_70_501 141
121 3300046516 Ga0495628_0331727 Ga0495628_0331727_76_501 141
122 3300048915 Ga0496112_0199421 Ga0496112_0199421_710_1135 141
123 3300048918 Ga0496115_0152688 Ga0496115_0152688_1255_1689 141
124 3300049572 Ga0501036_0711304 Ga0501036_0711304_62_490 141
125 3300049823 Ga0501044_0095010 Ga0501044_0095010_1705_2133 141
126 3300053087 Ga0500643_007630 Ga0500643_007630_3858_4283 141
127 3300053136 Ga0500559_0000042 Ga0500559_0000042_79887_80318 141
128 3300053136 Ga0500559_0021561 Ga0500559_0021561_483_914 141
129 3300053177 Ga0500636_0011176 Ga0500636_0011176_4587_5018 141
130 3300005327 Ga0070658_10128565 Ga0070658_101285653 142
131 3300005334 Ga0068869_101628952 Ga0068869_1016289521 142
132 3300005335 Ga0070666_10154051 Ga0070666_101540512 142
133 3300005345 Ga0070692_10354681 Ga0070692_103546812 142
134 3300005347 Ga0070668_100000072 Ga0070668_10000007213 142
135 3300005347 Ga0070668_100005766 Ga0070668_10000576610 142
136 3300005353 Ga0070669_100236715 Ga0070669_1002367152 142
137 3300005353 Ga0070669_100328678 Ga0070669_1003286781 142
138 3300005355 Ga0070671_100024817 Ga0070671_1000248178 142
139 3300005355 Ga0070671_100127621 Ga0070671_1001276213 142
140 3300005367 Ga0070667_100017228 Ga0070667_1000172283 142
141 3300005367 Ga0070667_100041596 Ga0070667_1000415962 142
142 3300005367 Ga0070667_100469959 Ga0070667_1004699591 142
143 3300005539 Ga0068853_100752913 Ga0068853_1007529133 142
144 3300005548 Ga0070665_100536436 Ga0070665_1005364362 142
145 3300005548 Ga0070665_102657604 Ga0070665_1026576041 142
146 3300005578 Ga0068854_100083067 Ga0068854_1000830673 142
147 3300005614 Ga0068856_101032879 Ga0068856_1010328793 142
148 3300005617 Ga0068859_100005357 Ga0068859_10000535712 142
149 3300005617 Ga0068859_100060864 Ga0068859_1000608642 142
150 3300005618 Ga0068864_100446625 Ga0068864_1004466252 142
151 3300005719 Ga0068861_100232890 Ga0068861_1002328901 142
152 3300005719 Ga0068861_100735635 Ga0068861_1007356351 142
153 3300005841 Ga0068863_100006189 Ga0068863_1000061894 142
154 3300005842 Ga0068858_100048907 Ga0068858_1000489075 142
155 3300005843 Ga0068860_100000032 Ga0068860_100000032232 142
156 3300005843 Ga0068860_100124240 Ga0068860_1001242402 142
157 3300005843 Ga0068860_100656920 Ga0068860_1006569201 142
158 3300005844 Ga0068862_100000644 Ga0068862_10000064435 142
159 3300005844 Ga0068862_100056849 Ga0068862_1000568492 142
160 3300005844 Ga0068862_101058490 Ga0068862_1010584901 142
161 3300006038 Ga0075365_10319219 Ga0075365_103192192 142
162 3300006042 Ga0075368_10001687 Ga0075368_100016876 142
163 3300006051 Ga0075364_10003820 Ga0075364_100038205 142
164 3300006178 Ga0075367_10006644 Ga0075367_100066445 142
165 3300006186 Ga0075369_10205589 Ga0075369_102055892 142
166 3300006195 Ga0075366_10020258 Ga0075366_100202584 142
167 3300006353 Ga0075370_10001352 Ga0075370_1000135211 142
168 3300006353 Ga0075370_10509481 Ga0075370_105094811 142
169 3300006931 Ga0097620_100005357 Ga0097620_1000053572 142
170 3300006931 Ga0097620_100060862 Ga0097620_1000608622 142
171 3300009093 Ga0105240_10006128 Ga0105240_100061287 142
172 3300009093 Ga0105240_10008257 Ga0105240_1000825711 142
173 3300009093 Ga0105240_10159299 Ga0105240_101592994 142
174 3300009093 Ga0105240_11680920 Ga0105240_116809201 142
175 3300009098 Ga0105245_11067538 Ga0105245_110675383 142
176 3300009101 Ga0105247_10207249 Ga0105247_102072492 142
177 3300009174 Ga0105241_10552254 Ga0105241_105522542 142
178 3300009174 Ga0105241_12002779 Ga0105241_120027791 142
179 3300009176 Ga0105242_10758891 Ga0105242_107588912 142
180 3300009177 Ga0105248_10005911 Ga0105248_1000591110 142
181 3300009551 Ga0105238_10274766 Ga0105238_102747662 142
182 3300009551 Ga0105238_10347894 Ga0105238_103478942 142
183 3300009551 Ga0105238_12064051 Ga0105238_120640511 142
184 3300009551 Ga0105238_12768098 Ga0105238_127680981 142
185 3300010375 Ga0105239_10045681 Ga0105239_100456814 142
186 3300013306 Ga0163162_10407904 Ga0163162_104079041 142
187 3300014325 Ga0163163_10021342 Ga0163163_100213429 142
188 3300014325 Ga0163163_10103443 Ga0163163_101034435 142
189 3300014968 Ga0157379_10064431 Ga0157379_100644316 142
190 3300014969 Ga0157376_10840587 Ga0157376_108405872 142
191 3300021361 Ga0213872_10015499 Ga0213872_100154995 142
192 3300025913 Ga0207695_10003533 Ga0207695_1000353315 142
193 3300025913 Ga0207695_10004836 Ga0207695_1000483612 142
194 3300025913 Ga0207695_10086815 Ga0207695_100868154 142
195 3300025923 Ga0207681_10077461 Ga0207681_100774613 142
196 3300025923 Ga0207681_10465752 Ga0207681_104657521 142
197 3300025924 Ga0207694_10487548 Ga0207694_104875481 142
198 3300025924 Ga0207694_10920261 Ga0207694_109202612 142
199 3300025925 Ga0207650_10020185 Ga0207650_100201852 142
200 3300025925 Ga0207650_10282599 Ga0207650_102825993 142
201 3300025925 Ga0207650_10452762 Ga0207650_104527622 142
202 3300025927 Ga0207687_11127308 Ga0207687_111273082 142
203 3300025934 Ga0207686_10485052 Ga0207686_104850522 142
204 3300025941 Ga0207711_10008323 Ga0207711_100083239 142
205 3300025961 Ga0207712_11098893 Ga0207712_110988931 142
206 3300025972 Ga0207668_10004234 Ga0207668_100042346 142
207 3300025972 Ga0207668_10005371 Ga0207668_100053719 142
208 3300025972 Ga0207668_10084728 Ga0207668_100847281 142
209 3300025986 Ga0207658_10027873 Ga0207658_100278733 142
210 3300026035 Ga0207703_10033865 Ga0207703_100338654 142
211 3300026035 Ga0207703_10034177 Ga0207703_100341772 142
212 3300026041 Ga0207639_10555299 Ga0207639_105552993 142
213 3300026078 Ga0207702_11060800 Ga0207702_110608001 142
214 3300026088 Ga0207641_10002251 Ga0207641_1000225114 142
215 3300026095 Ga0207676_10446488 Ga0207676_104464881 142
216 3300026118 Ga0207675_100081065 Ga0207675_1000810652 142
217 3300026118 Ga0207675_100412871 Ga0207675_1004128713 142
218 3300026118 Ga0207675_100857078 Ga0207675_1008570781 142
219 3300027866 Ga0209813_10066185 Ga0209813_100661852 142
220 3300028380 Ga0268265_10001386 Ga0268265_100013866 142
221 3300028380 Ga0268265_10515502 Ga0268265_105155022 142
222 3300028380 Ga0268265_10838687 Ga0268265_108386871 142
223 3300028381 Ga0268264_10000045 Ga0268264_10000045121 142
224 3300028381 Ga0268264_10862584 Ga0268264_108625842 142
225 3300028786 Ga0307517_10070835 Ga0307517_100708352 142
226 3300028800 Ga0265338_10146118 Ga0265338_101461182 142
227 3300031242 Ga0265329_10349416 Ga0265329_103494161 142
228 3300031251 Ga0265327_10001920 Ga0265327_100019204 142
229 3300031251 Ga0265327_10054026 Ga0265327_100540264 142
230 3300031730 Ga0307516_10000022 Ga0307516_1000002219 142
231 3300035114 Ga0373939_0093691 Ga0373939_0093691_357_788 142
232 3300035691 Ga0373931_0123387 Ga0373931_0123387_228_659 142
233 3300037068 Ga0373925_0163820 Ga0373925_0163820_531_962 142
234 3300037068 Ga0373925_1020624 Ga0373925_1020624_140_571 142
235 3300037312 Ga0395899_0000016 Ga0395899_0000016_389074_389502 142
236 3300039447 Ga0436361_0195157 Ga0436361_0195157_5023_5451 142
237 3300039447 Ga0436361_0250096 Ga0436361_0250096_208_636 142
238 3300039447 Ga0436361_0903973 Ga0436361_0903973_70_498 142
239 3300039447 Ga0436361_1168976 Ga0436361_1168976_293_721 142
240 3300039447 Ga0436361_1192202 Ga0436361_1192202_1059_1487 142
241 3300041997 Ga0439431_0045374 Ga0439431_0045374_679_1107 142
242 3300042004 Ga0439445_0068822 Ga0439445_0068822_430_858 142
243 3300045049 Ga0466959_0330390 Ga0466959_0330390_545_973 142
244 3300046460 Ga0495638_0134601 Ga0495638_0134601_46_477 142
245 3300046507 Ga0495606_0654294 Ga0495606_0654294_44_475 142
246 3300046515 Ga0495620_0200046 Ga0495620_0200046_110_541 142
247 3300046520 Ga0495637_0086036 Ga0495637_0086036_559_990 142
248 3300046520 Ga0495637_0337563 Ga0495637_0337563_46_477 142
249 3300046522 Ga0495643_0013207 Ga0495643_0013207_3169_3600 142
250 3300046528 Ga0495642_0039794 Ga0495642_0039794_1337_1771 142
251 3300046538 Ga0495609_0072338 Ga0495609_0072338_262_693 142
252 3300046542 Ga0495597_0002237 Ga0495597_0002237_1779_2210 142
253 3300046542 Ga0495597_0259012 Ga0495597_0259012_133_564 142
254 3300046557 Ga0495622_0005534 Ga0495622_0005534_1536_1967 142
255 3300046616 Ga0495668_0124980 Ga0495668_0124980_947_1378 142
256 3300046660 Ga0495625_0099276 Ga0495625_0099276_317_748 142
257 3300046660 Ga0495625_0214177 Ga0495625_0214177_666_1100 142
258 3300046663 Ga0495635_0215095 Ga0495635_0215095_740_1171 142
259 3300046684 Ga0495669_0000005 Ga0495669_0000005_135382_135816 142
260 3300046690 Ga0495624_0537736 Ga0495624_0537736_20_451 142
261 3300047315 Ga0495581_0041881 Ga0495581_0041881_450_881 142
262 3300047443 Ga0495687_037418 Ga0495687_037418_377_808 142
263 3300047472 Ga0495686_0053022 Ga0495686_0053022_1726_2157 142
264 3300047673 Ga0495593_0001938 Ga0495593_0001938_4665_5096 142
265 3300048090 Ga0495615_0005446 Ga0495615_0005446_1734_2162 142
266 3300048904 Ga0496101_0410711 Ga0496101_0410711_301_729 142
267 3300048918 Ga0496115_0002327 Ga0496115_0002327_10253_10681 142
268 3300048918 Ga0496115_0020272 Ga0496115_0020272_2143_2571 142
269 3300048922 Ga0496119_0028053 Ga0496119_0028053_2057_2485 142
270 3300048924 Ga0496121_0000035 Ga0496121_0000035_116157_116585 142
271 3300050489 nmdc:mga03683_24666_c1 nmdc:mga03683_24666_c1_622_1053 142
272 3300050490 nmdc:mga03n38_772312_c1 nmdc:mga03n38_772312_c1_45_476 142
273 3300050491 nmdc:mga00v17_6139_c1 nmdc:mga00v17_6139_c1_571_1002 142
274 3300050493 nmdc:mga0k408_121091_c1 nmdc:mga0k408_121091_c1_1080_1511 142
275 3300050494 nmdc:mga06z11_12913_c1 nmdc:mga06z11_12913_c1_2351_2782 142
276 3300050495 nmdc:mga04h51_78846_c1 nmdc:mga04h51_78846_c1_315_746 142
277 3300050496 nmdc:mga07m45_287780_c1 nmdc:mga07m45_287780_c1_191_622 142
278 3300050496 nmdc:mga07m45_37190_c1 nmdc:mga07m45_37190_c1_330_761 142
279 3300050516 nmdc:mga0sz30_215700_c1 nmdc:mga0sz30_215700_c1_179_610 142
280 3300053087 Ga0500643_012886 Ga0500643_012886_2514_2942 142
281 3300053092 Ga0500583_0019914 Ga0500583_0019914_1465_1896 142
282 3300053093 Ga0500651_0030693 Ga0500651_0030693_1436_1867 142
283 3300053094 Ga0500566_0043523 Ga0500566_0043523_1656_2087 142
284 3300053098 Ga0500650_0351679 Ga0500650_0351679_70_501 142
285 3300053103 Ga0500555_002048 Ga0500555_002048_3321_3752 142
286 3300053104 Ga0500556_0013744 Ga0500556_0013744_52_483 142
287 3300053109 Ga0500569_005407 Ga0500569_005407_828_1259 142
288 3300053111 Ga0500572_035931 Ga0500572_035931_727_1158 142
289 3300053119 Ga0500595_007611 Ga0500595_007611_2567_2998 142
290 3300053121 Ga0500607_108730 Ga0500607_108730_183_614 142
291 3300053122 Ga0500608_023326 Ga0500608_023326_1558_1989 142
292 3300053123 Ga0500614_004094 Ga0500614_004094_1213_1644 142
293 3300053130 Ga0500642_0032633 Ga0500642_0032633_1563_1994 142
294 3300053130 Ga0500642_0335869 Ga0500642_0335869_99_530 142
295 3300053134 Ga0500658_0026869 Ga0500658_0026869_1511_1942 142
296 3300053148 Ga0500590_001960 Ga0500590_001960_7483_7914 142
297 3300053153 Ga0500616_0033516 Ga0500616_0033516_1207_1635 142
298 3300053154 Ga0500619_002786 Ga0500619_002786_2857_3288 142
299 3300053155 Ga0500620_097471 Ga0500620_097471_150_581 142
300 3300053156 Ga0500622_0022034 Ga0500622_0022034_591_1022 142
301 3300053177 Ga0500636_0088154 Ga0500636_0088154_1308_1739 142
302 3300053178 Ga0500637_0047943 Ga0500637_0047943_1151_1582 142
303 3300053725 Ga0500576_169291 Ga0500576_169291_83_514 142
304 3300053729 Ga0500625_040729 Ga0500625_040729_924_1355 142
305 3300053735 Ga0500596_007428 Ga0500596_007428_1012_1443 142

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jor-assembly1.cif.gz_A ensemble structures for unligated staphylococcal nuclease-h124l 0.307 86 140
3itp-assembly1.cif.gz_A crystal structure of staphylococcal nuclease variant delta+phs f34k at cryogenic temperature 0.3013 86 140
4p3m-assembly1.cif.gz_A crystal structure of serine hydroxymethyltransferase from psychromonas ingrahamii 0.3008 22 109
4p3m-assembly1.cif.gz_A crystal structure of serine hydroxymethyltransferase from psychromonas ingrahamii 0.2055 22 109
2kq3-assembly1.cif.gz_A solution structure of snase140 0.204 58 140
ID Description Score Start End Superfamily
4uacA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.2787 89 137 3.40.190.10
2y0yT00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.266 17 117 1.20.58.110
af_Q03603_1_98_1.10.238.110 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;Diacylglycerol kinase alpha. 0.2483 31 137 1.10.238.110
2y0yT00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.2443 17 117 1.20.58.110
2aqcA00 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;H/ACA ribonucleoprotein complex, subunit Nop10 0.2405 113 134 2.20.28.40
ID Description Score Start End GO Terms
AF-A0A840A3A0-F1-model_v4 Uncharacterized protein 0.8248 6 141
AF-A0A7W9CFE2-F1-model_v4 Uncharacterized protein 0.8185 1 70
AF-A0A840A3A0-F1-model_v4 Uncharacterized protein 0.7905 6 141
AF-A0A7W9CFE2-F1-model_v4 Uncharacterized protein 0.7578 1 70
AF-A0A6B3UIR3-F1-model_v4 Uncharacterized protein 0.7335 26 141

Feature Viewer

pLDDT pTM Quality
87.79 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map