F398174

General Info

Members Datasets Scaffolds Average Seq Length
305 216 611 208

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10143310|Ga0265318_101433102
Length 239
Sequence MQAPLHRTRIKICGLTREQDIDAAVHAGADAVGFVMYRASPRHVTVARAAELARRLPPFVTPVLLFVNETAPTVIAARAAVAGAVIQFHGDETPEQCNAVGPSFIRAARIPLDAAAAGFDLVKYAQAYRQAQAILLDAHVEGYGGGGKTFNWSLISKSLTSDPAPTGAGLCPLVLSGGLTAANVIDGILQIRPWAVDVSSGVEASKGIKDPEKIHQFVAAVRLADERIAGLKNVRLPAT

Samples

Sample ID Description Type Environment
1 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
55 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
109 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
135 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
136 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
137 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
138 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
139 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
203 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
205 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
211 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
212 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
213 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
214 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
215 2831864461 Roseateles noduli HZ7 Isolate Nodule
216 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 0.33
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.59
Nodule 1.31
Rhizoplane 0.98
Rhizosphere 63.28
Stem 0
Stem Tuber 0
Unclassified 1.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265318_10143310 3300028577 Bacteria 877
2 JGI25156J39149_1016013 3300002705 Bacteria 1476
3 JGI25162J39368_1006056 3300002737 Bacteria 2178
4 JGI25154J39366_1004852 3300002738 Bacteria 2284
5 JGI25157J39369_1001473 3300002741 Bacteria 8720
6 JGI25157J39369_1003405 3300002741 Bacteria 3270
7 JGI25164J39214_1000587 3300002772 Bacteria 16308
8 JGI25165J46597_1001159 3300003214 Bacteria 16326
9 rootL2_10006461 3300003322 Bacteria 12808
10 rootH1_10024766 3300003316 Bacteria 5634
11 rootH1_10024766 3300003323 Bacteria 6031
12 Ga0055539_1005625 3300003752 Bacteria 1622
13 Ga0055539_1016633 3300003752 Bacteria 892
14 Ga0055533_1006060 3300003756 Bacteria 1840
15 Ga0055525_1000233 3300003759 Bacteria 58310
16 Ga0055525_1000346 3300003759 Bacteria 33587
17 Ga0055527_1000149 3300003760 Bacteria 49224
18 Ga0055527_1000259 3300003760 Bacteria 32195
19 Ga0055527_1000266 3300003760 Bacteria 31574
20 Ga0055527_1006338 3300003760 Bacteria 1485
21 Ga0055535_1000395 3300003761 Bacteria 41210
22 Ga0055535_1000606 3300003761 Bacteria 29564
23 Ga0055535_1000651 3300003761 Bacteria 27644
24 Ga0055535_1001113 3300003761 Bacteria 16309
25 Ga0055542_1000167 3300003762 Bacteria 83068
26 Ga0055542_1000264 3300003762 Bacteria 58581
27 Ga0055542_1000364 3300003762 Bacteria 47003
28 Ga0055542_1008129 3300003762 Bacteria 2071
29 Ga0055529_1000416 3300003763 Bacteria 43929
30 Ga0055529_1000640 3300003763 Bacteria 25655
31 Ga0055529_1000908 3300003763 Bacteria 16313
32 Ga0055526_1001331 3300003771 Bacteria 17689
33 Ga0055540_1018447 3300003792 Bacteria 1912
34 Ga0055531_10005778 3300003794 Bacteria 7163
35 Ga0055543_1002541 3300004625 Bacteria 5953
36 Ga0058859_10043507 3300004798 Bacteria 1526
37 Ga0065165_1000395 3300005262 Bacteria 70688
38 Ga0065165_1000995 3300005262 Bacteria 34985
39 Ga0070658_10235109 3300005327 Bacteria 1552
40 Ga0070658_10372803 3300005327 Bacteria 1224
41 Ga0070676_10024179 3300005328 Bacteria 3419
42 Ga0070666_10000007 3300005335 Bacteria 293732
43 Ga0070687_100331020 3300005343 Bacteria 976
44 Ga0070661_100090668 3300005344 Bacteria 2264
45 Ga0070668_100151328 3300005347 Bacteria 1877
46 Ga0070668_100762213 3300005347 Bacteria 857
47 Ga0070671_100020110 3300005355 Bacteria 5440
48 Ga0070674_100080320 3300005356 Bacteria 2328
49 Ga0070688_100611785 3300005365 Bacteria 835
50 Ga0070667_100037500 3300005367 Bacteria 4063
51 Ga0070700_100035822 3300005441 Bacteria 3006
52 Ga0070663_100582984 3300005455 Bacteria 938
53 Ga0070678_101017214 3300005456 Bacteria 762
54 Ga0068867_100000005 3300005459 Bacteria 174097
55 Ga0068853_100826189 3300005539 Bacteria 888
56 Ga0070665_100000817 3300005548 Bacteria 40729
57 Ga0068854_100020103 3300005578 Bacteria 4511
58 Ga0068856_100002593 3300005614 Bacteria 18615
59 Ga0068852_100003098 3300005616 Bacteria 11576
60 Ga0068859_100083583 3300005617 Bacteria 3236
61 Ga0068870_10022163 3300005840 Bacteria 3118
62 Ga0068862_100260597 3300005844 Bacteria 1582
63 Ga0081455_10103511 3300005937 Bacteria 2279
64 Ga0081539_10003782 3300005985 Bacteria 17888
65 Ga0075362_10033677 3300006177 Bacteria 2229
66 Ga0075362_10060236 3300006177 Bacteria 1715
67 Ga0075367_10093105 3300006178 Bacteria 1835
68 Ga0075366_10017777 3300006195 Bacteria 4099
69 Ga0097621_100075175 3300006237 Bacteria 2799
70 Ga0075370_10007774 3300006353 Bacteria 5477
71 Ga0075370_10044698 3300006353 Bacteria 2504
72 Ga0068871_100066264 3300006358 Bacteria 2960
73 Ga0097620_100083588 3300006931 Bacteria 3236
74 Ga0099824_1043770 3300006942 Bacteria 987
75 Ga0099823_1000985 3300006944 Bacteria 21888
76 Ga0111539_10005820 3300009094 Bacteria 15939
77 Ga0111539_10231417 3300009094 Bacteria 2152
78 Ga0105247_10059414 3300009101 Bacteria 2367
79 Ga0114129_10847373 3300009147 Bacteria 1162
80 Ga0105243_10006176 3300009148 Bacteria 9263
81 Ga0105237_10000595 3300009545 Bacteria 50470
82 Ga0105238_10001931 3300009551 Bacteria 20819
83 Ga0105238_10216353 3300009551 Bacteria 1892
84 Ga0105249_10819678 3300009553 Bacteria 995
85 Ga0105249_11377201 3300009553 Unclassified 777
86 Ga0105246_10059714 3300011119 Bacteria 2646
87 Ga0157319_1000006 3300012497 Bacteria 361506
88 Ga0157370_10006616 3300013104 Bacteria 12736
89 Ga0163162_10001668 3300013306 Bacteria 20833
90 Ga0157375_11149778 3300013308 Bacteria 909
91 Ga0157377_10000244 3300014745 Bacteria 27334
92 Ga0183369_1009 3300015685 Bacteria 346348
93 Ga0163161_10113330 3300017792 Bacteria 2029
94 Ga0213872_10000647 3300021361 Bacteria 26348
95 Ga0209674_100523 3300025226 Bacteria 15570
96 Ga0209672_100007 3300025228 Bacteria 959482
97 Ga0209672_100018 3300025228 Bacteria 432924
98 Ga0209672_100198 3300025228 Bacteria 47906
99 Ga0209672_100599 3300025228 Bacteria 18942
100 Ga0209563_100071 3300025230 Bacteria 232653
101 Ga0207427_100036 3300025231 Bacteria 309540
102 Ga0209437_101013 3300025233 Bacteria 9710
103 Ga0209258_100017 3300025242 Bacteria 590785
104 Ga0209258_100024 3300025242 Bacteria 542096
105 Ga0209258_100035 3300025242 Bacteria 430864
106 Ga0209258_100379 3300025242 Bacteria 57256
107 Ga0209258_112615 3300025242 Bacteria 1031
108 Ga0209646_1001471 3300025246 Bacteria 6278
109 Ga0209646_1005067 3300025246 Bacteria 2335
110 Ga0209026_1000056 3300025250 Bacteria 236450
111 Ga0209026_1000162 3300025250 Bacteria 102867
112 Ga0209026_1000513 3300025250 Bacteria 27282
113 Ga0209677_101331 3300025253 Bacteria 10857
114 Ga0209677_106509 3300025253 Bacteria 2747
115 Ga0209148_1000009 3300025254 Bacteria 1395625
116 Ga0209148_1000044 3300025254 Bacteria 458417
117 Ga0209148_1000045 3300025254 Bacteria 448076
118 Ga0209148_1000048 3300025254 Bacteria 430913
119 Ga0209759_1000166 3300025256 Bacteria 113080
120 Ga0209759_1000670 3300025256 Bacteria 31566
121 Ga0209233_1000101 3300025261 Bacteria 286063
122 Ga0209455_1000010 3300025272 Bacteria 959482
123 Ga0209455_1000029 3300025272 Bacteria 542096
124 Ga0209455_1000035 3300025272 Bacteria 479071
125 Ga0209455_1000560 3300025272 Bacteria 25084
126 Ga0209673_1010710 3300025273 Bacteria 3843
127 Ga0209564_1000003 3300025295 Bacteria 1585848
128 Ga0209050_1012336 3300025298 Bacteria 3930
129 Ga0209256_1002401 3300025299 Bacteria 15389
130 Ga0209051_1003352 3300025303 Bacteria 10557
131 Ga0209257_1001931 3300025304 Bacteria 22372
132 Ga0207680_10000002 3300025903 Bacteria 1018646
133 Ga0207705_10032332 3300025909 Bacteria 3738
134 Ga0207671_10010424 3300025914 Bacteria 7668
135 Ga0207662_10400316 3300025918 Bacteria 931
136 Ga0207649_10062885 3300025920 Bacteria 2341
137 Ga0207694_10000177 3300025924 Bacteria 65875
138 Ga0207694_10133598 3300025924 Bacteria 1991
139 Ga0207709_10003666 3300025935 Bacteria 9044
140 Ga0207667_10317081 3300025949 Bacteria 1592
141 Ga0207640_10015853 3300025981 Bacteria 4373
142 Ga0207658_10108538 3300025986 Bacteria 2189
143 Ga0207703_10556671 3300026035 Bacteria 1082
144 Ga0207639_10464967 3300026041 Bacteria 1151
145 Ga0207678_10146910 3300026067 Bacteria 2012
146 Ga0207678_10290017 3300026067 Bacteria 1405
147 Ga0207708_10062788 3300026075 Bacteria 2838
148 Ga0207702_10018842 3300026078 Bacteria 5709
149 Ga0207648_10000541 3300026089 Bacteria 42157
150 Ga0207698_10366601 3300026142 Bacteria 1366
151 Ga0209389_1010870 3300027296 Bacteria 8227
152 Ga0209813_10101827 3300027866 Bacteria 978
153 Ga0209974_10001160 3300027876 Bacteria 9386
154 Ga0207428_10013975 3300027907 Bacteria 6992
155 Ga0207428_10106898 3300027907 Bacteria 2156
156 Ga0268266_10000004 3300028379 Bacteria 1495817
157 Ga0268265_10211370 3300028380 Bacteria 1691
158 Ga0307515_10002409 3300028794 Bacteria 40792
159 Ga0265331_10042041 3300031250 Bacteria 2219
160 Ga0307513_10137312 3300031456 Bacteria 2378
161 Ga0307513_10464561 3300031456 Bacteria 988
162 Ga0316578_10000202 3300031728 Bacteria 16966
163 Ga0307516_10001303 3300031730 Bacteria 34698
164 Ga0316577_10013725 3300031733 Bacteria 4438
165 Ga0307413_10370352 3300031824 Bacteria 1112
166 Ga0307410_10010051 3300031852 Bacteria 5342
167 Ga0307414_10066531 3300032004 Bacteria 2577
168 Ga0307411_10199788 3300032005 Bacteria 1534
169 Ga0307510_10001742 3300033180 Bacteria 24237
170 Ga0373947_0466735 3300035725 Bacteria 856
171 Ga0373925_0069518 3300037068 Bacteria 2660
172 Ga0395899_0000404 3300037312 Bacteria 50522
173 Ga0395899_0010991 3300037312 Bacteria 6934
174 Ga0395900_0000107 3300037418 Bacteria 149024
175 Ga0395898_0000078 3300037466 Bacteria 244514
176 Ga0395898_0000211 3300037466 Bacteria 149301
177 Ga0395905_0029070 3300037471 Bacteria 5208
178 Ga0395905_0044723 3300037471 Bacteria 4154
179 Ga0395901_0146934 3300038443 Bacteria 2478
180 Ga0395901_0304485 3300038443 Bacteria 1652
181 Ga0436361_0882487 3300039447 Bacteria 26486
182 Ga0436361_0969151 3300039447 Bacteria 1099
183 Ga0451793_0466386 3300041452 Bacteria 1499
184 Ga0451800_0410668 3300041459 Bacteria 2378
185 Ga0439431_0001183 3300041997 Bacteria 5703
186 Ga0450890_004141 3300042127 Bacteria 1903
187 Ga0450898_029761 3300042134 Bacteria 997
188 Ga0450908_002562 3300042184 Bacteria 3565
189 Ga0439459_0002812 3300042438 Bacteria 2715
190 Ga0451577_0027444 3300042876 Bacteria 5154
191 Ga0451577_0637187 3300042876 Bacteria 967
192 Ga0466988_0066541 3300044536 Bacteria 2126
193 Ga0466969_0002513 3300044656 Bacteria 9807
194 Ga0466969_0234492 3300044656 Bacteria 833
195 Ga0466989_0182326 3300044663 Bacteria 1247
196 Ga0466966_0016803 3300044684 Bacteria 4834
197 Ga0466966_0061311 3300044684 Bacteria 2372
198 Ga0466961_0000906 3300044693 Bacteria 18402
199 Ga0466961_0002884 3300044693 Bacteria 10664
200 Ga0466961_0022546 3300044693 Bacteria 4050
201 Ga0466961_0139611 3300044693 Bacteria 1517
202 Ga0466963_0149236 3300044694 Bacteria 1623
203 Ga0466964_0008393 3300044706 Bacteria 3881
204 Ga0453684_0665103 3300044712 Bacteria 1135
205 Ga0466968_0057910 3300044735 Bacteria 1667
206 Ga0466970_0005775 3300044765 Bacteria 6151
207 Ga0466970_0006092 3300044765 Bacteria 6011
208 Ga0466957_0062767 3300044842 Bacteria 2282
209 Ga0466959_0000110 3300045049 Bacteria 52740
210 Ga0466959_0029071 3300045049 Bacteria 4094
211 Ga0466959_0102986 3300045049 Bacteria 2042
212 Ga0451576_0820558 3300045051 Bacteria 976
213 Ga0466958_0081242 3300045836 Bacteria 1994
214 Ga0466967_0011210 3300045976 Bacteria 6776
215 Ga0495594_0219075 3300046499 Bacteria 1085
216 Ga0495606_0070583 3300046507 Bacteria 2202
217 Ga0495610_0063981 3300046512 Bacteria 1740
218 Ga0495620_0010812 3300046515 Bacteria 4799
219 Ga0495632_0240399 3300046519 Bacteria 814
220 Ga0495643_0174248 3300046522 Bacteria 1050
221 Ga0495625_0009603 3300046660 Bacteria 8075
222 Ga0495625_0018610 3300046660 Bacteria 5415
223 Ga0495686_0081747 3300047472 Bacteria 1972
224 Ga0496102_0114266 3300048905 Bacteria 2519
225 Ga0496117_0191253 3300048920 Bacteria 1165
226 Ga0496124_0024076 3300048927 Bacteria 5543
227 Ga0496125_0181577 3300048928 Bacteria 1401
228 Ga0496126_0122272 3300048929 Bacteria 2256
229 Ga0496126_0849715 3300048929 Bacteria 696
230 Ga0501299_064850 3300049522 Bacteria 781
231 Ga0501031_0494147 3300049568 Bacteria 789
232 Ga0501032_0007967 3300049569 Bacteria 7722
233 Ga0501033_0595315 3300049570 Bacteria 759
234 Ga0501034_0069897 3300049571 Bacteria 3522
235 Ga0501036_0149290 3300049572 Bacteria 1971
236 Ga0501036_0528173 3300049572 Bacteria 981
237 Ga0501037_0025221 3300049573 Bacteria 4393
238 Ga0501037_0343737 3300049573 Unclassified 1030
239 Ga0501039_0148072 3300049575 Bacteria 1845
240 Ga0501040_0001956 3300049576 Bacteria 13274
241 Ga0501040_0217152 3300049576 Bacteria 1360
242 Ga0501041_0025885 3300049577 Bacteria 3528
243 Ga0501041_0026419 3300049577 Bacteria 3493
244 Ga0501042_0021837 3300049578 Bacteria 4466
245 Ga0501043_0000108 3300049579 Bacteria 77329
246 Ga0501043_0022379 3300049579 Bacteria 4958
247 Ga0501043_0048142 3300049579 Bacteria 3352
248 Ga0501043_0623449 3300049579 Bacteria 795
249 Ga0501046_0000050 3300049580 Bacteria 134922
250 Ga0501046_0065029 3300049580 Bacteria 2846
251 Ga0501047_0000012 3300049581 Bacteria 368824
252 Ga0501048_0001920 3300049582 Bacteria 15783
253 Ga0501048_0033944 3300049582 Bacteria 3684
254 Ga0501048_0063971 3300049582 Bacteria 2601
255 Ga0501048_0437144 3300049582 Bacteria 936
256 Ga0501068_0457041 3300049584 Bacteria 826
257 Ga0501071_0080701 3300049587 Bacteria 2379
258 Ga0501071_0086219 3300049587 Bacteria 2303
259 Ga0501072_0003566 3300049588 Bacteria 11705
260 Ga0501072_0181691 3300049588 Bacteria 1678
261 Ga0501074_0051752 3300049590 Bacteria 2964
262 Ga0501075_0000204 3300049591 Bacteria 31579
263 Ga0501075_0047064 3300049591 Bacteria 3241
264 Ga0501076_0038593 3300049592 Bacteria 3749
265 Ga0501076_0069475 3300049592 Bacteria 2814
266 Ga0501077_0019438 3300049593 Bacteria 4297
267 Ga0501077_0154333 3300049593 Bacteria 1457
268 Ga0501077_0351021 3300049593 Unclassified 941
269 Ga0501222_002144 3300049662 Bacteria 2737
270 Ga0501079_0003175 3300049741 Bacteria 12037
271 Ga0501079_0109360 3300049741 Bacteria 2147
272 Ga0501080_0025780 3300049742 Bacteria 5461
273 Ga0501081_0173510 3300049743 Bacteria 1557
274 Ga0501081_0197484 3300049743 Unclassified 1458
275 Ga0501035_0343415 3300049822 Bacteria 1250
276 Ga0501035_0434339 3300049822 Bacteria 1088
277 Ga0501035_0444388 3300049822 Bacteria 1073
278 Ga0501045_0002562 3300049824 Bacteria 12390
279 Ga0501045_0005119 3300049824 Bacteria 9072
280 Ga0501045_0214051 3300049824 Bacteria 1435
281 nmdc:mga03683_36049_c1 3300050489 Bacteria 2010
282 nmdc:mga0k408_27041_c1 3300050493 Bacteria 3256
283 nmdc:mga0k408_27087_c1 3300050493 Bacteria 3253
284 nmdc:mga0k408_483312_c1 3300050493 Bacteria 735
285 nmdc:mga04h51_149383_c1 3300050495 Bacteria 892
286 nmdc:mga05p37_693041_c2 3300050507 Unclassified 817
287 nmdc:mga08y16_284465_c1 3300050511 Bacteria 1705
288 nmdc:mga08y16_481_c1 3300050511 Bacteria 36847
289 Ga0500595_026020 3300053119 Bacteria 2021
290 Ga0500658_0010715 3300053134 Bacteria 3382
291 Ga0500622_0018928 3300053156 Bacteria 3659
292 Ga0500587_001782 3300053739 Bacteria 3059
293 Ga0501084_0008089 3300054114 Bacteria 8661
294 Ga0590075_018267 3300059424 Bacteria 1733
295 Ga0501082_0007651 3300060353 Bacteria 9320
296 Ga0501082_0219953 3300060353 Bacteria 1652
297 Ga0466962_0002526 3300061719 Bacteria 8691
298 Ga0466962_0034403 3300061719 Bacteria 2426
299 Ga0466962_0196859 3300061719 Bacteria 984
300 Ga0530510_0023561 3300061734 Bacteria 4388
301 2587757634 2585428062 Bacteria 6842168
302 2643894210 2643221577 Bacteria 3710843
303 2644476412 2643221685 Bacteria 3673288
304 2687582457 2687453130 Bacteria 4227172
305 2831869958 2831864461 Bacteria 6502356
306 2886854429 2886848708 Bacteria 5632523
307 Ga0265318_10143310
308 JGI25156J39149_1016013
309 JGI25162J39368_1006056
310 JGI25154J39366_1004852
311 JGI25157J39369_1001473
312 JGI25157J39369_1003405
313 JGI25164J39214_1000587
314 JGI25165J46597_1001159
315 rootL2_10006461
316 rootH1_10024766
317 Ga0055539_1005625
318 Ga0055539_1016633
319 Ga0055533_1006060
320 Ga0055525_1000233
321 Ga0055525_1000346
322 Ga0055527_1000149
323 Ga0055527_1000259
324 Ga0055527_1000266
325 Ga0055527_1006338
326 Ga0055535_1000395
327 Ga0055535_1000606
328 Ga0055535_1000651
329 Ga0055535_1001113
330 Ga0055542_1000167
331 Ga0055542_1000264
332 Ga0055542_1000364
333 Ga0055542_1008129
334 Ga0055529_1000416
335 Ga0055529_1000640
336 Ga0055529_1000908
337 Ga0055526_1001331
338 Ga0055540_1018447
339 Ga0055531_10005778
340 Ga0055543_1002541
341 Ga0058859_10043507
342 Ga0065165_1000395
343 Ga0065165_1000995
344 Ga0070658_10235109
345 Ga0070658_10372803
346 Ga0070676_10024179
347 Ga0070666_10000007
348 Ga0070687_100331020
349 Ga0070661_100090668
350 Ga0070668_100151328
351 Ga0070668_100762213
352 Ga0070671_100020110
353 Ga0070674_100080320
354 Ga0070688_100611785
355 Ga0070667_100037500
356 Ga0070700_100035822
357 Ga0070663_100582984
358 Ga0070678_101017214
359 Ga0068867_100000005
360 Ga0068853_100826189
361 Ga0070665_100000817
362 Ga0068854_100020103
363 Ga0068856_100002593
364 Ga0068852_100003098
365 Ga0068859_100083583
366 Ga0068870_10022163
367 Ga0068862_100260597
368 Ga0081455_10103511
369 Ga0081539_10003782
370 Ga0075362_10033677
371 Ga0075362_10060236
372 Ga0075367_10093105
373 Ga0075366_10017777
374 Ga0097621_100075175
375 Ga0075370_10007774
376 Ga0075370_10044698
377 Ga0068871_100066264
378 Ga0097620_100083588
379 Ga0099824_1043770
380 Ga0099823_1000985
381 Ga0111539_10005820
382 Ga0111539_10231417
383 Ga0105247_10059414
384 Ga0114129_10847373
385 Ga0105243_10006176
386 Ga0105237_10000595
387 Ga0105238_10001931
388 Ga0105238_10216353
389 Ga0105249_10819678
390 Ga0105249_11377201
391 Ga0105246_10059714
392 Ga0157319_1000006
393 Ga0157370_10006616
394 Ga0163162_10001668
395 Ga0157375_11149778
396 Ga0157377_10000244
397 Ga0183369_1009
398 Ga0163161_10113330
399 Ga0213872_10000647
400 Ga0209674_100523
401 Ga0209672_100007
402 Ga0209672_100018
403 Ga0209672_100198
404 Ga0209672_100599
405 Ga0209563_100071
406 Ga0207427_100036
407 Ga0209437_101013
408 Ga0209258_100017
409 Ga0209258_100024
410 Ga0209258_100035
411 Ga0209258_100379
412 Ga0209258_112615
413 Ga0209646_1001471
414 Ga0209646_1005067
415 Ga0209026_1000056
416 Ga0209026_1000162
417 Ga0209026_1000513
418 Ga0209677_101331
419 Ga0209677_106509
420 Ga0209148_1000009
421 Ga0209148_1000044
422 Ga0209148_1000045
423 Ga0209148_1000048
424 Ga0209759_1000166
425 Ga0209759_1000670
426 Ga0209233_1000101
427 Ga0209455_1000010
428 Ga0209455_1000029
429 Ga0209455_1000035
430 Ga0209455_1000560
431 Ga0209673_1010710
432 Ga0209564_1000003
433 Ga0209050_1012336
434 Ga0209256_1002401
435 Ga0209051_1003352
436 Ga0209257_1001931
437 Ga0207680_10000002
438 Ga0207705_10032332
439 Ga0207671_10010424
440 Ga0207662_10400316
441 Ga0207649_10062885
442 Ga0207694_10000177
443 Ga0207694_10133598
444 Ga0207709_10003666
445 Ga0207667_10317081
446 Ga0207640_10015853
447 Ga0207658_10108538
448 Ga0207703_10556671
449 Ga0207639_10464967
450 Ga0207678_10146910
451 Ga0207678_10290017
452 Ga0207708_10062788
453 Ga0207702_10018842
454 Ga0207648_10000541
455 Ga0207698_10366601
456 Ga0209389_1010870
457 Ga0209813_10101827
458 Ga0209974_10001160
459 Ga0207428_10013975
460 Ga0207428_10106898
461 Ga0268266_10000004
462 Ga0268265_10211370
463 Ga0307515_10002409
464 Ga0265331_10042041
465 Ga0307513_10137312
466 Ga0307513_10464561
467 Ga0316578_10000202
468 Ga0307516_10001303
469 Ga0316577_10013725
470 Ga0307413_10370352
471 Ga0307410_10010051
472 Ga0307414_10066531
473 Ga0307411_10199788
474 Ga0307510_10001742
475 Ga0373947_0466735
476 Ga0373925_0069518
477 Ga0395899_0000404
478 Ga0395899_0010991
479 Ga0395900_0000107
480 Ga0395898_0000078
481 Ga0395898_0000211
482 Ga0395905_0029070
483 Ga0395905_0044723
484 Ga0395901_0146934
485 Ga0395901_0304485
486 Ga0436361_0882487
487 Ga0436361_0969151
488 Ga0451793_0466386
489 Ga0451800_0410668
490 Ga0439431_0001183
491 Ga0450890_004141
492 Ga0450898_029761
493 Ga0450908_002562
494 Ga0439459_0002812
495 Ga0451577_0027444
496 Ga0451577_0637187
497 Ga0466988_0066541
498 Ga0466969_0002513
499 Ga0466969_0234492
500 Ga0466989_0182326
501 Ga0466966_0016803
502 Ga0466966_0061311
503 Ga0466961_0000906
504 Ga0466961_0002884
505 Ga0466961_0022546
506 Ga0466961_0139611
507 Ga0466963_0149236
508 Ga0466964_0008393
509 Ga0453684_0665103
510 Ga0466968_0057910
511 Ga0466970_0005775
512 Ga0466970_0006092
513 Ga0466957_0062767
514 Ga0466959_0000110
515 Ga0466959_0029071
516 Ga0466959_0102986
517 Ga0451576_0820558
518 Ga0466958_0081242
519 Ga0466967_0011210
520 Ga0495594_0219075
521 Ga0495606_0070583
522 Ga0495610_0063981
523 Ga0495620_0010812
524 Ga0495632_0240399
525 Ga0495643_0174248
526 Ga0495625_0009603
527 Ga0495625_0018610
528 Ga0495686_0081747
529 Ga0496102_0114266
530 Ga0496117_0191253
531 Ga0496124_0024076
532 Ga0496125_0181577
533 Ga0496126_0122272
534 Ga0496126_0849715
535 Ga0501299_064850
536 Ga0501031_0494147
537 Ga0501032_0007967
538 Ga0501033_0595315
539 Ga0501034_0069897
540 Ga0501036_0149290
541 Ga0501036_0528173
542 Ga0501037_0025221
543 Ga0501037_0343737
544 Ga0501039_0148072
545 Ga0501040_0001956
546 Ga0501040_0217152
547 Ga0501041_0025885
548 Ga0501041_0026419
549 Ga0501042_0021837
550 Ga0501043_0000108
551 Ga0501043_0022379
552 Ga0501043_0048142
553 Ga0501043_0623449
554 Ga0501046_0000050
555 Ga0501046_0065029
556 Ga0501047_0000012
557 Ga0501048_0001920
558 Ga0501048_0033944
559 Ga0501048_0063971
560 Ga0501048_0437144
561 Ga0501068_0457041
562 Ga0501071_0080701
563 Ga0501071_0086219
564 Ga0501072_0003566
565 Ga0501072_0181691
566 Ga0501074_0051752
567 Ga0501075_0000204
568 Ga0501075_0047064
569 Ga0501076_0038593
570 Ga0501076_0069475
571 Ga0501077_0019438
572 Ga0501077_0154333
573 Ga0501077_0351021
574 Ga0501222_002144
575 Ga0501079_0003175
576 Ga0501079_0109360
577 Ga0501080_0025780
578 Ga0501081_0173510
579 Ga0501081_0197484
580 Ga0501035_0343415
581 Ga0501035_0434339
582 Ga0501035_0444388
583 Ga0501045_0002562
584 Ga0501045_0005119
585 Ga0501045_0214051
586 nmdc:mga03683_36049_c1
587 nmdc:mga0k408_27041_c1
588 nmdc:mga0k408_27087_c1
589 nmdc:mga0k408_483312_c1
590 nmdc:mga04h51_149383_c1
591 nmdc:mga05p37_693041_c2
592 nmdc:mga08y16_284465_c1
593 nmdc:mga08y16_481_c1
594 Ga0500595_026020
595 Ga0500658_0010715
596 Ga0500622_0018928
597 Ga0500587_001782
598 Ga0501084_0008089
599 Ga0590075_018267
600 Ga0501082_0007651
601 Ga0501082_0219953
602 Ga0466962_0002526
603 Ga0466962_0034403
604 Ga0466962_0196859
605 Ga0530510_0023561
606 2587757634
607 2643894210
608 2644476412
609 2687582457
610 2831869958
611 2886854429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

10

220

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dl3-assembly1.cif.gz_A crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9394 1 204
1dl3-assembly1.cif.gz_A crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9346 1 204
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9294 1 204
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9248 1 204
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.8916 1 204
ID Description Score Start End Superfamily
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9394 1 204 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9346 1 204 3.20.20.70
af_Q8LPI9_65_212_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9221 1 103 3.20.20.70
af_Q2FYR5_1_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8625 2 204 3.20.20.70
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8596 2 203 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3C1AM95-F1-model_v4 deleted 0.9789 1 102
AF-T1DD38-F1-model_v4 phosphoribosylanthranilate isomerase (EC 5.3.1.24) 0.9756 1 98 GO:0000162
GO:0004640
GO:0006568
AF-A0A352FYC5-F1-model_v4 deleted 0.9746 1 85
AF-A0A7R8WYD6-F1-model_v4 phosphoribosylanthranilate isomerase (EC 5.3.1.24) 0.9687 1 125 GO:0000162
GO:0004640
GO:0006568
AF-B9TJ98-F1-model_v4 phosphoribosylanthranilate isomerase (EC 5.3.1.24) 0.9683 1 102 GO:0000162
GO:0004640
GO:0006568

Map