F398239

General Info

Members Datasets Scaffolds Average Seq Length
305 227 610 272

Family's Representative Sequence

Representative Sequence 3300042002|Ga0439442_000237|Ga0439442_000237_2827_3765
Length 312
Sequence MIRITAPLARGYASHILQQQRGTDMNEHTEAMDADRALKQNHRAMWAQGDYPALASELLPELGAILVDASGIKPGQRVLDVAAGAGNAAIPAAMMGAEVVASDLTPEMFDDGRRLAADRGVELEWTEADAEALPFPDNDFDVVMSCLGVMFAPHHQDAADELVRVCKPGGTIGLLSWTPEGFIGRMFATMKPFSPAPPPGAQPPPLWGSEDHVRELFGDKITGIQARKQTLRITSFHRPEDFLHYFKSHYGPTISLYKFLGEDEEKVKALDMALTELAEAFSDAHGDSPSQMEWEYLLFTAKKVPIGGAPTA

Samples

Sample ID Description Type Environment
1 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
115 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
119 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
193 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 2501939600 Micromonospora sp. L5 Isolate Unclassified
197 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
198 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
199 2643221711 Terrabacter sp. Root85 Isolate Unclassified
200 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
201 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
202 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
203 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
204 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
205 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
206 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
207 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
208 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
209 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
210 2858868258 Micromonospora sp. MH33 Isolate Unclassified
211 2902582711 Micromonospora sp. AP08 Isolate Unclassified
212 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
213 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
214 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
215 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
216 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
217 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
218 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
219 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
220 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
221 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
222 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
223 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
224 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
225 649633069 Micromonospora sp. L5 Isolate Unclassified
226 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
227 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.18
Metatranscriptomes 0.33
Isolates 10.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.3
Nodule 0
Rhizoplane 11.48
Rhizosphere 77.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439442_000237 3300042002 Bacteria 13514
2 JGI24744J21845_10003987 3300002077 Bacteria 3046
3 Ga0065714_10092260 3300005288 Bacteria 1884
4 Ga0070676_10128074 3300005328 Bacteria 1602
5 Ga0068869_100202398 3300005334 Bacteria 1566
6 Ga0070682_100000023 3300005337 Bacteria 206016
7 Ga0070691_10010565 3300005341 Bacteria 4215
8 Ga0070668_100313682 3300005347 Bacteria 1318
9 Ga0070674_100048738 3300005356 Bacteria 2908
10 Ga0070659_100019605 3300005366 Bacteria 5129
11 Ga0070659_100467292 3300005366 Bacteria 1072
12 Ga0070714_100125145 3300005435 Bacteria 2291
13 Ga0070705_100096615 3300005440 Bacteria 1855
14 Ga0070678_100001272 3300005456 Bacteria 13364
15 Ga0070678_100049214 3300005456 Bacteria 3040
16 Ga0070662_100243922 3300005457 Bacteria 1442
17 Ga0070684_100258679 3300005535 Bacteria 1592
18 Ga0068853_100457602 3300005539 Bacteria 1201
19 Ga0070665_100009887 3300005548 Bacteria 9645
20 Ga0068855_100230571 3300005563 Bacteria 2074
21 Ga0070702_100003217 3300005615 Bacteria 7262
22 Ga0070702_100100933 3300005615 Bacteria 1770
23 Ga0068852_100124592 3300005616 Bacteria 2364
24 Ga0068859_100460020 3300005617 Bacteria 1368
25 Ga0068866_10009424 3300005718 Bacteria 4146
26 Ga0068866_10241417 3300005718 Bacteria 1100
27 Ga0068863_100442983 3300005841 Bacteria 1274
28 Ga0068858_100095849 3300005842 Bacteria 2764
29 Ga0068860_100063330 3300005843 Bacteria 3513
30 Ga0068860_100539703 3300005843 Bacteria 1167
31 Ga0070715_10074936 3300006163 Bacteria 1521
32 Ga0097621_100055828 3300006237 Bacteria 3226
33 Ga0075370_10058647 3300006353 Bacteria 2189
34 Ga0075370_10250991 3300006353 Bacteria 1049
35 Ga0068871_100141108 3300006358 Bacteria 2049
36 Ga0075430_100325195 3300006846 Bacteria 1271
37 Ga0068865_100275193 3300006881 Bacteria 1338
38 Ga0097620_100460021 3300006931 Bacteria 1368
39 Ga0111539_10032272 3300009094 Bacteria 6360
40 Ga0111539_10598164 3300009094 Bacteria 1284
41 Ga0105245_10034838 3300009098 Bacteria 4466
42 Ga0105245_10096317 3300009098 Bacteria 2731
43 Ga0105245_10311186 3300009098 Bacteria 1549
44 Ga0105243_10022543 3300009148 Bacteria 4787
45 Ga0105243_10067261 3300009148 Bacteria 2884
46 Ga0105241_10075860 3300009174 Bacteria 2620
47 Ga0105242_10079873 3300009176 Bacteria 2732
48 Ga0105242_10124882 3300009176 Bacteria 2214
49 Ga0105248_10007999 3300009177 Bacteria 11613
50 Ga0105248_10463061 3300009177 Bacteria 1429
51 Ga0105238_10645208 3300009551 Bacteria 1068
52 Ga0105249_10104292 3300009553 Bacteria 2672
53 Ga0099796_10031645 3300010159 Bacteria 1727
54 Ga0105239_10081478 3300010375 Bacteria 3562
55 Ga0105246_10073992 3300011119 Bacteria 2407
56 Ga0157371_10002779 3300013102 Bacteria 16418
57 Ga0157374_10000692 3300013296 Bacteria 29700
58 Ga0157374_10173982 3300013296 Bacteria 2101
59 Ga0157378_10014661 3300013297 Bacteria 6864
60 Ga0163162_10294713 3300013306 Bacteria 1754
61 Ga0163162_10509650 3300013306 Bacteria 1333
62 Ga0157372_10028613 3300013307 Bacteria 6084
63 Ga0157375_10014724 3300013308 Bacteria 6989
64 Ga0157375_10083862 3300013308 Bacteria 3233
65 Ga0157375_10160533 3300013308 Bacteria 2389
66 Ga0157375_10569179 3300013308 Bacteria 1294
67 Ga0163163_10150038 3300014325 Bacteria 2375
68 Ga0157377_10089803 3300014745 Bacteria 1812
69 Ga0157379_10008564 3300014968 Bacteria 8900
70 Ga0157376_10027645 3300014969 Bacteria 4499
71 Ga0206354_11454572 3300020081 Bacteria 2335
72 Ga0213875_10001699 3300021388 Bacteria 13862
73 Ga0207656_10168251 3300025321 Bacteria 1046
74 Ga0207642_10240965 3300025899 Bacteria 1021
75 Ga0207710_10143185 3300025900 Bacteria 1155
76 Ga0207688_10005697 3300025901 Bacteria 6773
77 Ga0207688_10074743 3300025901 Bacteria 1928
78 Ga0207647_10008992 3300025904 Bacteria 7117
79 Ga0207645_10238757 3300025907 Bacteria 1200
80 Ga0207654_10252384 3300025911 Bacteria 1183
81 Ga0207662_10216608 3300025918 Bacteria 1245
82 Ga0207687_10058840 3300025927 Bacteria 2705
83 Ga0207700_10000003 3300025928 Bacteria 500797
84 Ga0207664_10037913 3300025929 Bacteria 3734
85 Ga0207706_10140394 3300025933 Bacteria 2125
86 Ga0207686_10023969 3300025934 Bacteria 3529
87 Ga0207709_10046757 3300025935 Bacteria 2628
88 Ga0207669_10048226 3300025937 Bacteria 2529
89 Ga0207669_10249336 3300025937 Bacteria 1321
90 Ga0207704_10367422 3300025938 Bacteria 1125
91 Ga0207711_10055010 3300025941 Bacteria 3416
92 Ga0207689_10006813 3300025942 Bacteria 10049
93 Ga0207661_10155421 3300025944 Bacteria 1981
94 Ga0207651_10137556 3300025960 Bacteria 1881
95 Ga0207640_10133775 3300025981 Bacteria 1796
96 Ga0207703_10447164 3300026035 Bacteria 1206
97 Ga0207641_10091115 3300026088 Bacteria 2668
98 Ga0207675_100015806 3300026118 Bacteria 7039
99 Ga0207675_100062256 3300026118 Bacteria 3484
100 Ga0207683_10000291 3300026121 Bacteria 45113
101 Ga0207683_10026362 3300026121 Bacteria 5016
102 Ga0207698_10307268 3300026142 Bacteria 1479
103 Ga0268266_10025853 3300028379 Bacteria 4995
104 Ga0268266_10044638 3300028379 Bacteria 3789
105 Ga0268266_10299044 3300028379 Bacteria 1501
106 Ga0268265_10029923 3300028380 Bacteria 3917
107 Ga0268264_10110622 3300028381 Bacteria 2406
108 Ga0265327_10008675 3300031251 Bacteria 7525
109 Ga0307405_10047167 3300031731 Bacteria 2651
110 Ga0307405_10060899 3300031731 Bacteria 2383
111 Ga0307405_10184322 3300031731 Bacteria 1501
112 Ga0307405_10187328 3300031731 Bacteria 1491
113 Ga0307405_10389457 3300031731 Bacteria 1087
114 Ga0307413_10175663 3300031824 Bacteria 1521
115 Ga0307413_10312788 3300031824 Bacteria 1196
116 Ga0307410_10074193 3300031852 Bacteria 2368
117 Ga0307410_10157387 3300031852 Bacteria 1698
118 Ga0307410_10240501 3300031852 Bacteria 1402
119 Ga0307410_10289168 3300031852 Bacteria 1289
120 Ga0307406_10067139 3300031901 Bacteria 2337
121 Ga0307406_10074402 3300031901 Bacteria 2236
122 Ga0307406_10162943 3300031901 Bacteria 1605
123 Ga0307407_10023073 3300031903 Bacteria 3241
124 Ga0307407_10126681 3300031903 Bacteria 1627
125 Ga0307407_10153231 3300031903 Bacteria 1500
126 Ga0307407_10284269 3300031903 Bacteria 1147
127 Ga0307407_10374513 3300031903 Bacteria 1015
128 Ga0307412_10160690 3300031911 Bacteria 1668
129 Ga0307412_10379084 3300031911 Bacteria 1144
130 Ga0307409_100017279 3300031995 Bacteria 4802
131 Ga0307409_100313767 3300031995 Bacteria 1464
132 Ga0307416_100142008 3300032002 Bacteria 2184
133 Ga0307411_10011673 3300032005 Bacteria 4754
134 Ga0307415_100007259 3300032126 Bacteria 6050
135 Ga0373934_0003340 3300035086 Bacteria 5878
136 Ga0373923_0000243 3300035111 Bacteria 11610
137 Ga0373936_0002873 3300035113 Bacteria 6432
138 Ga0373953_0000017 3300035117 Bacteria 44109
139 Ga0373954_0005691 3300035118 Bacteria 5406
140 Ga0373956_0003164 3300035119 Bacteria 6652
141 Ga0373955_0004094 3300035172 Bacteria 6439
142 Ga0373924_0008050 3300035410 Bacteria 3816
143 Ga0373935_0071978 3300035692 Bacteria 2231
144 Ga0373933_0004762 3300035724 Bacteria 7416
145 Ga0373937_0009915 3300036401 Bacteria 8305
146 Ga0373925_0161460 3300037068 Bacteria 1765
147 Ga0436364_0346797 3300037853 Bacteria 1227
148 Ga0436364_0826140 3300037853 Bacteria 8214
149 Ga0436364_0858362 3300037853 Bacteria 86877
150 Ga0436365_0585192 3300039437 Bacteria 966
151 Ga0436362_0092809 3300039453 Bacteria 1280
152 Ga0439436_0025123 3300041404 Bacteria 1752
153 Ga0439439_0008466 3300041406 Bacteria 2431
154 Ga0439466_0006053 3300041411 Bacteria 4605
155 Ga0439465_0025007 3300041413 Bacteria 1883
156 Ga0451797_0951785 3300041453 Bacteria 1504
157 Ga0451853_3867169 3300041512 Bacteria 5823
158 Ga0439442_000754 3300042002 Bacteria 6765
159 Ga0439449_0011808 3300042007 Bacteria 3284
160 Ga0439457_001525 3300042014 Bacteria 6947
161 Ga0439462_0013693 3300042015 Bacteria 2080
162 Ga0439462_0041449 3300042015 Bacteria 1229
163 Ga0466972_0096422 3300044658 Bacteria 1401
164 Ga0466963_0008894 3300044694 Bacteria 6026
165 Ga0466970_0020400 3300044765 Bacteria 3443
166 Ga0466960_0008476 3300044901 Bacteria 4212
167 Ga0466967_0064722 3300045976 Bacteria 3252
168 Ga0466967_0160402 3300045976 Bacteria 2110
169 Ga0495592_0000326 3300046454 Bacteria 39616
170 Ga0495592_0059342 3300046454 Bacteria 2818
171 Ga0495651_0000247 3300046462 Bacteria 41943
172 Ga0495653_0008028 3300046463 Bacteria 8643
173 Ga0495605_0205973 3300046474 Bacteria 856
174 Ga0495664_0004057 3300046477 Bacteria 7981
175 Ga0495608_0000246 3300046511 Bacteria 39320
176 Ga0495618_0001721 3300046514 Bacteria 14527
177 Ga0495628_0002426 3300046516 Bacteria 16809
178 Ga0495628_0010367 3300046516 Bacteria 7923
179 Ga0495652_0017975 3300046529 Bacteria 6307
180 Ga0495640_0008671 3300046533 Bacteria 7969
181 Ga0495640_0063669 3300046533 Bacteria 2497
182 Ga0495586_0086866 3300046535 Bacteria 1724
183 Ga0495587_0001785 3300046536 Bacteria 14374
184 Ga0495645_0002347 3300046543 Bacteria 12843
185 Ga0495667_0006753 3300046559 Bacteria 7788
186 Ga0495656_0000227 3300046615 Bacteria 19910
187 Ga0495634_0166279 3300046642 Bacteria 1388
188 Ga0495635_0000471 3300046663 Bacteria 25519
189 Ga0495635_0144844 3300046663 Bacteria 1618
190 Ga0495588_0004737 3300046674 Bacteria 6016
191 Ga0495657_0006033 3300046675 Bacteria 9516
192 Ga0495599_0005285 3300046678 Bacteria 7706
193 Ga0495599_0027814 3300046678 Bacteria 3543
194 Ga0495623_0008109 3300046679 Bacteria 6827
195 Ga0495646_0003695 3300046680 Bacteria 9552
196 Ga0495669_0000223 3300046684 Bacteria 33954
197 Ga0495613_0000027 3300046689 Bacteria 146674
198 Ga0495613_0503581 3300046689 Bacteria 815
199 Ga0495600_0002582 3300046809 Bacteria 10433
200 Ga0495600_0027077 3300046809 Bacteria 3704
201 Ga0495581_0028742 3300047315 Bacteria 3224
202 Ga0495604_0000058 3300047317 Bacteria 96955
203 Ga0495604_0031179 3300047317 Bacteria 4230
204 Ga0495674_0025571 3300047319 Bacteria 5411
205 Ga0495676_0197630 3300047321 Bacteria 1399
206 Ga0495680_0005645 3300047322 Bacteria 11723
207 Ga0495675_0015324 3300047444 Bacteria 4849
208 Ga0495684_0000406 3300047471 Bacteria 35191
209 Ga0495602_0000331 3300048088 Bacteria 43719
210 Ga0495602_0012777 3300048088 Bacteria 8609
211 Ga0496100_0000024 3300048903 Bacteria 116138
212 Ga0496101_0000072 3300048904 Bacteria 116138
213 Ga0496101_0039263 3300048904 Bacteria 3366
214 Ga0496101_0053995 3300048904 Bacteria 2900
215 Ga0496102_0125565 3300048905 Bacteria 2398
216 Ga0496102_0175150 3300048905 Bacteria 2020
217 Ga0496102_0213397 3300048905 Bacteria 1819
218 Ga0496103_0080348 3300048906 Bacteria 2050
219 Ga0496103_0121732 3300048906 Bacteria 1662
220 Ga0496104_0000008 3300048907 Bacteria 516976
221 Ga0496104_0019618 3300048907 Bacteria 6189
222 Ga0496104_0070961 3300048907 Bacteria 3312
223 Ga0496104_0241060 3300048907 Bacteria 1720
224 Ga0496105_0000003 3300048908 Bacteria 713251
225 Ga0496105_0015207 3300048908 Bacteria 6129
226 Ga0496105_0076768 3300048908 Bacteria 2759
227 Ga0496106_0000040 3300048909 Bacteria 108754
228 Ga0496106_0004159 3300048909 Bacteria 10784
229 Ga0496106_0067432 3300048909 Bacteria 2728
230 Ga0496107_0000025 3300048910 Bacteria 116138
231 Ga0496107_0007102 3300048910 Bacteria 7716
232 Ga0496108_0004601 3300048911 Bacteria 11108
233 Ga0496108_0322638 3300048911 Bacteria 1346
234 Ga0496109_0021628 3300048912 Bacteria 5690
235 Ga0496110_0135230 3300048913 Bacteria 2227
236 Ga0496110_0359078 3300048913 Bacteria 1327
237 Ga0496111_0226894 3300048914 Bacteria 1387
238 Ga0496111_0230592 3300048914 Bacteria 1375
239 Ga0496112_0047535 3300048915 Bacteria 4210
240 Ga0496113_0015834 3300048916 Bacteria 5196
241 Ga0496113_0194598 3300048916 Bacteria 1610
242 Ga0496114_0072565 3300048917 Bacteria 2895
243 Ga0496114_0101560 3300048917 Bacteria 2456
244 Ga0496115_0066607 3300048918 Bacteria 2911
245 Ga0496124_0284348 3300048927 Bacteria 1204
246 Ga0496126_0035344 3300048929 Bacteria 4685
247 Ga0501031_0034900 3300049568 Bacteria 3282
248 Ga0501032_0065646 3300049569 Bacteria 2426
249 Ga0501033_0247310 3300049570 Bacteria 1265
250 Ga0501036_0112131 3300049572 Bacteria 2305
251 Ga0501036_0271401 3300049572 Bacteria 1420
252 Ga0501037_0153362 3300049573 Bacteria 1645
253 Ga0501037_0361618 3300049573 Bacteria 1000
254 Ga0501039_0113999 3300049575 Bacteria 2115
255 Ga0501042_0180428 3300049578 Bacteria 1523
256 Ga0501042_0266863 3300049578 Bacteria 1236
257 Ga0501070_0279311 3300049586 Bacteria 1363
258 Ga0501070_0500054 3300049586 Bacteria 977
259 Ga0501081_0297302 3300049743 Bacteria 1184
260 Ga0501044_0205208 3300049823 Bacteria 1928
261 Ga0501045_0371070 3300049824 Bacteria 1065
262 nmdc:mga0yw44_144787_c1 3300050492 Bacteria 1546
263 nmdc:mga07m45_112138_c1 3300050496 Bacteria 1571
264 nmdc:mga07m45_38840_c1 3300050496 Bacteria 2658
265 nmdc:mga0qj67_311364_c1 3300050509 Bacteria 1275
266 nmdc:mga0qj67_345826_c1 3300050509 Bacteria 1202
267 Ga0495601_0000017 3300053077 Bacteria 204209
268 Ga0495601_0069151 3300053077 Bacteria 2252
269 Ga0495595_0005075 3300053084 Bacteria 5319
270 Ga0500556_0000498 3300053104 Bacteria 27278
271 Ga0500593_000215 3300053117 Bacteria 23777
272 Ga0501084_0164729 3300054114 Bacteria 1871
273 Ga0501082_0390598 3300060353 Bacteria 1214
274 2501941433 2501939600 Bacteria 6907073
275 2547409762 2547132111 Bacteria 8013147
276 2644443314 2643221678 Bacteria 9540101
277 2644607439 2643221711 Bacteria 4865335
278 2676495717 2675903060 Bacteria 10051191
279 2738887373 2738541308 Bacteria 7020677
280 2739206286 2738543005 Bacteria 5278128
281 2808848727 2808606359 Bacteria 9866990
282 2808893915 2808606370 Bacteria 4942454
283 2812358049 2811994879 Bacteria 9313447
284 2819426413 2818991318 Bacteria 5266538
285 2835190375 2835188231 Bacteria 3476928
286 2839987985 2839986021 Bacteria 3685650
287 2856861092 2856858025 Bacteria 7255264
288 2858875362 2858868258 Bacteria 7683772
289 2902587991 2902582711 Bacteria 6187705
290 2902798193 2902792274 Bacteria 7270173
291 2902813851 2902810491 Bacteria 6794147
292 2905928512 2905926851 Bacteria 4423176
293 2919474017 2919468124 Bacteria 9133025
294 2929216940 2929212328 Bacteria 7708288
295 2945923464 2945920336 Bacteria 4501603
296 2946003526 2946003308 Bacteria 3857229
297 2946040812 2946037020 Bacteria 4900426
298 2946067793 2946064051 Bacteria 8957905
299 2946072630 2946072368 Bacteria 8999607
300 2954002055 2953998280 Bacteria 4812144
301 2974304362 2974302888 Bacteria 4369871
302 3006486576 3006486233 Bacteria 8157040
303 649811849 649633069 Bacteria 6962533
304 8003862734 8003856774 Bacteria 7675274
305 8054108077 8054107350 Bacteria 5022511
306 Ga0439442_000237
307 JGI24744J21845_10003987
308 Ga0065714_10092260
309 Ga0070676_10128074
310 Ga0068869_100202398
311 Ga0070682_100000023
312 Ga0070691_10010565
313 Ga0070668_100313682
314 Ga0070674_100048738
315 Ga0070659_100019605
316 Ga0070659_100467292
317 Ga0070714_100125145
318 Ga0070705_100096615
319 Ga0070678_100001272
320 Ga0070678_100049214
321 Ga0070662_100243922
322 Ga0070684_100258679
323 Ga0068853_100457602
324 Ga0070665_100009887
325 Ga0068855_100230571
326 Ga0070702_100003217
327 Ga0070702_100100933
328 Ga0068852_100124592
329 Ga0068859_100460020
330 Ga0068866_10009424
331 Ga0068866_10241417
332 Ga0068863_100442983
333 Ga0068858_100095849
334 Ga0068860_100063330
335 Ga0068860_100539703
336 Ga0070715_10074936
337 Ga0097621_100055828
338 Ga0075370_10058647
339 Ga0075370_10250991
340 Ga0068871_100141108
341 Ga0075430_100325195
342 Ga0068865_100275193
343 Ga0097620_100460021
344 Ga0111539_10032272
345 Ga0111539_10598164
346 Ga0105245_10034838
347 Ga0105245_10096317
348 Ga0105245_10311186
349 Ga0105243_10022543
350 Ga0105243_10067261
351 Ga0105241_10075860
352 Ga0105242_10079873
353 Ga0105242_10124882
354 Ga0105248_10007999
355 Ga0105248_10463061
356 Ga0105238_10645208
357 Ga0105249_10104292
358 Ga0099796_10031645
359 Ga0105239_10081478
360 Ga0105246_10073992
361 Ga0157371_10002779
362 Ga0157374_10000692
363 Ga0157374_10173982
364 Ga0157378_10014661
365 Ga0163162_10294713
366 Ga0163162_10509650
367 Ga0157372_10028613
368 Ga0157375_10014724
369 Ga0157375_10083862
370 Ga0157375_10160533
371 Ga0157375_10569179
372 Ga0163163_10150038
373 Ga0157377_10089803
374 Ga0157379_10008564
375 Ga0157376_10027645
376 Ga0206354_11454572
377 Ga0213875_10001699
378 Ga0207656_10168251
379 Ga0207642_10240965
380 Ga0207710_10143185
381 Ga0207688_10005697
382 Ga0207688_10074743
383 Ga0207647_10008992
384 Ga0207645_10238757
385 Ga0207654_10252384
386 Ga0207662_10216608
387 Ga0207687_10058840
388 Ga0207700_10000003
389 Ga0207664_10037913
390 Ga0207706_10140394
391 Ga0207686_10023969
392 Ga0207709_10046757
393 Ga0207669_10048226
394 Ga0207669_10249336
395 Ga0207704_10367422
396 Ga0207711_10055010
397 Ga0207689_10006813
398 Ga0207661_10155421
399 Ga0207651_10137556
400 Ga0207640_10133775
401 Ga0207703_10447164
402 Ga0207641_10091115
403 Ga0207675_100015806
404 Ga0207675_100062256
405 Ga0207683_10000291
406 Ga0207683_10026362
407 Ga0207698_10307268
408 Ga0268266_10025853
409 Ga0268266_10044638
410 Ga0268266_10299044
411 Ga0268265_10029923
412 Ga0268264_10110622
413 Ga0265327_10008675
414 Ga0307405_10047167
415 Ga0307405_10060899
416 Ga0307405_10184322
417 Ga0307405_10187328
418 Ga0307405_10389457
419 Ga0307413_10175663
420 Ga0307413_10312788
421 Ga0307410_10074193
422 Ga0307410_10157387
423 Ga0307410_10240501
424 Ga0307410_10289168
425 Ga0307406_10067139
426 Ga0307406_10074402
427 Ga0307406_10162943
428 Ga0307407_10023073
429 Ga0307407_10126681
430 Ga0307407_10153231
431 Ga0307407_10284269
432 Ga0307407_10374513
433 Ga0307412_10160690
434 Ga0307412_10379084
435 Ga0307409_100017279
436 Ga0307409_100313767
437 Ga0307416_100142008
438 Ga0307411_10011673
439 Ga0307415_100007259
440 Ga0373934_0003340
441 Ga0373923_0000243
442 Ga0373936_0002873
443 Ga0373953_0000017
444 Ga0373954_0005691
445 Ga0373956_0003164
446 Ga0373955_0004094
447 Ga0373924_0008050
448 Ga0373935_0071978
449 Ga0373933_0004762
450 Ga0373937_0009915
451 Ga0373925_0161460
452 Ga0436364_0346797
453 Ga0436364_0826140
454 Ga0436364_0858362
455 Ga0436365_0585192
456 Ga0436362_0092809
457 Ga0439436_0025123
458 Ga0439439_0008466
459 Ga0439466_0006053
460 Ga0439465_0025007
461 Ga0451797_0951785
462 Ga0451853_3867169
463 Ga0439442_000754
464 Ga0439449_0011808
465 Ga0439457_001525
466 Ga0439462_0013693
467 Ga0439462_0041449
468 Ga0466972_0096422
469 Ga0466963_0008894
470 Ga0466970_0020400
471 Ga0466960_0008476
472 Ga0466967_0064722
473 Ga0466967_0160402
474 Ga0495592_0000326
475 Ga0495592_0059342
476 Ga0495651_0000247
477 Ga0495653_0008028
478 Ga0495605_0205973
479 Ga0495664_0004057
480 Ga0495608_0000246
481 Ga0495618_0001721
482 Ga0495628_0002426
483 Ga0495628_0010367
484 Ga0495652_0017975
485 Ga0495640_0008671
486 Ga0495640_0063669
487 Ga0495586_0086866
488 Ga0495587_0001785
489 Ga0495645_0002347
490 Ga0495667_0006753
491 Ga0495656_0000227
492 Ga0495634_0166279
493 Ga0495635_0000471
494 Ga0495635_0144844
495 Ga0495588_0004737
496 Ga0495657_0006033
497 Ga0495599_0005285
498 Ga0495599_0027814
499 Ga0495623_0008109
500 Ga0495646_0003695
501 Ga0495669_0000223
502 Ga0495613_0000027
503 Ga0495613_0503581
504 Ga0495600_0002582
505 Ga0495600_0027077
506 Ga0495581_0028742
507 Ga0495604_0000058
508 Ga0495604_0031179
509 Ga0495674_0025571
510 Ga0495676_0197630
511 Ga0495680_0005645
512 Ga0495675_0015324
513 Ga0495684_0000406
514 Ga0495602_0000331
515 Ga0495602_0012777
516 Ga0496100_0000024
517 Ga0496101_0000072
518 Ga0496101_0039263
519 Ga0496101_0053995
520 Ga0496102_0125565
521 Ga0496102_0175150
522 Ga0496102_0213397
523 Ga0496103_0080348
524 Ga0496103_0121732
525 Ga0496104_0000008
526 Ga0496104_0019618
527 Ga0496104_0070961
528 Ga0496104_0241060
529 Ga0496105_0000003
530 Ga0496105_0015207
531 Ga0496105_0076768
532 Ga0496106_0000040
533 Ga0496106_0004159
534 Ga0496106_0067432
535 Ga0496107_0000025
536 Ga0496107_0007102
537 Ga0496108_0004601
538 Ga0496108_0322638
539 Ga0496109_0021628
540 Ga0496110_0135230
541 Ga0496110_0359078
542 Ga0496111_0226894
543 Ga0496111_0230592
544 Ga0496112_0047535
545 Ga0496113_0015834
546 Ga0496113_0194598
547 Ga0496114_0072565
548 Ga0496114_0101560
549 Ga0496115_0066607
550 Ga0496124_0284348
551 Ga0496126_0035344
552 Ga0501031_0034900
553 Ga0501032_0065646
554 Ga0501033_0247310
555 Ga0501036_0112131
556 Ga0501036_0271401
557 Ga0501037_0153362
558 Ga0501037_0361618
559 Ga0501039_0113999
560 Ga0501042_0180428
561 Ga0501042_0266863
562 Ga0501070_0279311
563 Ga0501070_0500054
564 Ga0501081_0297302
565 Ga0501044_0205208
566 Ga0501045_0371070
567 nmdc:mga0yw44_144787_c1
568 nmdc:mga07m45_112138_c1
569 nmdc:mga07m45_38840_c1
570 nmdc:mga0qj67_311364_c1
571 nmdc:mga0qj67_345826_c1
572 Ga0495601_0000017
573 Ga0495601_0069151
574 Ga0495595_0005075
575 Ga0500556_0000498
576 Ga0500593_000215
577 Ga0501084_0164729
578 Ga0501082_0390598
579 2501941433
580 2547409762
581 2644443314
582 2644607439
583 2676495717
584 2738887373
585 2739206286
586 2808848727
587 2808893915
588 2812358049
589 2819426413
590 2835190375
591 2839987985
592 2856861092
593 2858875362
594 2902587991
595 2902798193
596 2902813851
597 2905928512
598 2919474017
599 2929216940
600 2945923464
601 2946003526
602 2946040812
603 2946067793
604 2946072630
605 2954002055
606 2974304362
607 3006486576
608 649811849
609 8003862734
610 8054108077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

79

174

0.98

PF13847

Methyltransf_31

Methyltransferase domain

72

182

0.94

PF13649

Methyltransf_25

Methyltransferase domain

78

170

0.93

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

62

183

0.91

PF08242

Methyltransf_12

Methyltransferase domain

79

172

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dlc-assembly1.cif.gz_A crystal structure of a putative s-adenosyl-l-methionine-dependent methyltransferase (mmp1179) from methanococcus maripaludis at 1.15 a resolution 0.8949 28 149
5bxy-assembly2.cif.gz_B crystal structure of rna methyltransferase from salinibacter ruber in complex with s-adenosyl-l-homocysteine 0.856 36 151
4hh4-assembly1.cif.gz_C structure of the ccbj methyltransferase from streptomyces caelestis 0.8477 39 154
5mpt-assembly1.cif.gz_A structure of the citrinin polyketide synthase cmet domain 0.8475 52 153
5fa8-assembly1.cif.gz_A sam complex with akmt from the hyperthermophilic archaeon sulfolobus islandicu 0.8474 36 150
ID Description Score Start End Superfamily
af_P9WLY7_8_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9872 9 275 3.40.50.150
af_P9WLY9_5_208_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9846 17 206 3.40.50.150
af_P9WLY7_8_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9799 9 275 3.40.50.150
af_A0A0N7KI91_1_189_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.927 40 149 3.40.50.150
af_Q4D3E1_216_398_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9185 35 84 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7G7MQX4-F1-model_v4 Class I SAM-dependent methyltransferase 0.9838 5 275 GO:0008168
GO:0032259
AF-A0A7G7MQX4-F1-model_v4 Class I SAM-dependent methyltransferase 0.9766 5 275 GO:0008168
GO:0032259
AF-A0A3P9KJD1-F1-model_v4 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial 0.9541 75 153 GO:0006744
GO:0008168
GO:0032259
AF-A0A7W0K1D5-F1-model_v4 Class I SAM-dependent methyltransferase 0.9441 40 153 GO:0008168
GO:0032259
AF-A0A1F8RDI3-F1-model_v4 Methyltransferase domain-containing protein 0.9324 44 155 GO:0008168
GO:0032259

Map