F398451

General Info

Members Datasets Scaffolds Average Seq Length
306 206 613 543

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1001427|Ga0055526_10014273
Length 586
Sequence MNTTASLSSPFLIPSSPRRRGSRVAKVLALLPWIPACAGMTMGLAAIPATAQPVATFSSFTYSGKDASDLLTAGPNDYRNPVLKGFYPDPSVTRVGDDFYLVNSTFSYFPGIPVFHSRDLVHWAQIGNAIDRPGQLDFKQLGLSRGVFAPSIQARDGIFYLLNTCVDCGDNFLLTAKNPAGPWSDPVWLPDLKGGIDPSMFFDDDGRTWVVNNGPPEGKPLYEGHRAIWIQEFDRKTLRTFGPRKVLVNGGIDLSKKPIWIEGPHIFRKDGWYYLSCAEGGTAEGHSQVILRSKSVTGPYEAWSGNPILTQRDLAADRPMPITSAGHAQLVTTPDGKWWATFLAVRPYAGDFYTTGRETFLLPVEWKDGWPVILPPATAIPWTHARPALPQGKAPIPTSGAFTLRDDFRGKLPAYWMMLRNPRDDWYRTGAAGLMLKARPVGLGDNANPSFLARRQQHTNAVAETMVQFAPEKEGDRAGLVVLQNDDYWFFVGRKRVNGKDVITVDQREGPDSPRLGKTLFTAAAPAGTVRLRIAVQGRSYAFSYAAPGARPAWKPLGKIDTDSLTTKVAGGFVGSVFGLFAGAGE

Samples

Sample ID Description Type Environment
1 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
35 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
40 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
41 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
68 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
69 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
99 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
100 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
101 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
102 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
103 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
160 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
168 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
169 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
172 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
173 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
177 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
178 2738541278 Niastella sp. CF465 Isolate Unclassified
179 2738541297 Duganella sp. GV083 Isolate Unclassified
180 2738541302 Pedobacter sp. CF074 Isolate Unclassified
181 2738541357 Duganella sp. GV053 Isolate Unclassified
182 2738543003 Duganella sp. GV066 Isolate Unclassified
183 2738543026 Duganella sp. GV089 Isolate Unclassified
184 2738543029 Duganella sp. GV039 Isolate Unclassified
185 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
186 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
187 2818991437 Pedobacter terrae 518 Isolate Unclassified
188 2821131069 Duganella sp. 1224 Isolate Unclassified
189 2842711865 Duganella sp. R-73148 Isolate Unclassified
190 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
191 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
192 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
193 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
194 2849560528 Caulobacter zeae 410 Isolate Unclassified
195 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
196 2851153111 Caulobacter radicis 736 Isolate Unclassified
197 2857558681 Duganella sp. R-74565 Isolate Unclassified
198 2857564685 Duganella sp. R-74599 Isolate Unclassified
199 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
200 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
201 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
202 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
203 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
204 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
205 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
206 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.2
Metatranscriptomes 0
Isolates 9.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.92
Nodule 0
Rhizoplane 0.65
Rhizosphere 64.71
Stem 0
Stem Tuber 0
Unclassified 2.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1001427 3300003771 Bacteria 17011
2 ARcpr5oldR_c001230 3300000041 Bacteria 2617
3 JGI25150J39212_1000582 3300002774 Bacteria 14421
4 JGI25153J46596_10000260 3300003215 Bacteria 42298
5 JGI25153J46596_10012909 3300003215 Bacteria 3567
6 rootH1_10020653 3300003316 Bacteria 20480
7 rootH2_10021495 3300003320 Bacteria 59568
8 rootL2_10000935 3300003322 Bacteria 11758
9 rootL2_10003822 3300003322 Bacteria 68632
10 rootL2_10012685 3300003322 Bacteria 5262
11 rootH1_10000877 3300003316 Bacteria 19081
12 rootH1_10000877 3300003323 Bacteria 40245
13 rootH1_10009812 3300003323 Unclassified 3243
14 rootH1_10011789 3300003323 Bacteria 124621
15 rootH1_10035305 3300003323 Bacteria 13858
16 rootH1_10059214 3300003323 Bacteria 6013
17 Ga0055529_1000341 3300003763 Bacteria 52197
18 Ga0055526_1000029 3300003771 Bacteria 148855
19 Ga0055537_1000161 3300003773 Bacteria 50226
20 Ga0055524_1000110 3300003775 Bacteria 99255
21 Ga0055530_10000074 3300003791 Bacteria 85116
22 Ga0055530_10008826 3300003791 Bacteria 3972
23 Ga0055540_1005064 3300003792 Bacteria 5700
24 Ga0055540_1009090 3300003792 Bacteria 3483
25 Ga0055531_10000374 3300003794 Bacteria 43198
26 Ga0055531_10001873 3300003794 Bacteria 14758
27 Ga0055531_10002640 3300003794 Bacteria 11857
28 Ga0065165_1000459 3300005262 Bacteria 63870
29 Ga0065165_1001172 3300005262 Bacteria 30464
30 Ga0065165_1001720 3300005262 Bacteria 21926
31 Ga0065165_1012896 3300005262 Bacteria 3363
32 Ga0065714_10064423 3300005288 Bacteria 257266
33 Ga0070682_100030897 3300005337 Bacteria 3237
34 Ga0070660_100006806 3300005339 Bacteria 7933
35 Ga0070661_100000006 3300005344 Bacteria 216544
36 Ga0070667_100059957 3300005367 Bacteria 3220
37 Ga0070711_100062324 3300005439 Unclassified 2599
38 Ga0070685_10012217 3300005466 Bacteria 4507
39 Ga0070679_100005952 3300005530 Bacteria 11338
40 Ga0068856_100002115 3300005614 Bacteria 20611
41 Ga0070717_10000103 3300006028 Bacteria 66530
42 Ga0097621_100082850 3300006237 Bacteria 2672
43 Ga0105237_10000059 3300009545 Bacteria 146569
44 Ga0105238_10001661 3300009551 Bacteria 22342
45 Ga0157371_10000076 3300013102 Bacteria 161805
46 Ga0157370_10001645 3300013104 Bacteria 27598
47 Ga0157370_10092596 3300013104 Bacteria 2837
48 Ga0157370_10130391 3300013104 Bacteria 2345
49 Ga0157369_10000015 3300013105 Bacteria 262917
50 Ga0157374_10026791 3300013296 Bacteria 5191
51 Ga0163163_10039308 3300014325 Bacteria 4617
52 Ga0182006_1000088 3300015261 Bacteria 114232
53 Ga0182006_1000388 3300015261 Bacteria 36326
54 Ga0182007_10000010 3300015262 Bacteria 286070
55 Ga0163161_10000878 3300017792 Bacteria 23391
56 Ga0213873_10000006 3300021358 Bacteria 408723
57 Ga0213876_10000004 3300021384 Bacteria 943822
58 Ga0207425_1000072 3300025245 Bacteria 115017
59 Ga0207425_1000211 3300025245 Bacteria 46314
60 Ga0209129_1002536 3300025258 Bacteria 8864
61 Ga0209565_1000030 3300025263 Bacteria 325058
62 Ga0209565_1000132 3300025263 Bacteria 104716
63 Ga0209455_1000037 3300025272 Bacteria 464097
64 Ga0209673_1000925 3300025273 Bacteria 37051
65 Ga0209676_1010696 3300025292 Bacteria 3784
66 Ga0209025_1000721 3300025294 Bacteria 56094
67 Ga0209564_1000009 3300025295 Bacteria 950196
68 Ga0209564_1000502 3300025295 Bacteria 64443
69 Ga0209564_1010068 3300025295 Bacteria 4407
70 Ga0209758_1000009 3300025297 Bacteria 1123483
71 Ga0209758_1000215 3300025297 Bacteria 125461
72 Ga0209758_1001186 3300025297 Bacteria 32950
73 Ga0209758_1007196 3300025297 Bacteria 7664
74 Ga0209050_1000005 3300025298 Bacteria 1557793
75 Ga0209050_1000039 3300025298 Bacteria 410069
76 Ga0209050_1000049 3300025298 Bacteria 364096
77 Ga0209050_1003793 3300025298 Bacteria 10798
78 Ga0209050_1004719 3300025298 Bacteria 9028
79 Ga0209050_1024795 3300025298 Bacteria 2061
80 Ga0209256_1000046 3300025299 Bacteria 325040
81 Ga0207426_1009796 3300025302 Bacteria 3761
82 Ga0209051_1000377 3300025303 Bacteria 63522
83 Ga0209257_1000051 3300025304 Bacteria 434166
84 Ga0209257_1001706 3300025304 Bacteria 24648
85 Ga0209257_1001841 3300025304 Bacteria 23124
86 Ga0209257_1001876 3300025304 Bacteria 22762
87 Ga0209257_1002030 3300025304 Bacteria 21596
88 Ga0209257_1002036 3300025304 Bacteria 21541
89 Ga0209257_1015748 3300025304 Bacteria 3116
90 Ga0207707_10031698 3300025912 Bacteria 4626
91 Ga0207671_10000064 3300025914 Bacteria 169693
92 Ga0207657_10013554 3300025919 Bacteria 7996
93 Ga0207649_10000058 3300025920 Bacteria 100911
94 Ga0207694_10009544 3300025924 Bacteria 7319
95 Ga0207665_10074913 3300025939 Bacteria 2317
96 Ga0207661_10007163 3300025944 Bacteria 7923
97 Ga0207702_10000731 3300026078 Bacteria 35138
98 Ga0207674_10114407 3300026116 Bacteria 2670
99 Ga0265326_10012280 3300028558 Bacteria 2520
100 Ga0265334_10010789 3300028573 Bacteria 3856
101 Ga0265323_10000448 3300028653 Bacteria 23600
102 Ga0265323_10004166 3300028653 Bacteria 6263
103 Ga0265323_10029628 3300028653 Unclassified 2046
104 Ga0307515_10037816 3300028794 Bacteria 7743
105 Ga0265338_10001667 3300028800 Bacteria 35359
106 Ga0265338_10019425 3300028800 Bacteria 7211
107 Ga0307511_10001468 3300030521 Bacteria 24941
108 Ga0265330_10000707 3300031235 Bacteria 21114
109 Ga0265330_10007580 3300031235 Bacteria 5276
110 Ga0265330_10008054 3300031235 Bacteria 5098
111 Ga0265330_10017471 3300031235 Bacteria 3302
112 Ga0265330_10023041 3300031235 Bacteria 2830
113 Ga0265332_10025239 3300031238 Unclassified 2611
114 Ga0265329_10000088 3300031242 Bacteria 42313
115 Ga0265329_10000106 3300031242 Bacteria 39414
116 Ga0265331_10025960 3300031250 Unclassified 2952
117 Ga0265316_10000160 3300031344 Bacteria 75479
118 Ga0265316_10000175 3300031344 Bacteria 72559
119 Ga0265316_10000603 3300031344 Bacteria 40127
120 Ga0265316_10001195 3300031344 Bacteria 28082
121 Ga0265316_10010446 3300031344 Bacteria 8458
122 Ga0265316_10015342 3300031344 Bacteria 6702
123 Ga0307408_100123964 3300031548 Unclassified 2006
124 Ga0307508_10000027 3300031616 Bacteria 171013
125 Ga0265314_10014809 3300031711 Bacteria 6218
126 Ga0265314_10021892 3300031711 Unclassified 4903
127 Ga0265342_10001516 3300031712 Bacteria 21504
128 Ga0265342_10001752 3300031712 Bacteria 19811
129 Ga0265342_10032822 3300031712 Unclassified 3199
130 Ga0316578_10053443 3300031728 Bacteria 2367
131 Ga0307405_10000013 3300031731 Bacteria 227563
132 Ga0316577_10013778 3300031733 Bacteria 4430
133 Ga0307413_10002767 3300031824 Bacteria 7222
134 Ga0307407_10000024 3300031903 Bacteria 113716
135 Ga0307409_100075640 3300031995 Bacteria 2697
136 Ga0307416_100000037 3300032002 Bacteria 137513
137 Ga0307414_10001797 3300032004 Bacteria 11109
138 Ga0307414_10008467 3300032004 Bacteria 5833
139 Ga0307415_100000511 3300032126 Bacteria 16878
140 Ga0307415_100019408 3300032126 Bacteria 4127
141 Ga0373939_0006545 3300035114 Bacteria 2809
142 Ga0373954_0007247 3300035118 Bacteria 4846
143 Ga0373937_0000835 3300036401 Bacteria 26380
144 Ga0316584_0000058 3300036712 Bacteria 42692
145 Ga0373925_0160832 3300037068 Bacteria 1769
146 Ga0395900_0011733 3300037418 Bacteria 8959
147 Ga0395905_0030653 3300037471 Bacteria 5065
148 Ga0395901_0001184 3300038443 Bacteria 27748
149 Ga0436365_0862833 3300039437 Bacteria 88455
150 Ga0436362_0554113 3300039453 Bacteria 162652
151 Ga0439461_0000015 3300041410 Bacteria 22241
152 Ga0439465_0001953 3300041413 Bacteria 6759
153 Ga0439431_0000089 3300041997 Bacteria 14969
154 Ga0439442_002415 3300042002 Bacteria 3667
155 Ga0439445_0001126 3300042004 Bacteria 5721
156 Ga0439445_0003080 3300042004 Bacteria 3734
157 Ga0439432_001016 3300042006 Bacteria 10605
158 Ga0439462_0000140 3300042015 Bacteria 11659
159 Ga0439434_0000049 3300042435 Bacteria 29298
160 Ga0439434_0009946 3300042435 Bacteria 2800
161 Ga0451577_0003868 3300042876 Bacteria 16253
162 Ga0466966_0037366 3300044684 Bacteria 3132
163 Ga0453684_0000001 3300044712 Bacteria 2623166
164 Ga0453684_0022350 3300044712 Bacteria 9387
165 Ga0453684_0231704 3300044712 Bacteria 2132
166 Ga0451576_0000163 3300045051 Bacteria 170072
167 Ga0451576_0001835 3300045051 Bacteria 34480
168 Ga0466958_0002804 3300045836 Bacteria 8874
169 Ga0495617_000003 3300046452 Bacteria 541914
170 Ga0495617_003036 3300046452 Bacteria 6399
171 Ga0495590_0000014 3300046457 Bacteria 258314
172 Ga0495638_0000133 3300046460 Bacteria 119393
173 Ga0495638_0000633 3300046460 Bacteria 38772
174 Ga0495638_0030325 3300046460 Bacteria 3482
175 Ga0495638_0041552 3300046460 Bacteria 2908
176 Ga0495653_0000002 3300046463 Bacteria 507262
177 Ga0495650_0000072 3300046471 Bacteria 257886
178 Ga0495650_0000267 3300046471 Bacteria 100234
179 Ga0495650_0001047 3300046471 Bacteria 30813
180 Ga0495650_0009192 3300046471 Bacteria 5657
181 Ga0495605_0000068 3300046474 Bacteria 137743
182 Ga0495585_0002789 3300046492 Bacteria 12177
183 Ga0495607_0000360 3300046501 Bacteria 47044
184 Ga0495583_0000044 3300046506 Bacteria 226264
185 Ga0495606_0000001 3300046507 Bacteria 592123
186 Ga0495606_0000030 3300046507 Bacteria 249484
187 Ga0495606_0000476 3300046507 Bacteria 65896
188 Ga0495606_0000545 3300046507 Bacteria 60465
189 Ga0495606_0002860 3300046507 Bacteria 19101
190 Ga0495610_0000003 3300046512 Bacteria 1203910
191 Ga0495610_0000449 3300046512 Bacteria 42537
192 Ga0495610_0002355 3300046512 Bacteria 15969
193 Ga0495628_0122816 3300046516 Bacteria 1991
194 Ga0495637_0000937 3300046520 Bacteria 18653
195 Ga0495643_0000028 3300046522 Bacteria 262886
196 Ga0495648_0000006 3300046524 Bacteria 361208
197 Ga0495648_0002607 3300046524 Bacteria 16486
198 Ga0495648_0038419 3300046524 Bacteria 3061
199 Ga0495642_0001570 3300046528 Bacteria 10031
200 Ga0495654_0000037 3300046530 Bacteria 188218
201 Ga0495654_0007710 3300046530 Bacteria 5990
202 Ga0495609_0014880 3300046538 Bacteria 3650
203 Ga0495597_0000072 3300046542 Bacteria 87914
204 Ga0495622_0000136 3300046557 Bacteria 62960
205 Ga0495633_0000055 3300046558 Bacteria 151013
206 Ga0495633_0000509 3300046558 Bacteria 39153
207 Ga0495633_0005401 3300046558 Bacteria 7828
208 Ga0495668_0000452 3300046616 Bacteria 52507
209 Ga0495668_0000512 3300046616 Bacteria 48355
210 Ga0495668_0000527 3300046616 Bacteria 47676
211 Ga0495668_0002400 3300046616 Bacteria 15521
212 Ga0495625_0000220 3300046660 Bacteria 90406
213 Ga0495625_0000697 3300046660 Bacteria 47751
214 Ga0495625_0024433 3300046660 Bacteria 4599
215 Ga0495599_0011957 3300046678 Bacteria 5338
216 Ga0495670_0000003 3300046691 Bacteria 326779
217 Ga0495671_0000010 3300046692 Bacteria 368641
218 Ga0495649_0000239 3300046694 Bacteria 48404
219 Ga0495649_0007544 3300046694 Bacteria 6621
220 Ga0495674_0066298 3300047319 Bacteria 3133
221 Ga0495672_0000212 3300047320 Bacteria 83026
222 Ga0495672_0002330 3300047320 Bacteria 17608
223 Ga0495672_0002511 3300047320 Bacteria 16777
224 Ga0495683_0003693 3300047323 Bacteria 8866
225 Ga0495687_000885 3300047443 Bacteria 31640
226 Ga0495687_000887 3300047443 Bacteria 31523
227 Ga0495673_0000003 3300047469 Bacteria 1491337
228 Ga0495673_0000016 3300047469 Bacteria 580643
229 Ga0495673_0000035 3300047469 Bacteria 316861
230 Ga0495686_0001147 3300047472 Bacteria 31133
231 Ga0495686_0004957 3300047472 Bacteria 10710
232 Ga0496105_0021362 3300048908 Bacteria 5238
233 Ga0496115_0000657 3300048918 Bacteria 25751
234 Ga0496121_0013459 3300048924 Bacteria 8784
235 Ga0496123_0016555 3300048926 Bacteria 5978
236 Ga0496126_0004912 3300048929 Bacteria 15608
237 Ga0496126_0020109 3300048929 Bacteria 6553
238 Ga0495678_000029 3300049459 Bacteria 219803
239 Ga0501032_0000168 3300049569 Bacteria 53390
240 Ga0501032_0000579 3300049569 Bacteria 29600
241 Ga0501033_0002097 3300049570 Bacteria 17290
242 Ga0501034_0178756 3300049571 Bacteria 2087
243 Ga0501036_0001028 3300049572 Bacteria 21076
244 Ga0501036_0057758 3300049572 Bacteria 3287
245 Ga0501038_0000149 3300049574 Bacteria 59727
246 Ga0501039_0045251 3300049575 Bacteria 3400
247 Ga0501043_0005173 3300049579 Bacteria 10557
248 Ga0501043_0113805 3300049579 Bacteria 2124
249 Ga0501046_0004696 3300049580 Bacteria 12330
250 Ga0501046_0014303 3300049580 Bacteria 6701
251 Ga0501047_0028654 3300049581 Bacteria 5371
252 Ga0501047_0127647 3300049581 Bacteria 2423
253 Ga0501068_0025114 3300049584 Bacteria 3504
254 Ga0501073_0110052 3300049589 Bacteria 1911
255 Ga0501223_000911 3300049663 Bacteria 6991
256 Ga0501225_0002733 3300049705 Bacteria 5419
257 Ga0501080_0157673 3300049742 Bacteria 2096
258 Ga0501083_0122198 3300049744 Bacteria 1708
259 Ga0501035_0000140 3300049822 Bacteria 88070
260 Ga0501035_0000857 3300049822 Bacteria 32421
261 Ga0501035_0046857 3300049822 Bacteria 3886
262 Ga0501044_0000090 3300049823 Bacteria 112221
263 Ga0501044_0018021 3300049823 Bacteria 7571
264 nmdc:mga0k408_40546_c1 3300050493 Bacteria 2679
265 Ga0500643_003174 3300053087 Bacteria 8034
266 Ga0500566_0004718 3300053094 Bacteria 8118
267 Ga0500595_007458 3300053119 Bacteria 4539
268 Ga0500618_000297 3300053125 Bacteria 37721
269 Ga0500658_0000969 3300053134 Bacteria 11709
270 Ga0500658_0006541 3300053134 Bacteria 4320
271 Ga0500568_0017303 3300053139 Bacteria 3185
272 Ga0500586_000014 3300053145 Bacteria 37183
273 Ga0500604_0000021 3300053151 Bacteria 72909
274 Ga0500616_0000101 3300053153 Bacteria 172722
275 Ga0500622_0000870 3300053156 Bacteria 25713
276 Ga0500622_0002433 3300053156 Bacteria 13451
277 Ga0466962_0016398 3300061719 Bacteria 3573
278 2644128478 2643221622 Bacteria 4212502
279 2738729438 2738541278 Bacteria 9755573
280 2738829817 2738541297 Bacteria 6549566
281 2738855340 2738541302 Bacteria 5944758
282 2739153613 2738541357 Bacteria 6549408
283 2739195533 2738543003 Bacteria 6549560
284 2739322009 2738543026 Bacteria 6549408
285 2739340250 2738543029 Bacteria 6549249
286 2788434215 2786546940 Bacteria 6396474
287 2792460514 2791355048 Bacteria 5832535
288 2819546777 2818991437 Bacteria 5805520
289 2821131775 2821131069 Bacteria 6108407
290 2842715438 2842711865 Bacteria 7155354
291 2842723075 2842722452 Bacteria 6263924
292 2842914029 2842909656 Bacteria 6185908
293 2843744608 2843744320 Bacteria 5659202
294 2849286093 2849281842 Bacteria 6065644
295 2849565574 2849560528 Bacteria 5393480
296 2849575690 2849573788 Bacteria 5421256
297 2851153287 2851153111 Bacteria 5542585
298 2857559203 2857558681 Bacteria 6617694
299 2857567006 2857564685 Bacteria 6290584
300 2857627912 2857627736 Bacteria 5625397
301 2898331753 2898329390 Bacteria 5168154
302 2904446951 2904445276 Bacteria 5310396
303 2911142309 2911138879 Bacteria 5811561
304 2945999720 2945997725 Bacteria 6404843
305 2954016683 2954016120 Bacteria 6446024
306 2971408215 2971403814 Bacteria 7370929
307 2977233143 2977232053 Bacteria 5485925
308 Ga0055526_1001427
309 ARcpr5oldR_c001230
310 JGI25150J39212_1000582
311 JGI25153J46596_10000260
312 JGI25153J46596_10012909
313 rootH1_10020653
314 rootH2_10021495
315 rootL2_10000935
316 rootL2_10003822
317 rootL2_10012685
318 rootH1_10000877
319 rootH1_10009812
320 rootH1_10011789
321 rootH1_10035305
322 rootH1_10059214
323 Ga0055529_1000341
324 Ga0055526_1000029
325 Ga0055537_1000161
326 Ga0055524_1000110
327 Ga0055530_10000074
328 Ga0055530_10008826
329 Ga0055540_1005064
330 Ga0055540_1009090
331 Ga0055531_10000374
332 Ga0055531_10001873
333 Ga0055531_10002640
334 Ga0065165_1000459
335 Ga0065165_1001172
336 Ga0065165_1001720
337 Ga0065165_1012896
338 Ga0065714_10064423
339 Ga0070682_100030897
340 Ga0070660_100006806
341 Ga0070661_100000006
342 Ga0070667_100059957
343 Ga0070711_100062324
344 Ga0070685_10012217
345 Ga0070679_100005952
346 Ga0068856_100002115
347 Ga0070717_10000103
348 Ga0097621_100082850
349 Ga0105237_10000059
350 Ga0105238_10001661
351 Ga0157371_10000076
352 Ga0157370_10001645
353 Ga0157370_10092596
354 Ga0157370_10130391
355 Ga0157369_10000015
356 Ga0157374_10026791
357 Ga0163163_10039308
358 Ga0182006_1000088
359 Ga0182006_1000388
360 Ga0182007_10000010
361 Ga0163161_10000878
362 Ga0213873_10000006
363 Ga0213876_10000004
364 Ga0207425_1000072
365 Ga0207425_1000211
366 Ga0209129_1002536
367 Ga0209565_1000030
368 Ga0209565_1000132
369 Ga0209455_1000037
370 Ga0209673_1000925
371 Ga0209676_1010696
372 Ga0209025_1000721
373 Ga0209564_1000009
374 Ga0209564_1000502
375 Ga0209564_1010068
376 Ga0209758_1000009
377 Ga0209758_1000215
378 Ga0209758_1001186
379 Ga0209758_1007196
380 Ga0209050_1000005
381 Ga0209050_1000039
382 Ga0209050_1000049
383 Ga0209050_1003793
384 Ga0209050_1004719
385 Ga0209050_1024795
386 Ga0209256_1000046
387 Ga0207426_1009796
388 Ga0209051_1000377
389 Ga0209257_1000051
390 Ga0209257_1001706
391 Ga0209257_1001841
392 Ga0209257_1001876
393 Ga0209257_1002030
394 Ga0209257_1002036
395 Ga0209257_1015748
396 Ga0207707_10031698
397 Ga0207671_10000064
398 Ga0207657_10013554
399 Ga0207649_10000058
400 Ga0207694_10009544
401 Ga0207665_10074913
402 Ga0207661_10007163
403 Ga0207702_10000731
404 Ga0207674_10114407
405 Ga0265326_10012280
406 Ga0265334_10010789
407 Ga0265323_10000448
408 Ga0265323_10004166
409 Ga0265323_10029628
410 Ga0307515_10037816
411 Ga0265338_10001667
412 Ga0265338_10019425
413 Ga0307511_10001468
414 Ga0265330_10000707
415 Ga0265330_10007580
416 Ga0265330_10008054
417 Ga0265330_10017471
418 Ga0265330_10023041
419 Ga0265332_10025239
420 Ga0265329_10000088
421 Ga0265329_10000106
422 Ga0265331_10025960
423 Ga0265316_10000160
424 Ga0265316_10000175
425 Ga0265316_10000603
426 Ga0265316_10001195
427 Ga0265316_10010446
428 Ga0265316_10015342
429 Ga0307408_100123964
430 Ga0307508_10000027
431 Ga0265314_10014809
432 Ga0265314_10021892
433 Ga0265342_10001516
434 Ga0265342_10001752
435 Ga0265342_10032822
436 Ga0316578_10053443
437 Ga0307405_10000013
438 Ga0316577_10013778
439 Ga0307413_10002767
440 Ga0307407_10000024
441 Ga0307409_100075640
442 Ga0307416_100000037
443 Ga0307414_10001797
444 Ga0307414_10008467
445 Ga0307415_100000511
446 Ga0307415_100019408
447 Ga0373939_0006545
448 Ga0373954_0007247
449 Ga0373937_0000835
450 Ga0316584_0000058
451 Ga0373925_0160832
452 Ga0395900_0011733
453 Ga0395905_0030653
454 Ga0395901_0001184
455 Ga0436365_0862833
456 Ga0436362_0554113
457 Ga0439461_0000015
458 Ga0439465_0001953
459 Ga0439431_0000089
460 Ga0439442_002415
461 Ga0439445_0001126
462 Ga0439445_0003080
463 Ga0439432_001016
464 Ga0439462_0000140
465 Ga0439434_0000049
466 Ga0439434_0009946
467 Ga0451577_0003868
468 Ga0466966_0037366
469 Ga0453684_0000001
470 Ga0453684_0022350
471 Ga0453684_0231704
472 Ga0451576_0000163
473 Ga0451576_0001835
474 Ga0466958_0002804
475 Ga0495617_000003
476 Ga0495617_003036
477 Ga0495590_0000014
478 Ga0495638_0000133
479 Ga0495638_0000633
480 Ga0495638_0030325
481 Ga0495638_0041552
482 Ga0495653_0000002
483 Ga0495650_0000072
484 Ga0495650_0000267
485 Ga0495650_0001047
486 Ga0495650_0009192
487 Ga0495605_0000068
488 Ga0495585_0002789
489 Ga0495607_0000360
490 Ga0495583_0000044
491 Ga0495606_0000001
492 Ga0495606_0000030
493 Ga0495606_0000476
494 Ga0495606_0000545
495 Ga0495606_0002860
496 Ga0495610_0000003
497 Ga0495610_0000449
498 Ga0495610_0002355
499 Ga0495628_0122816
500 Ga0495637_0000937
501 Ga0495643_0000028
502 Ga0495648_0000006
503 Ga0495648_0002607
504 Ga0495648_0038419
505 Ga0495642_0001570
506 Ga0495654_0000037
507 Ga0495654_0007710
508 Ga0495609_0014880
509 Ga0495597_0000072
510 Ga0495622_0000136
511 Ga0495633_0000055
512 Ga0495633_0000509
513 Ga0495633_0005401
514 Ga0495668_0000452
515 Ga0495668_0000512
516 Ga0495668_0000527
517 Ga0495668_0002400
518 Ga0495625_0000220
519 Ga0495625_0000697
520 Ga0495625_0024433
521 Ga0495599_0011957
522 Ga0495670_0000003
523 Ga0495671_0000010
524 Ga0495649_0000239
525 Ga0495649_0007544
526 Ga0495674_0066298
527 Ga0495672_0000212
528 Ga0495672_0002330
529 Ga0495672_0002511
530 Ga0495683_0003693
531 Ga0495687_000885
532 Ga0495687_000887
533 Ga0495673_0000003
534 Ga0495673_0000016
535 Ga0495673_0000035
536 Ga0495686_0001147
537 Ga0495686_0004957
538 Ga0496105_0021362
539 Ga0496115_0000657
540 Ga0496121_0013459
541 Ga0496123_0016555
542 Ga0496126_0004912
543 Ga0496126_0020109
544 Ga0495678_000029
545 Ga0501032_0000168
546 Ga0501032_0000579
547 Ga0501033_0002097
548 Ga0501034_0178756
549 Ga0501036_0001028
550 Ga0501036_0057758
551 Ga0501038_0000149
552 Ga0501039_0045251
553 Ga0501043_0005173
554 Ga0501043_0113805
555 Ga0501046_0004696
556 Ga0501046_0014303
557 Ga0501047_0028654
558 Ga0501047_0127647
559 Ga0501068_0025114
560 Ga0501073_0110052
561 Ga0501223_000911
562 Ga0501225_0002733
563 Ga0501080_0157673
564 Ga0501083_0122198
565 Ga0501035_0000140
566 Ga0501035_0000857
567 Ga0501035_0046857
568 Ga0501044_0000090
569 Ga0501044_0018021
570 nmdc:mga0k408_40546_c1
571 Ga0500643_003174
572 Ga0500566_0004718
573 Ga0500595_007458
574 Ga0500618_000297
575 Ga0500658_0000969
576 Ga0500658_0006541
577 Ga0500568_0017303
578 Ga0500586_000014
579 Ga0500604_0000021
580 Ga0500616_0000101
581 Ga0500622_0000870
582 Ga0500622_0002433
583 Ga0466962_0016398
584 2644128478
585 2738729438
586 2738829817
587 2738855340
588 2739153613
589 2739195533
590 2739322009
591 2739340250
592 2788434215
593 2792460514
594 2819546777
595 2821131775
596 2842715438
597 2842723075
598 2842914029
599 2843744608
600 2849286093
601 2849565574
602 2849575690
603 2851153287
604 2857559203
605 2857567006
606 2857627912
607 2898331753
608 2904446951
609 2911142309
610 2945999720
611 2954016683
612 2971408215
613 2977233143

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

78

371

0.97

PF17851

GH43_C2

Beta xylosidase C-terminal Concanavalin A-like domain

405

585

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jvh-assembly5.cif.gz_E crystal structure of a gh43_12 retrieved from capybara gut metagenome 0.9349 20 565
5joz-assembly2.cif.gz_B bacteroides ovatus xyloglucan pul gh43b 0.9326 45 564
5z5d-assembly1.cif.gz_A crystal structure of a thermostable glycoside hydrolase family 43 {beta}-1,4-xylosidase from geobacillus thermoleovorans it-08 0.9318 45 564
7jvh-assembly5.cif.gz_E crystal structure of a gh43_12 retrieved from capybara gut metagenome 0.9312 20 565
7erl-assembly1.cif.gz_B gh43 domain of bifunctional endoxylanase and arabinofuranosidase of bi0569 0.9294 21 567
ID Description Score Start End Superfamily
5z5iA02 Mainly Beta;Sandwich;Jelly Rolls; 0.9326 375 564 2.60.120.200
5jozB01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9217 45 360 2.115.10.20
5z5fA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9188 45 361 2.115.10.20
5jozB02 Mainly Beta;Sandwich;Jelly Rolls; 0.9182 377 564 2.60.120.200
5z5fA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.913 45 361 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A3D2L378-F1-model_v4 Glycoside hydrolase 43 family protein 0.9936 39 428 GO:0004553
GO:0005975
AF-A0A3D0L6X6-F1-model_v4 Glycoside hydrolase 43 family protein 0.9933 46 157 GO:0004553
GO:0005975
AF-A0A060C751-F1-model_v4 Glyco_hydro_43 0.9855 166 314 GO:0004553
GO:0005975
AF-U2BG60-F1-model_v4 deleted 0.9849 46 155
AF-A0A4Q3X390-F1-model_v4 Glycoside hydrolase family 43 protein 0.9833 120 324 GO:0004553
GO:0005975

Map