F398485

General Info

Members Datasets Scaffolds Average Seq Length
306 211 612 224

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100046423|Ga0070682_1000464233
Length 256
Sequence MNGARKSTRPHRYCKMGPFSSRFRRETFPPLWSQSRMTTPILLAWSGGKDCLLALQRLQADPAWQVVGLLTTLNRNYQRVAMHGVHREVLLAQTAALGLPLVEVLLDWPGSNEAYEEAHARAIRHCAFGDLFLEDVRDYRVRQLGRENWRAVFPLWGEDTAALSRRFVGEGHRAVLCCVDTGQLDAGFCGRDYDAGLLDALPAGVDPCGEHGEFHTLSYAGPLFRHPLRLRRGESVLRDGRFQYTDFLLDEHAGRA

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
59 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
95 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
110 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
111 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
130 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
131 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
132 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
133 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
134 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
135 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
136 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
139 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
201 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
202 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
203 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
207 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
208 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
209 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
210 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
211 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.08
Metatranscriptomes 1.96
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.52
Nodule 0
Rhizoplane 4.58
Rhizosphere 80.72
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100046423 3300005337 Bacteria 2695
2 JGI25162J39368_1003185 3300002737 Bacteria 5112
3 JGI25157J39369_1000860 3300002741 Bacteria 14747
4 JGI25164J39214_1000666 3300002772 Bacteria 14014
5 JGI25165J46597_1001865 3300003214 Bacteria 8677
6 Ga0055531_10001525 3300003794 Bacteria 16964
7 JGI25405J52794_10014097 3300003911 Bacteria 1558
8 Ga0070666_10000018 3300005335 Bacteria 187218
9 Ga0070682_100001177 3300005337 Bacteria 14919
10 Ga0070682_100542506 3300005337 Bacteria 909
11 Ga0070660_100015354 3300005339 Bacteria 5527
12 Ga0070660_100036416 3300005339 Bacteria 3727
13 Ga0070660_100137148 3300005339 Bacteria 1961
14 Ga0070660_100170956 3300005339 Bacteria 1755
15 Ga0070692_10016178 3300005345 Bacteria 3544
16 Ga0070659_100009626 3300005366 Bacteria 7102
17 Ga0070659_100019817 3300005366 Bacteria 5105
18 Ga0070659_100411787 3300005366 Bacteria 1142
19 Ga0070667_100032024 3300005367 Bacteria 4384
20 Ga0070709_10059117 3300005434 Bacteria 2433
21 Ga0070714_100003062 3300005435 Bacteria 12403
22 Ga0070714_100012139 3300005435 Bacteria 6863
23 Ga0070714_100085598 3300005435 Bacteria 2753
24 Ga0070713_100008958 3300005436 Bacteria 7131
25 Ga0070710_10032219 3300005437 Bacteria 2838
26 Ga0070711_100193503 3300005439 Bacteria 1565
27 Ga0070694_100453854 3300005444 Bacteria 1012
28 Ga0070663_100082277 3300005455 Bacteria 2368
29 Ga0070663_100387920 3300005455 Bacteria 1139
30 Ga0070678_100117596 3300005456 Bacteria 2091
31 Ga0070662_100075947 3300005457 Bacteria 2489
32 Ga0070662_100161957 3300005457 Bacteria 1750
33 Ga0070681_10001351 3300005458 Bacteria 21429
34 Ga0070681_10011680 3300005458 Bacteria 8698
35 Ga0070681_10012180 3300005458 Bacteria 8529
36 Ga0070681_10030069 3300005458 Bacteria 5450
37 Ga0070679_100039017 3300005530 Bacteria 4721
38 Ga0068853_100143127 3300005539 Bacteria 2147
39 Ga0070686_100550046 3300005544 Bacteria 903
40 Ga0070695_100030884 3300005545 Bacteria 3337
41 Ga0070696_100001026 3300005546 Bacteria 18027
42 Ga0070696_100056484 3300005546 Bacteria 2738
43 Ga0070693_100137204 3300005547 Bacteria 1536
44 Ga0068857_100321602 3300005577 Bacteria 1429
45 Ga0068854_100003601 3300005578 Bacteria 9691
46 Ga0068854_100061134 3300005578 Bacteria 2727
47 Ga0068856_100000582 3300005614 Bacteria 39927
48 Ga0068858_100030289 3300005842 Bacteria 5025
49 Ga0068858_100048183 3300005842 Bacteria 3949
50 Ga0068860_100131093 3300005843 Bacteria 2406
51 Ga0081455_10000002 3300005937 Bacteria 460472
52 Ga0070712_100149691 3300006175 Bacteria 1791
53 Ga0070712_100351732 3300006175 Bacteria 1206
54 Ga0075367_10313655 3300006178 Bacteria 988
55 Ga0075435_100403206 3300007076 Bacteria 1176
56 Ga0105240_10046303 3300009093 Bacteria 5512
57 Ga0105240_10153191 3300009093 Bacteria 2744
58 Ga0105241_10035176 3300009174 Bacteria 3768
59 Ga0105241_10613653 3300009174 Bacteria 984
60 Ga0105237_10000675 3300009545 Bacteria 47159
61 Ga0105237_10104805 3300009545 Bacteria 2819
62 Ga0105238_10011992 3300009551 Bacteria 8731
63 Ga0105238_10139480 3300009551 Bacteria 2402
64 Ga0105238_10242673 3300009551 Bacteria 1779
65 Ga0157373_10011171 3300013100 Bacteria 6607
66 Ga0157373_10013418 3300013100 Bacteria 6010
67 Ga0157373_10175488 3300013100 Bacteria 1508
68 Ga0157371_10020571 3300013102 Bacteria 4856
69 Ga0157371_10091263 3300013102 Bacteria 2158
70 Ga0157370_10005510 3300013104 Bacteria 14184
71 Ga0157370_10020890 3300013104 Bacteria 6531
72 Ga0157370_10434714 3300013104 Bacteria 1207
73 Ga0157369_10017478 3300013105 Bacteria 8059
74 Ga0157369_10968677 3300013105 Bacteria 871
75 Ga0163162_10001986 3300013306 Bacteria 19222
76 Ga0157372_10070476 3300013307 Bacteria 3933
77 Ga0157372_10078548 3300013307 Bacteria 3729
78 Ga0157372_10187634 3300013307 Bacteria 2394
79 Ga0157372_10932971 3300013307 Bacteria 1006
80 Ga0157375_10004011 3300013308 Bacteria 12774
81 Ga0182008_10041423 3300014497 Bacteria 2297
82 Ga0182008_10065359 3300014497 Bacteria 1790
83 Ga0157376_10116460 3300014969 Unclassified 2361
84 Ga0182007_10020699 3300015262 Bacteria 2347
85 Ga0182007_10025723 3300015262 Bacteria 2047
86 Ga0183369_1007 3300015685 Bacteria 414878
87 Ga0163161_10055869 3300017792 Bacteria 2867
88 Ga0197907_10972301 3300020069 Bacteria 1451
89 Ga0206356_11478499 3300020070 Bacteria 5285
90 Ga0206354_11579420 3300020081 Bacteria 916
91 Ga0206353_11651424 3300020082 Bacteria 883
92 Ga0206353_11923352 3300020082 Bacteria 2583
93 Ga0228598_1002558 3300024227 Bacteria 3949
94 Ga0209674_102072 3300025226 Bacteria 4567
95 Ga0207427_100242 3300025231 Bacteria 43876
96 Ga0209437_100424 3300025233 Bacteria 37579
97 Ga0209646_1004407 3300025246 Bacteria 2570
98 Ga0209026_1000098 3300025250 Bacteria 161845
99 Ga0209026_1000274 3300025250 Bacteria 61312
100 Ga0209759_1008242 3300025256 Bacteria 3265
101 Ga0209233_1000667 3300025261 Bacteria 16571
102 Ga0209455_1000095 3300025272 Bacteria 217487
103 Ga0209257_1000613 3300025304 Bacteria 58070
104 Ga0207692_10027067 3300025898 Bacteria 2696
105 Ga0207680_10000002 3300025903 Bacteria 1018646
106 Ga0207647_10021560 3300025904 Bacteria 4300
107 Ga0207647_10049605 3300025904 Bacteria 2603
108 Ga0207705_10016407 3300025909 Bacteria 5310
109 Ga0207654_10096991 3300025911 Bacteria 1809
110 Ga0207654_10140154 3300025911 Bacteria 1541
111 Ga0207707_10003140 3300025912 Bacteria 14667
112 Ga0207707_10013804 3300025912 Bacteria 7045
113 Ga0207707_10089184 3300025912 Bacteria 2695
114 Ga0207707_10114280 3300025912 Bacteria 2359
115 Ga0207671_10001518 3300025914 Bacteria 26689
116 Ga0207693_10005281 3300025915 Bacteria 10797
117 Ga0207693_10057346 3300025915 Bacteria 3053
118 Ga0207693_10167475 3300025915 Bacteria 1730
119 Ga0207657_10057975 3300025919 Bacteria 3335
120 Ga0207657_10111058 3300025919 Bacteria 2264
121 Ga0207649_10254915 3300025920 Bacteria 1265
122 Ga0207652_10528315 3300025921 Bacteria 1061
123 Ga0207694_10079355 3300025924 Bacteria 2574
124 Ga0207694_10130122 3300025924 Bacteria 2017
125 Ga0207694_10272259 3300025924 Bacteria 1389
126 Ga0207687_10458450 3300025927 Bacteria 1058
127 Ga0207700_10058481 3300025928 Bacteria 2912
128 Ga0207700_10144494 3300025928 Bacteria 1959
129 Ga0207664_10001322 3300025929 Bacteria 16316
130 Ga0207664_10001329 3300025929 Bacteria 16293
131 Ga0207664_10152943 3300025929 Bacteria 1961
132 Ga0207690_10000747 3300025932 Bacteria 20984
133 Ga0207690_10002706 3300025932 Bacteria 10697
134 Ga0207690_10011239 3300025932 Bacteria 5346
135 Ga0207690_10012135 3300025932 Bacteria 5155
136 Ga0207706_10044623 3300025933 Bacteria 3929
137 Ga0207667_10111153 3300025949 Bacteria 2826
138 Ga0207640_10014885 3300025981 Bacteria 4488
139 Ga0207640_10584371 3300025981 Bacteria 943
140 Ga0207678_10003855 3300026067 Bacteria 13482
141 Ga0207678_10020281 3300026067 Bacteria 5833
142 Ga0207678_10111625 3300026067 Bacteria 2332
143 Ga0207678_10232214 3300026067 Bacteria 1579
144 Ga0207702_10000132 3300026078 Bacteria 88794
145 Ga0207702_10030356 3300026078 Bacteria 4504
146 Ga0207674_10251279 3300026116 Bacteria 1715
147 Ga0207683_10045994 3300026121 Bacteria 3818
148 Ga0268264_10122551 3300028381 Bacteria 2293
149 Ga0307517_10106765 3300028786 Bacteria 2163
150 Ga0265338_10007405 3300028800 Bacteria 13638
151 Ga0316178_1018064 3300030735 Unclassified 975
152 Ga0265760_10029915 3300031090 Bacteria 1603
153 Ga0265325_10003514 3300031241 Bacteria 10200
154 Ga0265325_10043772 3300031241 Bacteria 2334
155 Ga0265339_10000840 3300031249 Bacteria 23652
156 Ga0265331_10000683 3300031250 Bacteria 29096
157 Ga0265331_10069014 3300031250 Bacteria 1656
158 Ga0265327_10006545 3300031251 Bacteria 9268
159 Ga0265316_10095956 3300031344 Unclassified 2258
160 Ga0307513_10214592 3300031456 Bacteria 1752
161 Ga0265313_10001284 3300031595 Bacteria 23759
162 Ga0265314_10000280 3300031711 Bacteria 74157
163 Ga0265342_10006065 3300031712 Bacteria 9067
164 Ga0307412_10130575 3300031911 Bacteria 1824
165 Ga0307411_10876587 3300032005 Bacteria 796
166 Ga0307510_10005448 3300033180 Bacteria 15156
167 Ga0373926_0006289 3300035083 Bacteria 3941
168 Ga0373934_0047309 3300035086 Bacteria 1701
169 Ga0373940_0152636 3300035088 Bacteria 737
170 Ga0373939_0001436 3300035114 Bacteria 5768
171 Ga0373953_0017751 3300035117 Bacteria 2621
172 Ga0373954_0023778 3300035118 Bacteria 2790
173 Ga0373957_0002141 3300035120 Bacteria 5561
174 Ga0373957_0003303 3300035120 Bacteria 4752
175 Ga0373960_0076339 3300035121 Bacteria 1046
176 Ga0373946_0008610 3300035171 Bacteria 3744
177 Ga0373955_0004697 3300035172 Bacteria 6069
178 Ga0373924_0013167 3300035410 Bacteria 3104
179 Ga0373931_0053507 3300035691 Bacteria 2154
180 Ga0373935_0301510 3300035692 Bacteria 1132
181 Ga0373935_0514887 3300035692 Bacteria 870
182 Ga0373933_0003782 3300035724 Bacteria 8361
183 Ga0373937_0040611 3300036401 Bacteria 4240
184 Ga0395899_0003826 3300037312 Bacteria 11879
185 Ga0395900_0004191 3300037418 Bacteria 15313
186 Ga0395900_0418799 3300037418 Bacteria 1300
187 Ga0395900_0853110 3300037418 Bacteria 836
188 Ga0395898_0007440 3300037466 Bacteria 11622
189 Ga0395898_0068334 3300037466 Bacteria 3438
190 Ga0395898_0174857 3300037466 Bacteria 2052
191 Ga0395905_0025032 3300037471 Bacteria 5630
192 Ga0395905_0359159 3300037471 Unclassified 1349
193 Ga0436364_1542567 3300037853 Bacteria 898
194 Ga0395901_0001533 3300038443 Bacteria 23956
195 Ga0395901_0009999 3300038443 Bacteria 9614
196 Ga0395901_0015703 3300038443 Bacteria 7714
197 Ga0395901_0092671 3300038443 Bacteria 3162
198 Ga0395901_0206482 3300038443 Bacteria 2057
199 Ga0395901_0766941 3300038443 Bacteria 956
200 Ga0439436_0025742 3300041404 Bacteria 1727
201 Ga0451789_0349180 3300041443 Bacteria 894
202 Ga0451791_0842962 3300041451 Bacteria 4256
203 Ga0451791_1559139 3300041451 Bacteria 4670
204 Ga0451793_0235365 3300041452 Bacteria 1332
205 Ga0451797_0190356 3300041453 Bacteria 2245
206 Ga0451797_0426262 3300041453 Bacteria 2576
207 Ga0451795_0964377 3300041456 Bacteria 2865
208 Ga0451798_1102015 3300041458 Bacteria 1211
209 Ga0451802_0567867 3300041460 Bacteria 724
210 Ga0451807_1305026 3300041486 Bacteria 1176
211 Ga0451837_0400289 3300041494 Bacteria 1921
212 Ga0451841_0752102 3300041498 Bacteria 1424
213 Ga0451853_3423423 3300041512 Bacteria 785
214 Ga0466957_0102791 3300044842 Bacteria 1803
215 Ga0466967_0197277 3300045976 Bacteria 1905
216 Ga0466967_0391179 3300045976 Bacteria 1351
217 Ga0466967_0720987 3300045976 Bacteria 988
218 Ga0495592_0310178 3300046454 Bacteria 1023
219 Ga0495603_0322126 3300046455 Bacteria 887
220 Ga0495638_0025057 3300046460 Bacteria 3882
221 Ga0495651_0121001 3300046462 Bacteria 1923
222 Ga0495639_0049624 3300046475 Bacteria 1905
223 Ga0495662_0243172 3300046476 Bacteria 886
224 Ga0495664_0063548 3300046477 Bacteria 2200
225 Ga0495608_0031465 3300046511 Bacteria 3588
226 Ga0495618_0029096 3300046514 Bacteria 3445
227 Ga0495652_0235169 3300046529 Bacteria 1367
228 Ga0495665_0134747 3300046531 Bacteria 1292
229 Ga0495622_0119243 3300046557 Bacteria 1205
230 Ga0495667_0022402 3300046559 Bacteria 4255
231 Ga0495634_0219348 3300046642 Bacteria 1174
232 Ga0495588_0155649 3300046674 Bacteria 1208
233 Ga0495657_0037929 3300046675 Bacteria 3318
234 Ga0495647_0021210 3300046681 Bacteria 2337
235 Ga0495624_0074969 3300046690 Bacteria 2101
236 Ga0495600_0131291 3300046809 Bacteria 1628
237 Ga0495604_0555334 3300047317 Bacteria 740
238 Ga0495674_0021315 3300047319 Bacteria 5994
239 Ga0495676_0030084 3300047321 Bacteria 4615
240 Ga0495680_0062470 3300047322 Bacteria 2863
241 Ga0495593_0011526 3300047673 Bacteria 5075
242 Ga0495602_0030359 3300048088 Bacteria 5128
243 Ga0496101_0056241 3300048904 Bacteria 2844
244 Ga0496107_0016925 3300048910 Bacteria 5126
245 Ga0496115_0024993 3300048918 Bacteria 4647
246 Ga0496115_0045470 3300048918 Bacteria 3505
247 Ga0496122_0018231 3300048925 Bacteria 6500
248 Ga0496124_0134071 3300048927 Bacteria 1963
249 Ga0496126_0230341 3300048929 Bacteria 1552
250 Ga0501031_0317646 3300049568 Bacteria 1009
251 Ga0501032_0009136 3300049569 Bacteria 7193
252 Ga0501033_0002369 3300049570 Bacteria 16069
253 Ga0501034_0056650 3300049571 Bacteria 3943
254 Ga0501034_0380430 3300049571 Bacteria 1337
255 Ga0501034_0880016 3300049571 Bacteria 785
256 Ga0501036_0264737 3300049572 Bacteria 1440
257 Ga0501037_0026448 3300049573 Bacteria 4290
258 Ga0501037_0321065 3300049573 Bacteria 1072
259 Ga0501038_0226776 3300049574 Bacteria 1489
260 Ga0501038_0242850 3300049574 Bacteria 1429
261 Ga0501043_0009237 3300049579 Bacteria 7748
262 Ga0501043_0374146 3300049579 Bacteria 1079
263 Ga0501046_0005419 3300049580 Bacteria 11404
264 Ga0501047_0002764 3300049581 Bacteria 16669
265 Ga0501047_0076182 3300049581 Bacteria 3228
266 Ga0501047_0153690 3300049581 Bacteria 2176
267 Ga0501047_0276973 3300049581 Bacteria 1523
268 Ga0501048_0039689 3300049582 Bacteria 3376
269 Ga0501069_0194569 3300049585 Bacteria 1174
270 Ga0501070_0028387 3300049586 Bacteria 4693
271 Ga0501070_0470482 3300049586 Unclassified 1012
272 Ga0501072_0289879 3300049588 Unclassified 1301
273 Ga0501073_0103367 3300049589 Bacteria 1978
274 Ga0501075_0840072 3300049591 Bacteria 699
275 Ga0501035_0051960 3300049822 Bacteria 3667
276 Ga0501035_0129657 3300049822 Bacteria 2199
277 Ga0501035_0224892 3300049822 Bacteria 1601
278 Ga0501035_0480445 3300049822 Bacteria 1025
279 Ga0501044_0011731 3300049823 Bacteria 9492
280 Ga0501044_0015409 3300049823 Bacteria 8233
281 Ga0501044_0230479 3300049823 Bacteria 1800
282 Ga0501044_0747439 3300049823 Bacteria 860
283 Ga0501045_0568999 3300049824 Bacteria 840
284 nmdc:mga06z11_179413_c1 3300050494 Bacteria 1220
285 Ga0495601_0000315 3300053077 Bacteria 25650
286 Ga0495601_0003404 3300053077 Bacteria 9119
287 Ga0495612_0003638 3300053078 Bacteria 6390
288 Ga0495612_0012629 3300053078 Bacteria 3405
289 Ga0495595_0003187 3300053084 Bacteria 6507
290 Ga0500643_009693 3300053087 Bacteria 3657
291 Ga0500644_0032527 3300053088 Bacteria 1668
292 Ga0500644_0076165 3300053088 Bacteria 1222
293 Ga0500651_0035382 3300053093 Bacteria 3147
294 Ga0500566_0062443 3300053094 Bacteria 2106
295 Ga0500650_0184232 3300053098 Unclassified 956
296 Ga0500595_000001 3300053119 Bacteria 1088438
297 Ga0500652_002166 3300053131 Bacteria 5905
298 Ga0500616_0000001 3300053153 Bacteria 1986011
299 Ga0500616_0013625 3300053153 Bacteria 4712
300 Ga0500645_000374 3300053730 Bacteria 31484
301 2538834098 2537561836 Bacteria 3910579
302 2643829558 2643221562 Bacteria 4048635
303 2643895190 2643221577 Bacteria 3710843
304 2644477349 2643221685 Bacteria 3673288
305 2687584007 2687453130 Bacteria 4227172
306 2895397505 2895395659 Bacteria 3983269
307 Ga0070682_100046423
308 JGI25162J39368_1003185
309 JGI25157J39369_1000860
310 JGI25164J39214_1000666
311 JGI25165J46597_1001865
312 Ga0055531_10001525
313 JGI25405J52794_10014097
314 Ga0070666_10000018
315 Ga0070682_100001177
316 Ga0070682_100542506
317 Ga0070660_100015354
318 Ga0070660_100036416
319 Ga0070660_100137148
320 Ga0070660_100170956
321 Ga0070692_10016178
322 Ga0070659_100009626
323 Ga0070659_100019817
324 Ga0070659_100411787
325 Ga0070667_100032024
326 Ga0070709_10059117
327 Ga0070714_100003062
328 Ga0070714_100012139
329 Ga0070714_100085598
330 Ga0070713_100008958
331 Ga0070710_10032219
332 Ga0070711_100193503
333 Ga0070694_100453854
334 Ga0070663_100082277
335 Ga0070663_100387920
336 Ga0070678_100117596
337 Ga0070662_100075947
338 Ga0070662_100161957
339 Ga0070681_10001351
340 Ga0070681_10011680
341 Ga0070681_10012180
342 Ga0070681_10030069
343 Ga0070679_100039017
344 Ga0068853_100143127
345 Ga0070686_100550046
346 Ga0070695_100030884
347 Ga0070696_100001026
348 Ga0070696_100056484
349 Ga0070693_100137204
350 Ga0068857_100321602
351 Ga0068854_100003601
352 Ga0068854_100061134
353 Ga0068856_100000582
354 Ga0068858_100030289
355 Ga0068858_100048183
356 Ga0068860_100131093
357 Ga0081455_10000002
358 Ga0070712_100149691
359 Ga0070712_100351732
360 Ga0075367_10313655
361 Ga0075435_100403206
362 Ga0105240_10046303
363 Ga0105240_10153191
364 Ga0105241_10035176
365 Ga0105241_10613653
366 Ga0105237_10000675
367 Ga0105237_10104805
368 Ga0105238_10011992
369 Ga0105238_10139480
370 Ga0105238_10242673
371 Ga0157373_10011171
372 Ga0157373_10013418
373 Ga0157373_10175488
374 Ga0157371_10020571
375 Ga0157371_10091263
376 Ga0157370_10005510
377 Ga0157370_10020890
378 Ga0157370_10434714
379 Ga0157369_10017478
380 Ga0157369_10968677
381 Ga0163162_10001986
382 Ga0157372_10070476
383 Ga0157372_10078548
384 Ga0157372_10187634
385 Ga0157372_10932971
386 Ga0157375_10004011
387 Ga0182008_10041423
388 Ga0182008_10065359
389 Ga0157376_10116460
390 Ga0182007_10020699
391 Ga0182007_10025723
392 Ga0183369_1007
393 Ga0163161_10055869
394 Ga0197907_10972301
395 Ga0206356_11478499
396 Ga0206354_11579420
397 Ga0206353_11651424
398 Ga0206353_11923352
399 Ga0228598_1002558
400 Ga0209674_102072
401 Ga0207427_100242
402 Ga0209437_100424
403 Ga0209646_1004407
404 Ga0209026_1000098
405 Ga0209026_1000274
406 Ga0209759_1008242
407 Ga0209233_1000667
408 Ga0209455_1000095
409 Ga0209257_1000613
410 Ga0207692_10027067
411 Ga0207680_10000002
412 Ga0207647_10021560
413 Ga0207647_10049605
414 Ga0207705_10016407
415 Ga0207654_10096991
416 Ga0207654_10140154
417 Ga0207707_10003140
418 Ga0207707_10013804
419 Ga0207707_10089184
420 Ga0207707_10114280
421 Ga0207671_10001518
422 Ga0207693_10005281
423 Ga0207693_10057346
424 Ga0207693_10167475
425 Ga0207657_10057975
426 Ga0207657_10111058
427 Ga0207649_10254915
428 Ga0207652_10528315
429 Ga0207694_10079355
430 Ga0207694_10130122
431 Ga0207694_10272259
432 Ga0207687_10458450
433 Ga0207700_10058481
434 Ga0207700_10144494
435 Ga0207664_10001322
436 Ga0207664_10001329
437 Ga0207664_10152943
438 Ga0207690_10000747
439 Ga0207690_10002706
440 Ga0207690_10011239
441 Ga0207690_10012135
442 Ga0207706_10044623
443 Ga0207667_10111153
444 Ga0207640_10014885
445 Ga0207640_10584371
446 Ga0207678_10003855
447 Ga0207678_10020281
448 Ga0207678_10111625
449 Ga0207678_10232214
450 Ga0207702_10000132
451 Ga0207702_10030356
452 Ga0207674_10251279
453 Ga0207683_10045994
454 Ga0268264_10122551
455 Ga0307517_10106765
456 Ga0265338_10007405
457 Ga0316178_1018064
458 Ga0265760_10029915
459 Ga0265325_10003514
460 Ga0265325_10043772
461 Ga0265339_10000840
462 Ga0265331_10000683
463 Ga0265331_10069014
464 Ga0265327_10006545
465 Ga0265316_10095956
466 Ga0307513_10214592
467 Ga0265313_10001284
468 Ga0265314_10000280
469 Ga0265342_10006065
470 Ga0307412_10130575
471 Ga0307411_10876587
472 Ga0307510_10005448
473 Ga0373926_0006289
474 Ga0373934_0047309
475 Ga0373940_0152636
476 Ga0373939_0001436
477 Ga0373953_0017751
478 Ga0373954_0023778
479 Ga0373957_0002141
480 Ga0373957_0003303
481 Ga0373960_0076339
482 Ga0373946_0008610
483 Ga0373955_0004697
484 Ga0373924_0013167
485 Ga0373931_0053507
486 Ga0373935_0301510
487 Ga0373935_0514887
488 Ga0373933_0003782
489 Ga0373937_0040611
490 Ga0395899_0003826
491 Ga0395900_0004191
492 Ga0395900_0418799
493 Ga0395900_0853110
494 Ga0395898_0007440
495 Ga0395898_0068334
496 Ga0395898_0174857
497 Ga0395905_0025032
498 Ga0395905_0359159
499 Ga0436364_1542567
500 Ga0395901_0001533
501 Ga0395901_0009999
502 Ga0395901_0015703
503 Ga0395901_0092671
504 Ga0395901_0206482
505 Ga0395901_0766941
506 Ga0439436_0025742
507 Ga0451789_0349180
508 Ga0451791_0842962
509 Ga0451791_1559139
510 Ga0451793_0235365
511 Ga0451797_0190356
512 Ga0451797_0426262
513 Ga0451795_0964377
514 Ga0451798_1102015
515 Ga0451802_0567867
516 Ga0451807_1305026
517 Ga0451837_0400289
518 Ga0451841_0752102
519 Ga0451853_3423423
520 Ga0466957_0102791
521 Ga0466967_0197277
522 Ga0466967_0391179
523 Ga0466967_0720987
524 Ga0495592_0310178
525 Ga0495603_0322126
526 Ga0495638_0025057
527 Ga0495651_0121001
528 Ga0495639_0049624
529 Ga0495662_0243172
530 Ga0495664_0063548
531 Ga0495608_0031465
532 Ga0495618_0029096
533 Ga0495652_0235169
534 Ga0495665_0134747
535 Ga0495622_0119243
536 Ga0495667_0022402
537 Ga0495634_0219348
538 Ga0495588_0155649
539 Ga0495657_0037929
540 Ga0495647_0021210
541 Ga0495624_0074969
542 Ga0495600_0131291
543 Ga0495604_0555334
544 Ga0495674_0021315
545 Ga0495676_0030084
546 Ga0495680_0062470
547 Ga0495593_0011526
548 Ga0495602_0030359
549 Ga0496101_0056241
550 Ga0496107_0016925
551 Ga0496115_0024993
552 Ga0496115_0045470
553 Ga0496122_0018231
554 Ga0496124_0134071
555 Ga0496126_0230341
556 Ga0501031_0317646
557 Ga0501032_0009136
558 Ga0501033_0002369
559 Ga0501034_0056650
560 Ga0501034_0380430
561 Ga0501034_0880016
562 Ga0501036_0264737
563 Ga0501037_0026448
564 Ga0501037_0321065
565 Ga0501038_0226776
566 Ga0501038_0242850
567 Ga0501043_0009237
568 Ga0501043_0374146
569 Ga0501046_0005419
570 Ga0501047_0002764
571 Ga0501047_0076182
572 Ga0501047_0153690
573 Ga0501047_0276973
574 Ga0501048_0039689
575 Ga0501069_0194569
576 Ga0501070_0028387
577 Ga0501070_0470482
578 Ga0501072_0289879
579 Ga0501073_0103367
580 Ga0501075_0840072
581 Ga0501035_0051960
582 Ga0501035_0129657
583 Ga0501035_0224892
584 Ga0501035_0480445
585 Ga0501044_0011731
586 Ga0501044_0015409
587 Ga0501044_0230479
588 Ga0501044_0747439
589 Ga0501045_0568999
590 nmdc:mga06z11_179413_c1
591 Ga0495601_0000315
592 Ga0495601_0003404
593 Ga0495612_0003638
594 Ga0495612_0012629
595 Ga0495595_0003187
596 Ga0500643_009693
597 Ga0500644_0032527
598 Ga0500644_0076165
599 Ga0500651_0035382
600 Ga0500566_0062443
601 Ga0500650_0184232
602 Ga0500595_000001
603 Ga0500652_002166
604 Ga0500616_0000001
605 Ga0500616_0013625
606 Ga0500645_000374
607 2538834098
608 2643829558
609 2643895190
610 2644477349
611 2687584007
612 2895397505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01902

Diphthami_syn_2

Diphthamide synthase

38

246

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fz0-assembly1.cif.gz_B inosine-guanosine nucleoside hydrolase (ig-nh) 0.858 1 35
3rk1-assembly1.cif.gz_A 'x-ray crystal structure of the putative n-type atp pyrophosphatase (pf0828) in complex with atp from pyrococcus furiosus, northeast structural genomics consortium target pfr23 0.8227 3 207
8qnd-assembly1.cif.gz_B crystal structure of the ribonucleoside hydrolase c from lactobacillus reuteri 0.8163 1 38
8oic-assembly2.cif.gz_E trichomonas vaginalis riboside hydrolase (his-tagged) 0.8041 1 36
8oib-assembly1.cif.gz_B trichomonas vaginalis riboside hydrolase in complex with glycerol 0.8012 1 37
ID Description Score Start End Superfamily
af_Q9XWN7_2_332_3.90.245.10 Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like 0.8583 2 34 3.90.245.10
af_Q2G032_1_148_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8001 1 34 3.40.50.720
2d13D02 Alpha Beta;Alpha-Beta Complex;putative n-type atp pyrophosphatase, domain 2;putative n-type atp pyrophosphatase, domain 2 0.7674 117 208 3.90.1490.10
2d13C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7499 4 116 3.40.50.620
af_Q8I5J0_1_157_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7451 3 129 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A4Q3B9U0-F1-model_v4 Diphthamide synthase domain-containing protein 0.9941 1 71
AF-A0A359CM52-F1-model_v4 ATP-binding protein 0.992 125 206 GO:0005524
AF-A0A2V7FMB5-F1-model_v4 Diphthamide synthase domain-containing protein 0.9908 118 207
AF-A0A0A0ETP9-F1-model_v4 Diphthamide synthase domain-containing protein 0.9876 130 207
AF-A0A534AFB1-F1-model_v4 ATP-binding protein 0.9871 112 207 GO:0005524

Map