F398706

General Info

Members Datasets Scaffolds Average Seq Length
306 224 612 245

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10046298|Ga0207664_100462983
Length 258
Sequence MPAQRHWISKVAIARALVVALAFVLLELLCRTGVIGRVTMIPPSEMVAALFDILRTGQFNSDIAFTCVNTISATALAIAAGFALGAGLHALPRLRRVIDPLLSAYYAVPTFVLFYPLLIVVFGAGRTALVVIGAMFGIVAMIINTVLGLDHVPPAVGRTGHVLKLDGLRQLVLIRLPAAAPHLVSGIKLAVAYSVIGIVAGEFILATRGIGKRVAFAYDNFDNKTMYGLLLLLLIAVALVNGCLSAWEKQLHRRFGQR

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
170 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
210 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
211 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
212 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
213 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
214 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 2643221736 Bosea sp. Root483D1 Isolate Unclassified
219 2818991467 Bosea vestrisii 3192 Isolate Unclassified
220 2841760612 Bosea sp. Tri-49 Isolate Nodule
221 2844104063 Bosea sp. Tri-39 Isolate Nodule
222 2851182111 Bosea sp. Tri-44 Isolate Nodule
223 2851246043 Bosea sp. Tri-54 Isolate Nodule
224 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.15
Nodule 1.63
Rhizoplane 0.98
Rhizosphere 86.6
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10046298 3300025929 Bacteria 3413
2 JGI25159J45721_1006338 3300002987 Bacteria 3554
3 Ga0065165_1000229 3300005262 Bacteria 98699
4 Ga0065715_10305770 3300005293 Bacteria 1031
5 Ga0065715_10316452 3300005293 Bacteria 1000
6 Ga0070658_10024543 3300005327 Bacteria 4836
7 Ga0070658_10032181 3300005327 Bacteria 4217
8 Ga0070676_10077890 3300005328 Bacteria 2004
9 Ga0070670_100183358 3300005331 Bacteria 1817
10 Ga0070666_10034384 3300005335 Bacteria 3358
11 Ga0070680_100001887 3300005336 Bacteria 15378
12 Ga0070680_100138126 3300005336 Bacteria 2043
13 Ga0070680_100147308 3300005336 Unclassified 1976
14 Ga0070689_100184834 3300005340 Bacteria 1694
15 Ga0070689_100229193 3300005340 Bacteria 1526
16 Ga0070687_100061864 3300005343 Bacteria 1980
17 Ga0070687_100304305 3300005343 Bacteria 1013
18 Ga0070675_100240838 3300005354 Bacteria 1581
19 Ga0070675_100306057 3300005354 Bacteria 1401
20 Ga0070671_100074007 3300005355 Bacteria 2846
21 Ga0070673_100441449 3300005364 Bacteria 1169
22 Ga0070688_100060508 3300005365 Bacteria 2392
23 Ga0070659_100052566 3300005366 Unclassified 3205
24 Ga0070713_100126140 3300005436 Unclassified 2252
25 Ga0070701_10173393 3300005438 Bacteria 1257
26 Ga0070711_100076780 3300005439 Bacteria 2369
27 Ga0070705_100037208 3300005440 Bacteria 2743
28 Ga0070662_100222956 3300005457 Bacteria 1505
29 Ga0070681_10072303 3300005458 Bacteria 3412
30 Ga0070681_10326884 3300005458 Bacteria 1443
31 Ga0070685_10185710 3300005466 Bacteria 1341
32 Ga0070707_100566786 3300005468 Bacteria 1098
33 Ga0070698_100175772 3300005471 Bacteria 2081
34 Ga0070698_100763711 3300005471 Bacteria 910
35 Ga0070679_100005746 3300005530 Bacteria 11508
36 Ga0068853_100185351 3300005539 Bacteria 1889
37 Ga0068853_100722379 3300005539 Bacteria 951
38 Ga0070695_100012768 3300005545 Bacteria 5042
39 Ga0070665_100735383 3300005548 Bacteria 1000
40 Ga0068855_100015541 3300005563 Bacteria 9164
41 Ga0068855_100039698 3300005563 Bacteria 5587
42 Ga0068857_100120931 3300005577 Bacteria 2357
43 Ga0068856_100072059 3300005614 Bacteria 3421
44 Ga0068856_100373363 3300005614 Unclassified 1445
45 Ga0068852_100019271 3300005616 Bacteria 5395
46 Ga0068852_100104491 3300005616 Bacteria 2564
47 Ga0068864_100070957 3300005618 Bacteria 3032
48 Ga0068863_100100898 3300005841 Bacteria 2743
49 Ga0068862_100600066 3300005844 Bacteria 1057
50 Ga0081538_10029189 3300005981 Bacteria 3775
51 Ga0081539_10034076 3300005985 Bacteria 3088
52 Ga0070717_10242830 3300006028 Bacteria 1589
53 Ga0070717_10434143 3300006028 Bacteria 1182
54 Ga0075432_10030816 3300006058 Bacteria 1855
55 Ga0075362_10001180 3300006177 Bacteria 8185
56 Ga0075367_10007683 3300006178 Bacteria 5538
57 Ga0075369_10122500 3300006186 Bacteria 1178
58 Ga0075366_10001237 3300006195 Bacteria 12669
59 Ga0075366_10038855 3300006195 Bacteria 2811
60 Ga0075428_100148021 3300006844 Bacteria 2552
61 Ga0075434_100025900 3300006871 Bacteria 5741
62 Ga0075434_100339292 3300006871 Bacteria 1523
63 Ga0075436_100094037 3300006914 Bacteria 2085
64 Ga0105251_10074583 3300009011 Bacteria 1575
65 Ga0111539_10036258 3300009094 Bacteria 5965
66 Ga0111539_10233941 3300009094 Bacteria 2139
67 Ga0111539_10275051 3300009094 Bacteria 1960
68 Ga0105245_10570874 3300009098 Bacteria 1155
69 Ga0114129_10164372 3300009147 Bacteria 3030
70 Ga0105243_10261367 3300009148 Bacteria 1550
71 Ga0105248_10076366 3300009177 Bacteria 3766
72 Ga0105238_10096406 3300009551 Bacteria 2944
73 Ga0105249_10912614 3300009553 Bacteria 945
74 Ga0105246_10203689 3300011119 Bacteria 1540
75 Ga0157373_10078407 3300013100 Bacteria 2329
76 Ga0157371_10083441 3300013102 Bacteria 2263
77 Ga0157371_10185937 3300013102 Bacteria 1487
78 Ga0157370_10055398 3300013104 Bacteria 3778
79 Ga0157370_10187709 3300013104 Unclassified 1919
80 Ga0157369_10627700 3300013105 Bacteria 1108
81 Ga0163162_10330105 3300013306 Bacteria 1658
82 Ga0163162_10808002 3300013306 Bacteria 1055
83 Ga0157372_10197053 3300013307 Bacteria 2333
84 Ga0157380_10090841 3300014326 Bacteria 2520
85 Ga0157379_10556912 3300014968 Bacteria 1067
86 Ga0213871_10064393 3300021441 Bacteria 1026
87 Ga0209130_1000045 3300025284 Bacteria 240278
88 Ga0209025_1016636 3300025294 Bacteria 4317
89 Ga0209025_1064609 3300025294 Bacteria 1343
90 Ga0207426_1010082 3300025302 Bacteria 3693
91 Ga0207682_10000821 3300025893 Bacteria 14352
92 Ga0207710_10071666 3300025900 Bacteria 1590
93 Ga0207688_10014612 3300025901 Bacteria 4265
94 Ga0207688_10219241 3300025901 Bacteria 1145
95 Ga0207680_10312598 3300025903 Bacteria 1097
96 Ga0207645_10015201 3300025907 Bacteria 5124
97 Ga0207705_10004267 3300025909 Bacteria 10827
98 Ga0207705_10024644 3300025909 Bacteria 4293
99 Ga0207707_10086981 3300025912 Bacteria 2731
100 Ga0207707_10489654 3300025912 Bacteria 1050
101 Ga0207663_10132452 3300025916 Unclassified 1724
102 Ga0207660_10011533 3300025917 Bacteria 5759
103 Ga0207660_10119428 3300025917 Bacteria 1995
104 Ga0207662_10024536 3300025918 Bacteria 3469
105 Ga0207662_10385950 3300025918 Bacteria 947
106 Ga0207657_10229062 3300025919 Unclassified 1486
107 Ga0207652_10005554 3300025921 Bacteria 10221
108 Ga0207652_10719950 3300025921 Bacteria 890
109 Ga0207646_10141679 3300025922 Bacteria 2166
110 Ga0207694_10275017 3300025924 Bacteria 1382
111 Ga0207650_10208954 3300025925 Bacteria 1567
112 Ga0207650_10283597 3300025925 Bacteria 1349
113 Ga0207687_10151150 3300025927 Bacteria 1772
114 Ga0207700_10111143 3300025928 Unclassified 2205
115 Ga0207700_10282626 3300025928 Unclassified 1428
116 Ga0207644_10210070 3300025931 Bacteria 1539
117 Ga0207690_10188121 3300025932 Unclassified 1560
118 Ga0207669_10470777 3300025937 Bacteria 999
119 Ga0207691_10016641 3300025940 Bacteria 6983
120 Ga0207691_10205553 3300025940 Bacteria 1713
121 Ga0207689_10398487 3300025942 Bacteria 1147
122 Ga0207667_10002456 3300025949 Bacteria 23176
123 Ga0207667_10081395 3300025949 Bacteria 3354
124 Ga0207668_10260143 3300025972 Bacteria 1414
125 Ga0207678_10287857 3300026067 Bacteria 1411
126 Ga0207708_10229841 3300026075 Bacteria 1489
127 Ga0207702_10075969 3300026078 Bacteria 2903
128 Ga0207702_10320213 3300026078 Unclassified 1477
129 Ga0207648_10122467 3300026089 Bacteria 2287
130 Ga0207676_10123624 3300026095 Bacteria 2186
131 Ga0207674_10153474 3300026116 Bacteria 2259
132 Ga0207675_100211187 3300026118 Bacteria 1867
133 Ga0207675_100551450 3300026118 Bacteria 1152
134 Ga0207683_10022537 3300026121 Bacteria 5406
135 Ga0207698_10078135 3300026142 Bacteria 2656
136 Ga0207428_10077328 3300027907 Bacteria 2605
137 Ga0268264_10267827 3300028381 Bacteria 1595
138 Ga0265325_10008700 3300031241 Bacteria 5970
139 Ga0265339_10001774 3300031249 Bacteria 15875
140 Ga0265316_10087898 3300031344 Bacteria 2374
141 Ga0307408_100269183 3300031548 Bacteria 1414
142 Ga0265313_10005248 3300031595 Bacteria 9593
143 Ga0307410_10023949 3300031852 Bacteria 3807
144 Ga0307414_10034218 3300032004 Bacteria 3366
145 Ga0307411_10035047 3300032005 Bacteria 3129
146 Ga0307510_10061301 3300033180 Bacteria 3859
147 Ga0373954_0041799 3300035118 Bacteria 2138
148 Ga0373943_0128162 3300035170 Bacteria 1356
149 Ga0373924_0057131 3300035410 Bacteria 1627
150 Ga0373935_0063565 3300035692 Bacteria 2366
151 Ga0373927_0147745 3300035695 Bacteria 1539
152 Ga0373947_0114381 3300035725 Bacteria 1709
153 Ga0373947_0154270 3300035725 Bacteria 1481
154 Ga0373937_0188758 3300036401 Bacteria 1936
155 Ga0373925_0436438 3300037068 Bacteria 1071
156 Ga0395899_0006840 3300037312 Bacteria 8833
157 Ga0395899_0288058 3300037312 Bacteria 1115
158 Ga0395900_0001715 3300037418 Bacteria 25336
159 Ga0395898_0025971 3300037466 Bacteria 5898
160 Ga0395898_0026356 3300037466 Bacteria 5851
161 Ga0395905_0773437 3300037471 Bacteria 863
162 Ga0395901_0011685 3300038443 Bacteria 8897
163 Ga0395901_0018310 3300038443 Bacteria 7151
164 Ga0395901_0027824 3300038443 Bacteria 5814
165 Ga0237819_05741 3300038705 Bacteria 1922
166 Ga0436360_1088500 3300039438 Bacteria 1247
167 Ga0439453_0023547 3300041408 Bacteria 1124
168 Ga0451577_0053982 3300042876 Bacteria 3588
169 Ga0451577_0214926 3300042876 Bacteria 1737
170 Ga0466963_0202410 3300044694 Bacteria 1389
171 Ga0453684_0548376 3300044712 Bacteria 1274
172 Ga0453684_0742425 3300044712 Bacteria 1063
173 Ga0466957_0397964 3300044842 Bacteria 942
174 Ga0466957_0465350 3300044842 Bacteria 873
175 Ga0495617_007487 3300046452 Bacteria 3788
176 Ga0495590_0081782 3300046457 Bacteria 1138
177 Ga0495591_009879 3300046458 Bacteria 3751
178 Ga0495629_0296885 3300046459 Unclassified 1107
179 Ga0495638_0018079 3300046460 Bacteria 4688
180 Ga0495638_0019577 3300046460 Bacteria 4477
181 Ga0495653_0131431 3300046463 Bacteria 1771
182 Ga0495650_0000316 3300046471 Bacteria 86653
183 Ga0495650_0006039 3300046471 Bacteria 7652
184 Ga0495582_0028739 3300046473 Bacteria 3052
185 Ga0495605_0000079 3300046474 Bacteria 126756
186 Ga0495605_0035176 3300046474 Bacteria 2533
187 Ga0495584_0217310 3300046491 Bacteria 972
188 Ga0495585_0076329 3300046492 Bacteria 1820
189 Ga0495607_0000677 3300046501 Bacteria 32941
190 Ga0495607_0054940 3300046501 Bacteria 2292
191 Ga0495583_0000591 3300046506 Bacteria 49672
192 Ga0495583_0001018 3300046506 Bacteria 31946
193 Ga0495583_0001437 3300046506 Bacteria 24216
194 Ga0495583_0001702 3300046506 Bacteria 21192
195 Ga0495606_0000022 3300046507 Bacteria 265567
196 Ga0495610_0006127 3300046512 Bacteria 8383
197 Ga0495610_0015167 3300046512 Bacteria 4490
198 Ga0495616_0014258 3300046513 Bacteria 4457
199 Ga0495620_0030044 3300046515 Bacteria 2507
200 Ga0495620_0156792 3300046515 Unclassified 885
201 Ga0495632_0000651 3300046519 Bacteria 31902
202 Ga0495632_0075360 3300046519 Bacteria 1614
203 Ga0495637_0012666 3300046520 Bacteria 4026
204 Ga0495637_0039494 3300046520 Bacteria 2036
205 Ga0495643_0045590 3300046522 Bacteria 2379
206 Ga0495663_0107352 3300046525 Bacteria 925
207 Ga0495654_0012882 3300046530 Bacteria 4483
208 Ga0495598_0004211 3300046537 Bacteria 3104
209 Ga0495609_0000168 3300046538 Bacteria 68840
210 Ga0495609_0000692 3300046538 Bacteria 25981
211 Ga0495597_0069377 3300046542 Bacteria 1521
212 Ga0495622_0006296 3300046557 Bacteria 5512
213 Ga0495667_0055862 3300046559 Bacteria 2597
214 Ga0495625_0000004 3300046660 Bacteria 611314
215 Ga0495625_0056135 3300046660 Bacteria 2805
216 Ga0495659_0146435 3300046664 Bacteria 946
217 Ga0495661_0000006 3300046665 Bacteria 427288
218 Ga0495661_0000241 3300046665 Bacteria 63218
219 Ga0495661_0008380 3300046665 Bacteria 7154
220 Ga0495646_0227222 3300046680 Bacteria 1007
221 Ga0495646_0324684 3300046680 Unclassified 810
222 Ga0495670_0019266 3300046691 Bacteria 3362
223 Ga0495649_0008246 3300046694 Bacteria 6276
224 Ga0495660_0010455 3300046810 Bacteria 5398
225 Ga0495660_0139427 3300046810 Bacteria 1208
226 Ga0495672_0089047 3300047320 Bacteria 1700
227 Ga0495676_0000004 3300047321 Bacteria 313696
228 Ga0495679_000015 3300047446 Bacteria 287256
229 Ga0495685_091410 3300047447 Bacteria 1009
230 Ga0495673_0007288 3300047469 Bacteria 6384
231 Ga0495673_0092395 3300047469 Bacteria 1234
232 Ga0495681_0003055 3300047470 Bacteria 11750
233 Ga0495686_0076449 3300047472 Bacteria 2051
234 Ga0495602_0122941 3300048088 Unclassified 2085
235 Ga0495602_0555774 3300048088 Bacteria 795
236 Ga0495626_0000012 3300048091 Bacteria 258483
237 Ga0496105_0012003 3300048908 Bacteria 6860
238 Ga0496111_0435535 3300048914 Bacteria 968
239 Ga0496112_0214089 3300048915 Bacteria 1884
240 Ga0496126_0140544 3300048929 Bacteria 2079
241 Ga0495678_019718 3300049459 Bacteria 3000
242 Ga0501031_0047379 3300049568 Bacteria 2803
243 Ga0501034_0057229 3300049571 Bacteria 3920
244 Ga0501037_0105123 3300049573 Bacteria 2035
245 Ga0501038_0049358 3300049574 Bacteria 3639
246 Ga0501038_0542404 3300049574 Bacteria 885
247 Ga0501039_0008884 3300049575 Bacteria 7656
248 Ga0501039_0278588 3300049575 Bacteria 1315
249 Ga0501039_0541181 3300049575 Bacteria 914
250 Ga0501047_0015335 3300049581 Bacteria 7300
251 Ga0501047_0298199 3300049581 Bacteria 1455
252 Ga0501048_0485473 3300049582 Bacteria 886
253 Ga0501070_0089318 3300049586 Bacteria 2550
254 Ga0501072_0058147 3300049588 Bacteria 3048
255 Ga0501072_0180018 3300049588 Bacteria 1686
256 Ga0501075_0467344 3300049591 Bacteria 962
257 Ga0501079_0159569 3300049741 Bacteria 1758
258 Ga0501081_0093534 3300049743 Bacteria 2117
259 Ga0501081_0165634 3300049743 Unclassified 1594
260 Ga0501081_0181145 3300049743 Bacteria 1524
261 Ga0501083_0030354 3300049744 Bacteria 3714
262 Ga0501083_0069976 3300049744 Bacteria 2335
263 Ga0501083_0070219 3300049744 Bacteria 2330
264 Ga0501044_0432487 3300049823 Unclassified 1225
265 Ga0501045_0335645 3300049824 Bacteria 1125
266 nmdc:mga03683_11573_c1 3300050489 Bacteria 3196
267 nmdc:mga03683_178336_c1 3300050489 Bacteria 968
268 nmdc:mga03683_91194_c1 3300050489 Bacteria 1329
269 nmdc:mga00v17_17852_c1 3300050491 Bacteria 4023
270 nmdc:mga0k408_1584_c1 3300050493 Bacteria 12299
271 nmdc:mga0k408_3072_c1 3300050493 Bacteria 8845
272 nmdc:mga06z11_36690_c1 3300050494 Bacteria 2421
273 nmdc:mga07m45_142701_c1 3300050496 Bacteria 1387
274 nmdc:mga08y16_164094_c1 3300050511 Bacteria 2308
275 nmdc:mga08y16_350105_c1 3300050511 Bacteria 1517
276 nmdc:mga0n895_317152_c1 3300050512 Bacteria 1580
277 nmdc:mga0rr50_245555_c1 3300050513 Bacteria 1485
278 nmdc:mga0sz30_40779_c1 3300050516 Bacteria 1951
279 Ga0495601_0004965 3300053077 Bacteria 7719
280 Ga0495601_0013139 3300053077 Bacteria 4978
281 Ga0500635_0084946 3300053080 Bacteria 1143
282 Ga0495595_0004309 3300053084 Bacteria 5724
283 Ga0495595_0015894 3300053084 Bacteria 3213
284 Ga0495595_0262335 3300053084 Unclassified 866
285 Ga0495619_0006479 3300053085 Bacteria 7415
286 Ga0500583_0072091 3300053092 Bacteria 1654
287 Ga0500641_0097906 3300053096 Bacteria 1257
288 Ga0500650_0117148 3300053098 Bacteria 1243
289 Ga0500652_107319 3300053131 Bacteria 1167
290 Ga0500577_0025913 3300053142 Bacteria 1990
291 Ga0500577_0087450 3300053142 Bacteria 1254
292 Ga0500604_0064830 3300053151 Bacteria 1155
293 Ga0501084_0063201 3300054114 Bacteria 3099
294 Ga0501084_0186063 3300054114 Bacteria 1753
295 Ga0501084_0371783 3300054114 Bacteria 1208
296 Ga0501082_0271420 3300060353 Bacteria 1476
297 Ga0501082_0394098 3300060353 Bacteria 1208
298 Ga0530510_0076942 3300061734 Bacteria 2425
299 Ga0530510_0227391 3300061734 Unclassified 1387
300 2644743321 2643221736 Bacteria 6608466
301 2819718464 2818991467 Bacteria 5893227
302 2841764803 2841760612 Bacteria 6454112
303 2844107749 2844104063 Bacteria 6440972
304 2851183119 2851182111 Bacteria 6047226
305 2851249855 2851246043 Bacteria 6439203
306 8057533166 8057529695 Bacteria 6306553
307 Ga0207664_10046298
308 JGI25159J45721_1006338
309 Ga0065165_1000229
310 Ga0065715_10305770
311 Ga0065715_10316452
312 Ga0070658_10024543
313 Ga0070658_10032181
314 Ga0070676_10077890
315 Ga0070670_100183358
316 Ga0070666_10034384
317 Ga0070680_100001887
318 Ga0070680_100138126
319 Ga0070680_100147308
320 Ga0070689_100184834
321 Ga0070689_100229193
322 Ga0070687_100061864
323 Ga0070687_100304305
324 Ga0070675_100240838
325 Ga0070675_100306057
326 Ga0070671_100074007
327 Ga0070673_100441449
328 Ga0070688_100060508
329 Ga0070659_100052566
330 Ga0070713_100126140
331 Ga0070701_10173393
332 Ga0070711_100076780
333 Ga0070705_100037208
334 Ga0070662_100222956
335 Ga0070681_10072303
336 Ga0070681_10326884
337 Ga0070685_10185710
338 Ga0070707_100566786
339 Ga0070698_100175772
340 Ga0070698_100763711
341 Ga0070679_100005746
342 Ga0068853_100185351
343 Ga0068853_100722379
344 Ga0070695_100012768
345 Ga0070665_100735383
346 Ga0068855_100015541
347 Ga0068855_100039698
348 Ga0068857_100120931
349 Ga0068856_100072059
350 Ga0068856_100373363
351 Ga0068852_100019271
352 Ga0068852_100104491
353 Ga0068864_100070957
354 Ga0068863_100100898
355 Ga0068862_100600066
356 Ga0081538_10029189
357 Ga0081539_10034076
358 Ga0070717_10242830
359 Ga0070717_10434143
360 Ga0075432_10030816
361 Ga0075362_10001180
362 Ga0075367_10007683
363 Ga0075369_10122500
364 Ga0075366_10001237
365 Ga0075366_10038855
366 Ga0075428_100148021
367 Ga0075434_100025900
368 Ga0075434_100339292
369 Ga0075436_100094037
370 Ga0105251_10074583
371 Ga0111539_10036258
372 Ga0111539_10233941
373 Ga0111539_10275051
374 Ga0105245_10570874
375 Ga0114129_10164372
376 Ga0105243_10261367
377 Ga0105248_10076366
378 Ga0105238_10096406
379 Ga0105249_10912614
380 Ga0105246_10203689
381 Ga0157373_10078407
382 Ga0157371_10083441
383 Ga0157371_10185937
384 Ga0157370_10055398
385 Ga0157370_10187709
386 Ga0157369_10627700
387 Ga0163162_10330105
388 Ga0163162_10808002
389 Ga0157372_10197053
390 Ga0157380_10090841
391 Ga0157379_10556912
392 Ga0213871_10064393
393 Ga0209130_1000045
394 Ga0209025_1016636
395 Ga0209025_1064609
396 Ga0207426_1010082
397 Ga0207682_10000821
398 Ga0207710_10071666
399 Ga0207688_10014612
400 Ga0207688_10219241
401 Ga0207680_10312598
402 Ga0207645_10015201
403 Ga0207705_10004267
404 Ga0207705_10024644
405 Ga0207707_10086981
406 Ga0207707_10489654
407 Ga0207663_10132452
408 Ga0207660_10011533
409 Ga0207660_10119428
410 Ga0207662_10024536
411 Ga0207662_10385950
412 Ga0207657_10229062
413 Ga0207652_10005554
414 Ga0207652_10719950
415 Ga0207646_10141679
416 Ga0207694_10275017
417 Ga0207650_10208954
418 Ga0207650_10283597
419 Ga0207687_10151150
420 Ga0207700_10111143
421 Ga0207700_10282626
422 Ga0207644_10210070
423 Ga0207690_10188121
424 Ga0207669_10470777
425 Ga0207691_10016641
426 Ga0207691_10205553
427 Ga0207689_10398487
428 Ga0207667_10002456
429 Ga0207667_10081395
430 Ga0207668_10260143
431 Ga0207678_10287857
432 Ga0207708_10229841
433 Ga0207702_10075969
434 Ga0207702_10320213
435 Ga0207648_10122467
436 Ga0207676_10123624
437 Ga0207674_10153474
438 Ga0207675_100211187
439 Ga0207675_100551450
440 Ga0207683_10022537
441 Ga0207698_10078135
442 Ga0207428_10077328
443 Ga0268264_10267827
444 Ga0265325_10008700
445 Ga0265339_10001774
446 Ga0265316_10087898
447 Ga0307408_100269183
448 Ga0265313_10005248
449 Ga0307410_10023949
450 Ga0307414_10034218
451 Ga0307411_10035047
452 Ga0307510_10061301
453 Ga0373954_0041799
454 Ga0373943_0128162
455 Ga0373924_0057131
456 Ga0373935_0063565
457 Ga0373927_0147745
458 Ga0373947_0114381
459 Ga0373947_0154270
460 Ga0373937_0188758
461 Ga0373925_0436438
462 Ga0395899_0006840
463 Ga0395899_0288058
464 Ga0395900_0001715
465 Ga0395898_0025971
466 Ga0395898_0026356
467 Ga0395905_0773437
468 Ga0395901_0011685
469 Ga0395901_0018310
470 Ga0395901_0027824
471 Ga0237819_05741
472 Ga0436360_1088500
473 Ga0439453_0023547
474 Ga0451577_0053982
475 Ga0451577_0214926
476 Ga0466963_0202410
477 Ga0453684_0548376
478 Ga0453684_0742425
479 Ga0466957_0397964
480 Ga0466957_0465350
481 Ga0495617_007487
482 Ga0495590_0081782
483 Ga0495591_009879
484 Ga0495629_0296885
485 Ga0495638_0018079
486 Ga0495638_0019577
487 Ga0495653_0131431
488 Ga0495650_0000316
489 Ga0495650_0006039
490 Ga0495582_0028739
491 Ga0495605_0000079
492 Ga0495605_0035176
493 Ga0495584_0217310
494 Ga0495585_0076329
495 Ga0495607_0000677
496 Ga0495607_0054940
497 Ga0495583_0000591
498 Ga0495583_0001018
499 Ga0495583_0001437
500 Ga0495583_0001702
501 Ga0495606_0000022
502 Ga0495610_0006127
503 Ga0495610_0015167
504 Ga0495616_0014258
505 Ga0495620_0030044
506 Ga0495620_0156792
507 Ga0495632_0000651
508 Ga0495632_0075360
509 Ga0495637_0012666
510 Ga0495637_0039494
511 Ga0495643_0045590
512 Ga0495663_0107352
513 Ga0495654_0012882
514 Ga0495598_0004211
515 Ga0495609_0000168
516 Ga0495609_0000692
517 Ga0495597_0069377
518 Ga0495622_0006296
519 Ga0495667_0055862
520 Ga0495625_0000004
521 Ga0495625_0056135
522 Ga0495659_0146435
523 Ga0495661_0000006
524 Ga0495661_0000241
525 Ga0495661_0008380
526 Ga0495646_0227222
527 Ga0495646_0324684
528 Ga0495670_0019266
529 Ga0495649_0008246
530 Ga0495660_0010455
531 Ga0495660_0139427
532 Ga0495672_0089047
533 Ga0495676_0000004
534 Ga0495679_000015
535 Ga0495685_091410
536 Ga0495673_0007288
537 Ga0495673_0092395
538 Ga0495681_0003055
539 Ga0495686_0076449
540 Ga0495602_0122941
541 Ga0495602_0555774
542 Ga0495626_0000012
543 Ga0496105_0012003
544 Ga0496111_0435535
545 Ga0496112_0214089
546 Ga0496126_0140544
547 Ga0495678_019718
548 Ga0501031_0047379
549 Ga0501034_0057229
550 Ga0501037_0105123
551 Ga0501038_0049358
552 Ga0501038_0542404
553 Ga0501039_0008884
554 Ga0501039_0278588
555 Ga0501039_0541181
556 Ga0501047_0015335
557 Ga0501047_0298199
558 Ga0501048_0485473
559 Ga0501070_0089318
560 Ga0501072_0058147
561 Ga0501072_0180018
562 Ga0501075_0467344
563 Ga0501079_0159569
564 Ga0501081_0093534
565 Ga0501081_0165634
566 Ga0501081_0181145
567 Ga0501083_0030354
568 Ga0501083_0069976
569 Ga0501083_0070219
570 Ga0501044_0432487
571 Ga0501045_0335645
572 nmdc:mga03683_11573_c1
573 nmdc:mga03683_178336_c1
574 nmdc:mga03683_91194_c1
575 nmdc:mga00v17_17852_c1
576 nmdc:mga0k408_1584_c1
577 nmdc:mga0k408_3072_c1
578 nmdc:mga06z11_36690_c1
579 nmdc:mga07m45_142701_c1
580 nmdc:mga08y16_164094_c1
581 nmdc:mga08y16_350105_c1
582 nmdc:mga0n895_317152_c1
583 nmdc:mga0rr50_245555_c1
584 nmdc:mga0sz30_40779_c1
585 Ga0495601_0004965
586 Ga0495601_0013139
587 Ga0500635_0084946
588 Ga0495595_0004309
589 Ga0495595_0015894
590 Ga0495595_0262335
591 Ga0495619_0006479
592 Ga0500583_0072091
593 Ga0500641_0097906
594 Ga0500650_0117148
595 Ga0500652_107319
596 Ga0500577_0025913
597 Ga0500577_0087450
598 Ga0500604_0064830
599 Ga0501084_0063201
600 Ga0501084_0186063
601 Ga0501084_0371783
602 Ga0501082_0271420
603 Ga0501082_0394098
604 Ga0530510_0076942
605 Ga0530510_0227391
606 2644743321
607 2819718464
608 2841764803
609 2844107749
610 2851183119
611 2851249855
612 8057533166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

77

257

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.7396 44 230
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.7243 44 230
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.7132 44 230
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.6479 56 226
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.6467 50 226
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7809 47 226 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7616 54 231 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.743 50 226 1.10.3720.10
af_P14176_140_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7413 53 232 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7384 54 235 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7G2IJA1-F1-model_v4 Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB 0.8309 1 203 GO:0005524
GO:0005886
GO:0016887
GO:0055085
AF-A0A4Q7Y480-F1-model_v4 NitT/TauT family transport system permease protein 0.8188 3 226 GO:0005886
GO:0055085
AF-A0A432TQM8-F1-model_v4 ABC transporter ATP-binding protein 0.8183 10 226 GO:0005524
GO:0005886
GO:0016887
GO:0055085
AF-A0A6F8YEI0-F1-model_v4 ABC transporter permease 0.8165 2 226 GO:0005886
GO:0055085
AF-A0A2W4MNX5-F1-model_v4 deleted 0.812 12 208

Map