F398749

General Info

Members Datasets Scaffolds Average Seq Length
306 188 305 77

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101356210|Ga0307416_1013562102
Length 86
Sequence VSANKAGRGPVRRPFTREQRTTIIYGMLAFILILVILQLWLLTATMNAYLGGDEAVIWPAAAASMFCLLLNAGLLRYLYYIERVRR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
148 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
170 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 0
Rhizosphere 98.69
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_3325057 2162886012 Unclassified 915
2 Ga0065707_10472318 3300005295 Bacteria 781
3 Ga0065707_11069021 3300005295 Bacteria 522
4 Ga0070670_100129959 3300005331 Bacteria 2175
5 Ga0070670_100441771 3300005331 Bacteria 1152
6 Ga0070670_100606332 3300005331 Bacteria 980
7 Ga0070666_10212539 3300005335 Bacteria 1363
8 Ga0070689_100642858 3300005340 Bacteria 922
9 Ga0070691_10001764 3300005341 Bacteria 9412
10 Ga0070687_100142294 3300005343 Bacteria 1398
11 Ga0070668_100984747 3300005347 Unclassified 757
12 Ga0070669_100998199 3300005353 Bacteria 718
13 Ga0070669_101223678 3300005353 Bacteria 649
14 Ga0070669_101238654 3300005353 Bacteria 645
15 Ga0070669_101310349 3300005353 Bacteria 627
16 Ga0070669_101799429 3300005353 Bacteria 534
17 Ga0070675_100139050 3300005354 Bacteria 2075
18 Ga0070675_100372718 3300005354 Bacteria 1269
19 Ga0070675_100965272 3300005354 Bacteria 782
20 Ga0070675_101341865 3300005354 Unclassified 659
21 Ga0070671_100529420 3300005355 Unclassified 1015
22 Ga0070671_100539166 3300005355 Unclassified 1006
23 Ga0070671_101337324 3300005355 Unclassified 632
24 Ga0070674_101046733 3300005356 Unclassified 718
25 Ga0070673_100368892 3300005364 Bacteria 1278
26 Ga0070688_100935807 3300005365 Bacteria 685
27 Ga0070659_101251398 3300005366 Bacteria 657
28 Ga0070667_100173051 3300005367 Bacteria 1907
29 Ga0070667_101038588 3300005367 Unclassified 765
30 Ga0070714_100005531 3300005435 Bacteria 9649
31 Ga0070714_100209508 3300005435 Unclassified 1786
32 Ga0070714_100491788 3300005435 Bacteria 1169
33 Ga0070701_10239213 3300005438 Bacteria 1091
34 Ga0070701_10566648 3300005438 Bacteria 747
35 Ga0070701_11012567 3300005438 Unclassified 580
36 Ga0070705_100055886 3300005440 Bacteria 2322
37 Ga0070705_101623359 3300005440 Unclassified 545
38 Ga0070700_100008636 3300005441 Bacteria 5553
39 Ga0070700_100558813 3300005441 Bacteria 890
40 Ga0070700_100597232 3300005441 Bacteria 864
41 Ga0070694_100408844 3300005444 Bacteria 1064
42 Ga0068867_100254628 3300005459 Bacteria 1429
43 Ga0070698_101026811 3300005471 Bacteria 772
44 Ga0070699_101375692 3300005518 Unclassified 647
45 Ga0070672_100192159 3300005543 Bacteria 1705
46 Ga0070672_100674370 3300005543 Bacteria 904
47 Ga0070672_102158379 3300005543 Unclassified 502
48 Ga0070686_101724375 3300005544 Unclassified 532
49 Ga0070695_100904479 3300005545 Bacteria 713
50 Ga0070696_100057800 3300005546 Bacteria 2707
51 Ga0070665_101426277 3300005548 Unclassified 701
52 Ga0070665_101579418 3300005548 Bacteria 664
53 Ga0070704_100341386 3300005549 Bacteria 1261
54 Ga0070704_100896981 3300005549 Unclassified 797
55 Ga0068855_100479867 3300005563 Unclassified 1353
56 Ga0068855_102164125 3300005563 Bacteria 559
57 Ga0070664_100103849 3300005564 Archaea 2474
58 Ga0068854_100677433 3300005578 Bacteria 888
59 Ga0068856_100336965 3300005614 Unclassified 1526
60 Ga0070702_100516319 3300005615 Unclassified 880
61 Ga0068859_102422268 3300005617 Bacteria 578
62 Ga0068864_102162775 3300005618 Bacteria 563
63 Ga0068861_100010652 3300005719 Bacteria 6385
64 Ga0068861_100443976 3300005719 Bacteria 1161
65 Ga0068861_101143122 3300005719 Unclassified 750
66 Ga0068861_101360128 3300005719 Bacteria 692
67 Ga0068861_101492025 3300005719 Bacteria 663
68 Ga0068861_102554995 3300005719 Unclassified 514
69 Ga0068863_100064197 3300005841 Bacteria 3473
70 Ga0068860_100307052 3300005843 Bacteria 1555
71 Ga0068860_101967982 3300005843 Unclassified 606
72 Ga0068862_100281322 3300005844 Bacteria 1525
73 Ga0068862_100876189 3300005844 Bacteria 881
74 Ga0068862_102668238 3300005844 Unclassified 511
75 Ga0068871_102085427 3300006358 Bacteria 540
76 Ga0075431_100627133 3300006847 Bacteria 1057
77 Ga0075429_101200676 3300006880 Bacteria 662
78 Ga0068865_100867058 3300006881 Unclassified 783
79 Ga0075436_101486196 3300006914 Unclassified 514
80 Ga0097620_102421199 3300006931 Bacteria 578
81 Ga0105240_10219420 3300009093 Bacteria 2216
82 Ga0105240_10349270 3300009093 Bacteria 1678
83 Ga0111539_10134807 3300009094 Bacteria 2892
84 Ga0111539_12214467 3300009094 Bacteria 638
85 Ga0105245_10000186 3300009098 Bacteria 58710
86 Ga0105247_10231357 3300009101 Bacteria 1255
87 Ga0105241_12464326 3300009174 Unclassified 520
88 Ga0105248_10199076 3300009177 Bacteria 2257
89 Ga0105248_10341786 3300009177 Bacteria 1685
90 Ga0105248_13241137 3300009177 Unclassified 518
91 Ga0105249_11043992 3300009553 Bacteria 887
92 Ga0105246_10617049 3300011119 Unclassified 939
93 Ga0157373_10296044 3300013100 Unclassified 1148
94 Ga0157370_10088419 3300013104 Unclassified 2910
95 Ga0157369_10300130 3300013105 Bacteria 1671
96 Ga0157369_10349668 3300013105 Bacteria 1535
97 Ga0157369_10775295 3300013105 Bacteria 986
98 Ga0157369_12238662 3300013105 Bacteria 554
99 Ga0157374_10117311 3300013296 Bacteria 2565
100 Ga0157378_11468063 3300013297 Bacteria 726
101 Ga0163162_10012824 3300013306 Bacteria 8186
102 Ga0163162_12462268 3300013306 Bacteria 598
103 Ga0163162_13280079 3300013306 Unclassified 518
104 Ga0157372_10070680 3300013307 Bacteria 3928
105 Ga0157372_10569695 3300013307 Bacteria 1320
106 Ga0157372_10728313 3300013307 Unclassified 1153
107 Ga0157372_10833415 3300013307 Bacteria 1071
108 Ga0157375_10549189 3300013308 Bacteria 1317
109 Ga0163163_12330557 3300014325 Unclassified 594
110 Ga0157380_10188365 3300014326 Bacteria 1819
111 Ga0157380_11801825 3300014326 Bacteria 671
112 Ga0157377_10749684 3300014745 Bacteria 714
113 Ga0207688_10924301 3300025901 Unclassified 552
114 Ga0207680_10365805 3300025903 Unclassified 1015
115 Ga0207645_10012483 3300025907 Bacteria 5761
116 Ga0207707_10301103 3300025912 Bacteria 1386
117 Ga0207695_10002596 3300025913 Bacteria 26488
118 Ga0207695_10078005 3300025913 Bacteria 3362
119 Ga0207660_10064674 3300025917 Bacteria 2641
120 Ga0207662_10171225 3300025918 Bacteria 1392
121 Ga0207662_10195724 3300025918 Unclassified 1306
122 Ga0207662_11029190 3300025918 Bacteria 585
123 Ga0207652_10064367 3300025921 Bacteria 3172
124 Ga0207646_11753734 3300025922 Bacteria 532
125 Ga0207681_10533289 3300025923 Bacteria 964
126 Ga0207681_10569063 3300025923 Unclassified 934
127 Ga0207681_11230765 3300025923 Unclassified 629
128 Ga0207681_11378608 3300025923 Bacteria 592
129 Ga0207650_10085863 3300025925 Bacteria 2395
130 Ga0207650_10351112 3300025925 Bacteria 1213
131 Ga0207659_10000080 3300025926 Bacteria 60332
132 Ga0207659_10086616 3300025926 Bacteria 2330
133 Ga0207659_10184500 3300025926 Bacteria 1655
134 Ga0207659_10307353 3300025926 Bacteria 1304
135 Ga0207659_10535023 3300025926 Bacteria 995
136 Ga0207687_10000725 3300025927 Bacteria 22382
137 Ga0207664_10139265 3300025929 Bacteria 2051
138 Ga0207644_11722984 3300025931 Bacteria 525
139 Ga0207690_11565081 3300025932 Bacteria 551
140 Ga0207706_10474311 3300025933 Unclassified 1081
141 Ga0207670_10539391 3300025936 Unclassified 952
142 Ga0207670_10560061 3300025936 Bacteria 935
143 Ga0207704_10934884 3300025938 Unclassified 731
144 Ga0207691_10325922 3300025940 Bacteria 1316
145 Ga0207711_11100516 3300025941 Unclassified 735
146 Ga0207679_10599699 3300025945 Unclassified 992
147 Ga0207667_10775555 3300025949 Unclassified 957
148 Ga0207651_10364404 3300025960 Bacteria 1221
149 Ga0207712_10858512 3300025961 Unclassified 800
150 Ga0207712_10969983 3300025961 Bacteria 753
151 Ga0207668_10955583 3300025972 Unclassified 764
152 Ga0207640_12096271 3300025981 Bacteria 513
153 Ga0207658_10328008 3300025986 Bacteria 1327
154 Ga0207703_11584927 3300026035 Unclassified 630
155 Ga0207708_10014645 3300026075 Bacteria 5869
156 Ga0207708_11403761 3300026075 Bacteria 613
157 Ga0207708_11649925 3300026075 Unclassified 563
158 Ga0207641_10206350 3300026088 Bacteria 1815
159 Ga0207648_10009113 3300026089 Bacteria 9540
160 Ga0207676_10902261 3300026095 Bacteria 867
161 Ga0207675_100057364 3300026118 Bacteria 3633
162 Ga0207675_102231504 3300026118 Bacteria 562
163 Ga0207675_102246058 3300026118 Unclassified 560
164 Ga0207675_102420875 3300026118 Bacteria 537
165 Ga0207683_11582622 3300026121 Bacteria 604
166 Ga0207428_10051568 3300027907 Bacteria 3289
167 Ga0268266_11180580 3300028379 Unclassified 740
168 Ga0268266_11399026 3300028379 Unclassified 675
169 Ga0268265_10299642 3300028380 Bacteria 1447
170 Ga0268264_12042413 3300028381 Unclassified 582
171 Ga0307405_10112084 3300031731 Bacteria 1850
172 Ga0307413_10219256 3300031824 Bacteria 1388
173 Ga0307410_10800768 3300031852 Bacteria 801
174 Ga0307410_11555096 3300031852 Unclassified 584
175 Ga0307406_11286758 3300031901 Bacteria 638
176 Ga0307407_10733626 3300031903 Bacteria 747
177 Ga0307412_10430358 3300031911 Bacteria 1082
178 Ga0307412_10451284 3300031911 Bacteria 1059
179 Ga0307409_100097276 3300031995 Bacteria 2431
180 Ga0307409_100438292 3300031995 Bacteria 1258
181 Ga0307409_100911798 3300031995 Bacteria 893
182 Ga0307416_100078495 3300032002 Bacteria 2778
183 Ga0307416_100147117 3300032002 Bacteria 2153
184 Ga0307416_101356210 3300032002 Bacteria 817
185 Ga0307416_101503610 3300032002 Bacteria 779
186 Ga0307414_10167724 3300032004 Bacteria 1752
187 Ga0307411_10080593 3300032005 Bacteria 2239
188 Ga0307411_11551235 3300032005 Bacteria 610
189 Ga0307415_100393894 3300032126 Bacteria 1180
190 Ga0307415_100992870 3300032126 Unclassified 780
191 Ga0373948_0006201 3300034817 Bacteria 1969
192 Ga0373923_0254368 3300035111 Bacteria 823
193 Ga0373956_0112575 3300035119 Bacteria 1268
194 Ga0373937_0062585 3300036401 Bacteria 3421
195 Ga0373937_0613493 3300036401 Bacteria 1033
196 Ga0373925_1692137 3300037068 Unclassified 517
197 Ga0451853_1202376 3300041512 Bacteria 736
198 Ga0439435_0006464 3300042436 Bacteria 2635
199 Ga0495592_0682072 3300046454 Bacteria 620
200 Ga0495603_0403333 3300046455 Unclassified 784
201 Ga0495629_0507920 3300046459 Bacteria 812
202 Ga0495653_0513360 3300046463 Bacteria 746
203 Ga0495639_0057532 3300046475 Bacteria 1777
204 Ga0495618_0258664 3300046514 Bacteria 1090
205 Ga0495618_0465544 3300046514 Unclassified 766
206 Ga0495628_0727762 3300046516 Bacteria 699
207 Ga0495640_0105522 3300046533 Archaea 1846
208 Ga0495640_0448909 3300046533 Bacteria 788
209 Ga0495587_0630982 3300046536 Bacteria 589
210 Ga0495667_0169060 3300046559 Bacteria 1405
211 Ga0495667_1001454 3300046559 Unclassified 510
212 Ga0495634_0209552 3300046642 Bacteria 1207
213 Ga0495635_0103169 3300046663 Bacteria 1949
214 Ga0495635_0186516 3300046663 Archaea 1409
215 Ga0495599_0599005 3300046678 Bacteria 642
216 Ga0495658_0257363 3300046683 Bacteria 1098
217 Ga0495613_0134204 3300046689 Archaea 1772
218 Ga0495600_0749315 3300046809 Bacteria 585
219 Ga0495581_0431691 3300047315 Bacteria 768
220 Ga0495604_0046764 3300047317 Bacteria 3374
221 Ga0495604_0101903 3300047317 Bacteria 2108
222 Ga0495674_0861523 3300047319 Unclassified 701
223 Ga0495674_1187984 3300047319 Unclassified 577
224 Ga0495675_0206808 3300047444 Bacteria 1193
225 Ga0495675_0791135 3300047444 Unclassified 526
226 Ga0495684_0014303 3300047471 Bacteria 6109
227 Ga0495684_0400449 3300047471 Bacteria 964
228 Ga0495602_0274789 3300048088 Bacteria 1244
229 Ga0501298_092819 3300049521 Bacteria 679
230 Ga0501299_044676 3300049522 Unclassified 899
231 Ga0501033_0121637 3300049570 Bacteria 1894
232 Ga0501034_0014249 3300049571 Bacteria 8196
233 Ga0501034_0303171 3300049571 Bacteria 1534
234 Ga0501034_1559036 3300049571 Bacteria 534
235 Ga0501036_0016068 3300049572 Bacteria 6254
236 Ga0501037_0008278 3300049573 Bacteria 7624
237 Ga0501037_0534297 3300049573 Bacteria 793
238 Ga0501038_0098335 3300049574 Bacteria 2440
239 Ga0501039_0268375 3300049575 Bacteria 1341
240 Ga0501040_0001996 3300049576 Bacteria 13159
241 Ga0501040_0183808 3300049576 Bacteria 1482
242 Ga0501041_0005352 3300049577 Bacteria 7514
243 Ga0501041_0248591 3300049577 Unclassified 1118
244 Ga0501042_0129906 3300049578 Bacteria 1815
245 Ga0501043_0021200 3300049579 Bacteria 5094
246 Ga0501046_0122994 3300049580 Bacteria 1973
247 Ga0501047_0012159 3300049581 Bacteria 8147
248 Ga0501047_0056381 3300049581 Bacteria 3799
249 Ga0501047_0170649 3300049581 Bacteria 2044
250 Ga0501048_0643017 3300049582 Archaea 761
251 Ga0501048_1281586 3300049582 Unclassified 527
252 Ga0501068_0074502 3300049584 Bacteria 2075
253 Ga0501070_0073955 3300049586 Bacteria 2820
254 Ga0501070_0074219 3300049586 Bacteria 2816
255 Ga0501070_0109436 3300049586 Bacteria 2283
256 Ga0501070_0821567 3300049586 Unclassified 729
257 Ga0501070_1029036 3300049586 Bacteria 638
258 Ga0501072_0113786 3300049588 Bacteria 2154
259 Ga0501074_0059480 3300049590 Bacteria 2753
260 Ga0501074_0060969 3300049590 Bacteria 2718
261 Ga0501074_0075855 3300049590 Bacteria 2414
262 Ga0501074_0918817 3300049590 Unclassified 616
263 Ga0501075_0003616 3300049591 Bacteria 10368
264 Ga0501075_0071624 3300049591 Bacteria 2620
265 Ga0501075_1517497 3300049591 Unclassified 507
266 Ga0501076_0000714 3300049592 Bacteria 21429
267 Ga0501076_0005455 3300049592 Bacteria 9152
268 Ga0501077_0349552 3300049593 Unclassified 943
269 Ga0501077_0680747 3300049593 Unclassified 661
270 Ga0501207_070610 3300049654 Bacteria 655
271 Ga0501235_151274 3300049669 Bacteria 601
272 Ga0501079_0011475 3300049741 Bacteria 6763
273 Ga0501080_0060052 3300049742 Bacteria 3538
274 Ga0501080_0071633 3300049742 Bacteria 3224
275 Ga0501080_0226803 3300049742 Bacteria 1708
276 Ga0501081_0008125 3300049743 Bacteria 6811
277 Ga0501081_0016525 3300049743 Bacteria 4879
278 Ga0501081_0937335 3300049743 Unclassified 653
279 Ga0501083_0076218 3300049744 Bacteria 2226
280 Ga0501035_0084836 3300049822 Bacteria 2793
281 Ga0501035_0455860 3300049822 Unclassified 1057
282 Ga0501044_0000230 3300049823 Bacteria 70210
283 Ga0501044_0005183 3300049823 Bacteria 14507
284 Ga0501044_0009239 3300049823 Bacteria 10766
285 Ga0501045_0037192 3300049824 Bacteria 3538
286 Ga0501045_0056715 3300049824 Bacteria 2865
287 nmdc:mga03683_389467_c1 3300050489 Bacteria 664
288 nmdc:mga0yw44_1217540_c1 3300050492 Bacteria 508
289 nmdc:mga0qj67_350395_c1 3300050509 Bacteria 1194
290 nmdc:mga06r32_375132_c1 3300050510 Bacteria 1405
291 Ga0495601_0413770 3300053077 Bacteria 873
292 Ga0495619_0061619 3300053085 Bacteria 2496
293 Ga0495619_0117599 3300053085 Bacteria 1821
294 Ga0495619_0562063 3300053085 Bacteria 782
295 Ga0501084_0021649 3300054114 Bacteria 5360
296 Ga0501084_0128502 3300054114 Bacteria 2133
297 Ga0501084_0627401 3300054114 Bacteria 908
298 Ga0501084_1107097 3300054114 Bacteria 665
299 Ga0590071_159303 3300059421 Unclassified 587
300 Ga0590075_209076 3300059424 Unclassified 517
301 Ga0501082_0033801 3300060353 Bacteria 4410
302 Ga0501082_0059943 3300060353 Bacteria 3279
303 Ga0530510_0010870 3300061734 Bacteria 6386
304 Ga0530510_0315915 3300061734 Bacteria 1170
305 Ga0530510_0881230 3300061734 Unclassified 684

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0507920 Ga0495629_0507920_282_491 69
2 3300046516 Ga0495628_0727762 Ga0495628_0727762_357_566 69
3 3300046533 Ga0495640_0448909 Ga0495640_0448909_531_740 69
4 3300046663 Ga0495635_0103169 Ga0495635_0103169_576_785 69
5 3300046809 Ga0495600_0749315 Ga0495600_0749315_355_564 69
6 3300047315 Ga0495581_0431691 Ga0495581_0431691_43_252 69
7 3300047317 Ga0495604_0046764 Ga0495604_0046764_160_369 69
8 3300047317 Ga0495604_0101903 Ga0495604_0101903_1230_1439 69
9 3300048088 Ga0495602_0274789 Ga0495602_0274789_322_531 69
10 3300053085 Ga0495619_0117599 Ga0495619_0117599_1034_1243 69
11 3300013297 Ga0157378_11468063 Ga0157378_114680632 70
12 3300041512 Ga0451853_1202376 Ga0451853_1202376_243_458 70
13 3300025912 Ga0207707_10301103 Ga0207707_103011032 71
14 3300025917 Ga0207660_10064674 Ga0207660_100646742 71
15 3300025921 Ga0207652_10064367 Ga0207652_100643674 71
16 3300037068 Ga0373925_1692137 Ga0373925_1692137_203_418 71
17 3300046454 Ga0495592_0682072 Ga0495592_0682072_393_608 71
18 3300046536 Ga0495587_0630982 Ga0495587_0630982_296_511 71
19 3300049571 Ga0501034_0303171 Ga0501034_0303171_693_911 71
20 iso_pu_bacteria 2687453257 2688067626 71
21 3300006847 Ga0075431_100627133 Ga0075431_1006271332 72
22 3300026121 Ga0207683_11582622 Ga0207683_115826222 72
23 3300050510 nmdc:mga06r32_375132_c1 nmdc:mga06r32_375132_c1_1152_1388 72
24 3300005365 Ga0070688_100935807 Ga0070688_1009358072 73
25 3300005438 Ga0070701_10566648 Ga0070701_105666481 73
26 3300005441 Ga0070700_100558813 Ga0070700_1005588132 73
27 3300005617 Ga0068859_102422268 Ga0068859_1024222682 73
28 3300005618 Ga0068864_102162775 Ga0068864_1021627751 73
29 3300005719 Ga0068861_102554995 Ga0068861_1025549952 73
30 3300005844 Ga0068862_100876189 Ga0068862_1008761892 73
31 3300006931 Ga0097620_102421199 Ga0097620_1024211992 73
32 3300025926 Ga0207659_10184500 Ga0207659_101845003 73
33 3300026118 Ga0207675_102246058 Ga0207675_1022460582 73
34 3300049581 Ga0501047_0012159 Ga0501047_0012159_2875_3096 73
35 3300049581 Ga0501047_0056381 Ga0501047_0056381_683_913 73
36 3300049586 Ga0501070_0073955 Ga0501070_0073955_1783_2013 73
37 3300049586 Ga0501070_0074219 Ga0501070_0074219_896_1117 73
38 3300049590 Ga0501074_0075855 Ga0501074_0075855_998_1219 73
39 3300049593 Ga0501077_0680747 Ga0501077_0680747_17_238 73
40 3300049823 Ga0501044_0000230 Ga0501044_0000230_34528_34758 73
41 3300009098 Ga0105245_10000186 Ga0105245_100001865 74
42 3300013306 Ga0163162_10012824 Ga0163162_100128244 74
43 3300025927 Ga0207687_10000725 Ga0207687_1000072515 74
44 3300026075 Ga0207708_11403761 Ga0207708_114037611 74
45 3300049521 Ga0501298_092819 Ga0501298_092819_330_554 74
46 3300049586 Ga0501070_1029036 Ga0501070_1029036_103_330 74
47 3300050489 nmdc:mga03683_389467_c1 nmdc:mga03683_389467_c1_145_369 74
48 3300050492 nmdc:mga0yw44_1217540_c1 nmdc:mga0yw44_1217540_c1_220_444 74
49 3300050509 nmdc:mga0qj67_350395_c1 nmdc:mga0qj67_350395_c1_777_1001 74
50 3300005544 Ga0070686_101724375 Ga0070686_1017243751 76
51 3300006358 Ga0068871_102085427 Ga0068871_1020854272 76
52 3300049582 Ga0501048_1281586 Ga0501048_1281586_83_313 76
53 3300049591 Ga0501075_1517497 Ga0501075_1517497_36_266 76
54 3300049743 Ga0501081_0937335 Ga0501081_0937335_265_495 76
55 3300054114 Ga0501084_0627401 Ga0501084_0627401_433_663 76
56 3300059421 Ga0590071_159303 Ga0590071_159303_160_390 76
57 3300061734 Ga0530510_0881230 Ga0530510_0881230_188_418 76
58 3300005353 Ga0070669_101799429 Ga0070669_1017994292 77
59 3300005440 Ga0070705_101623359 Ga0070705_1016233591 77
60 3300005441 Ga0070700_100597232 Ga0070700_1005972322 77
61 3300011119 Ga0105246_10617049 Ga0105246_106170492 77
62 3300031824 Ga0307413_10219256 Ga0307413_102192563 77
63 3300031852 Ga0307410_11555096 Ga0307410_115550962 77
64 3300031901 Ga0307406_11286758 Ga0307406_112867582 77
65 3300031911 Ga0307412_10430358 Ga0307412_104303582 77
66 3300031995 Ga0307409_100097276 Ga0307409_1000972762 77
67 3300032002 Ga0307416_100147117 Ga0307416_1001471175 77
68 2162886012 MBSR1b_contig_3325057 MBSR1b_0843.00001770 78
69 3300005295 Ga0065707_10472318 Ga0065707_104723181 78
70 3300005295 Ga0065707_11069021 Ga0065707_110690212 78
71 3300005331 Ga0070670_100129959 Ga0070670_1001299592 78
72 3300005331 Ga0070670_100441771 Ga0070670_1004417711 78
73 3300005331 Ga0070670_100606332 Ga0070670_1006063322 78
74 3300005335 Ga0070666_10212539 Ga0070666_102125392 78
75 3300005340 Ga0070689_100642858 Ga0070689_1006428582 78
76 3300005341 Ga0070691_10001764 Ga0070691_100017647 78
77 3300005343 Ga0070687_100142294 Ga0070687_1001422942 78
78 3300005347 Ga0070668_100984747 Ga0070668_1009847472 78
79 3300005353 Ga0070669_100998199 Ga0070669_1009981992 78
80 3300005353 Ga0070669_101223678 Ga0070669_1012236782 78
81 3300005353 Ga0070669_101238654 Ga0070669_1012386542 78
82 3300005353 Ga0070669_101310349 Ga0070669_1013103492 78
83 3300005354 Ga0070675_100139050 Ga0070675_1001390504 78
84 3300005354 Ga0070675_100372718 Ga0070675_1003727182 78
85 3300005354 Ga0070675_100965272 Ga0070675_1009652721 78
86 3300005354 Ga0070675_101341865 Ga0070675_1013418651 78
87 3300005355 Ga0070671_100529420 Ga0070671_1005294202 78
88 3300005355 Ga0070671_100539166 Ga0070671_1005391662 78
89 3300005355 Ga0070671_101337324 Ga0070671_1013373241 78
90 3300005356 Ga0070674_101046733 Ga0070674_1010467331 78
91 3300005364 Ga0070673_100368892 Ga0070673_1003688922 78
92 3300005366 Ga0070659_101251398 Ga0070659_1012513982 78
93 3300005367 Ga0070667_100173051 Ga0070667_1001730512 78
94 3300005367 Ga0070667_101038588 Ga0070667_1010385882 78
95 3300005435 Ga0070714_100005531 Ga0070714_1000055312 78
96 3300005435 Ga0070714_100209508 Ga0070714_1002095083 78
97 3300005435 Ga0070714_100491788 Ga0070714_1004917882 78
98 3300005438 Ga0070701_10239213 Ga0070701_102392132 78
99 3300005438 Ga0070701_11012567 Ga0070701_110125672 78
100 3300005440 Ga0070705_100055886 Ga0070705_1000558864 78
101 3300005441 Ga0070700_100008636 Ga0070700_1000086366 78
102 3300005444 Ga0070694_100408844 Ga0070694_1004088441 78
103 3300005459 Ga0068867_100254628 Ga0068867_1002546282 78
104 3300005471 Ga0070698_101026811 Ga0070698_1010268112 78
105 3300005518 Ga0070699_101375692 Ga0070699_1013756922 78
106 3300005543 Ga0070672_100192159 Ga0070672_1001921592 78
107 3300005543 Ga0070672_100674370 Ga0070672_1006743702 78
108 3300005543 Ga0070672_102158379 Ga0070672_1021583792 78
109 3300005545 Ga0070695_100904479 Ga0070695_1009044792 78
110 3300005546 Ga0070696_100057800 Ga0070696_1000578004 78
111 3300005548 Ga0070665_101426277 Ga0070665_1014262772 78
112 3300005548 Ga0070665_101579418 Ga0070665_1015794181 78
113 3300005549 Ga0070704_100341386 Ga0070704_1003413862 78
114 3300005549 Ga0070704_100896981 Ga0070704_1008969811 78
115 3300005563 Ga0068855_100479867 Ga0068855_1004798672 78
116 3300005563 Ga0068855_102164125 Ga0068855_1021641252 78
117 3300005564 Ga0070664_100103849 Ga0070664_1001038493 78
118 3300005578 Ga0068854_100677433 Ga0068854_1006774331 78
119 3300005614 Ga0068856_100336965 Ga0068856_1003369653 78
120 3300005615 Ga0070702_100516319 Ga0070702_1005163191 78
121 3300005719 Ga0068861_100010652 Ga0068861_1000106524 78
122 3300005719 Ga0068861_100443976 Ga0068861_1004439762 78
123 3300005719 Ga0068861_101143122 Ga0068861_1011431221 78
124 3300005719 Ga0068861_101360128 Ga0068861_1013601281 78
125 3300005719 Ga0068861_101492025 Ga0068861_1014920252 78
126 3300005841 Ga0068863_100064197 Ga0068863_1000641972 78
127 3300005843 Ga0068860_100307052 Ga0068860_1003070522 78
128 3300005843 Ga0068860_101967982 Ga0068860_1019679822 78
129 3300005844 Ga0068862_100281322 Ga0068862_1002813222 78
130 3300005844 Ga0068862_102668238 Ga0068862_1026682381 78
131 3300006880 Ga0075429_101200676 Ga0075429_1012006762 78
132 3300006881 Ga0068865_100867058 Ga0068865_1008670582 78
133 3300006914 Ga0075436_101486196 Ga0075436_1014861962 78
134 3300009093 Ga0105240_10219420 Ga0105240_102194203 78
135 3300009093 Ga0105240_10349270 Ga0105240_103492702 78
136 3300009094 Ga0111539_10134807 Ga0111539_101348071 78
137 3300009094 Ga0111539_12214467 Ga0111539_122144672 78
138 3300009101 Ga0105247_10231357 Ga0105247_102313572 78
139 3300009174 Ga0105241_12464326 Ga0105241_124643262 78
140 3300009177 Ga0105248_10199076 Ga0105248_101990762 78
141 3300009177 Ga0105248_10341786 Ga0105248_103417863 78
142 3300009177 Ga0105248_13241137 Ga0105248_132411372 78
143 3300009553 Ga0105249_11043992 Ga0105249_110439922 78
144 3300013100 Ga0157373_10296044 Ga0157373_102960442 78
145 3300013104 Ga0157370_10088419 Ga0157370_100884192 78
146 3300013105 Ga0157369_10300130 Ga0157369_103001302 78
147 3300013105 Ga0157369_10349668 Ga0157369_103496683 78
148 3300013105 Ga0157369_10775295 Ga0157369_107752952 78
149 3300013105 Ga0157369_12238662 Ga0157369_122386622 78
150 3300013296 Ga0157374_10117311 Ga0157374_101173114 78
151 3300013306 Ga0163162_12462268 Ga0163162_124622682 78
152 3300013306 Ga0163162_13280079 Ga0163162_132800791 78
153 3300013307 Ga0157372_10070680 Ga0157372_100706804 78
154 3300013307 Ga0157372_10569695 Ga0157372_105696952 78
155 3300013307 Ga0157372_10728313 Ga0157372_107283132 78
156 3300013307 Ga0157372_10833415 Ga0157372_108334152 78
157 3300013308 Ga0157375_10549189 Ga0157375_105491892 78
158 3300014325 Ga0163163_12330557 Ga0163163_123305572 78
159 3300014326 Ga0157380_10188365 Ga0157380_101883652 78
160 3300014326 Ga0157380_11801825 Ga0157380_118018252 78
161 3300014745 Ga0157377_10749684 Ga0157377_107496842 78
162 3300025901 Ga0207688_10924301 Ga0207688_109243012 78
163 3300025903 Ga0207680_10365805 Ga0207680_103658052 78
164 3300025907 Ga0207645_10012483 Ga0207645_100124834 78
165 3300025913 Ga0207695_10002596 Ga0207695_1000259622 78
166 3300025913 Ga0207695_10078005 Ga0207695_100780054 78
167 3300025918 Ga0207662_10171225 Ga0207662_101712252 78
168 3300025918 Ga0207662_10195724 Ga0207662_101957242 78
169 3300025918 Ga0207662_11029190 Ga0207662_110291901 78
170 3300025922 Ga0207646_11753734 Ga0207646_117537342 78
171 3300025923 Ga0207681_10533289 Ga0207681_105332892 78
172 3300025923 Ga0207681_10569063 Ga0207681_105690631 78
173 3300025923 Ga0207681_11230765 Ga0207681_112307651 78
174 3300025923 Ga0207681_11378608 Ga0207681_113786082 78
175 3300025925 Ga0207650_10085863 Ga0207650_100858632 78
176 3300025925 Ga0207650_10351112 Ga0207650_103511122 78
177 3300025926 Ga0207659_10000080 Ga0207659_1000008042 78
178 3300025926 Ga0207659_10086616 Ga0207659_100866162 78
179 3300025926 Ga0207659_10307353 Ga0207659_103073532 78
180 3300025926 Ga0207659_10535023 Ga0207659_105350232 78
181 3300025929 Ga0207664_10139265 Ga0207664_101392654 78
182 3300025931 Ga0207644_11722984 Ga0207644_117229842 78
183 3300025932 Ga0207690_11565081 Ga0207690_115650812 78
184 3300025933 Ga0207706_10474311 Ga0207706_104743112 78
185 3300025936 Ga0207670_10539391 Ga0207670_105393912 78
186 3300025936 Ga0207670_10560061 Ga0207670_105600612 78
187 3300025938 Ga0207704_10934884 Ga0207704_109348841 78
188 3300025940 Ga0207691_10325922 Ga0207691_103259223 78
189 3300025941 Ga0207711_11100516 Ga0207711_111005162 78
190 3300025945 Ga0207679_10599699 Ga0207679_105996992 78
191 3300025949 Ga0207667_10775555 Ga0207667_107755552 78
192 3300025960 Ga0207651_10364404 Ga0207651_103644042 78
193 3300025961 Ga0207712_10858512 Ga0207712_108585122 78
194 3300025961 Ga0207712_10969983 Ga0207712_109699832 78
195 3300025972 Ga0207668_10955583 Ga0207668_109555831 78
196 3300025981 Ga0207640_12096271 Ga0207640_120962712 78
197 3300025986 Ga0207658_10328008 Ga0207658_103280082 78
198 3300026035 Ga0207703_11584927 Ga0207703_115849272 78
199 3300026075 Ga0207708_10014645 Ga0207708_100146456 78
200 3300026075 Ga0207708_11649925 Ga0207708_116499252 78
201 3300026088 Ga0207641_10206350 Ga0207641_102063502 78
202 3300026089 Ga0207648_10009113 Ga0207648_100091139 78
203 3300026095 Ga0207676_10902261 Ga0207676_109022611 78
204 3300026118 Ga0207675_100057364 Ga0207675_1000573644 78
205 3300026118 Ga0207675_102231504 Ga0207675_1022315042 78
206 3300026118 Ga0207675_102420875 Ga0207675_1024208751 78
207 3300027907 Ga0207428_10051568 Ga0207428_100515684 78
208 3300028379 Ga0268266_11180580 Ga0268266_111805802 78
209 3300028379 Ga0268266_11399026 Ga0268266_113990261 78
210 3300028380 Ga0268265_10299642 Ga0268265_102996422 78
211 3300028381 Ga0268264_12042413 Ga0268264_120424131 78
212 3300031731 Ga0307405_10112084 Ga0307405_101120842 78
213 3300031852 Ga0307410_10800768 Ga0307410_108007682 78
214 3300031903 Ga0307407_10733626 Ga0307407_107336262 78
215 3300031911 Ga0307412_10451284 Ga0307412_104512842 78
216 3300031995 Ga0307409_100438292 Ga0307409_1004382923 78
217 3300031995 Ga0307409_100911798 Ga0307409_1009117982 78
218 3300032002 Ga0307416_100078495 Ga0307416_1000784952 78
219 3300032002 Ga0307416_101356210 Ga0307416_1013562102 78
220 3300032002 Ga0307416_101503610 Ga0307416_1015036102 78
221 3300032004 Ga0307414_10167724 Ga0307414_101677243 78
222 3300032005 Ga0307411_10080593 Ga0307411_100805934 78
223 3300032005 Ga0307411_11551235 Ga0307411_115512352 78
224 3300032126 Ga0307415_100393894 Ga0307415_1003938942 78
225 3300032126 Ga0307415_100992870 Ga0307415_1009928702 78
226 3300034817 Ga0373948_0006201 Ga0373948_0006201_114_350 78
227 3300035111 Ga0373923_0254368 Ga0373923_0254368_537_785 78
228 3300035119 Ga0373956_0112575 Ga0373956_0112575_182_424 78
229 3300036401 Ga0373937_0062585 Ga0373937_0062585_2126_2374 78
230 3300036401 Ga0373937_0613493 Ga0373937_0613493_228_470 78
231 3300042436 Ga0439435_0006464 Ga0439435_0006464_1536_1772 78
232 3300046455 Ga0495603_0403333 Ga0495603_0403333_96_332 78
233 3300046463 Ga0495653_0513360 Ga0495653_0513360_308_550 78
234 3300046475 Ga0495639_0057532 Ga0495639_0057532_539_781 78
235 3300046514 Ga0495618_0258664 Ga0495618_0258664_710_958 78
236 3300046514 Ga0495618_0465544 Ga0495618_0465544_54_296 78
237 3300046533 Ga0495640_0105522 Ga0495640_0105522_393_635 78
238 3300046559 Ga0495667_0169060 Ga0495667_0169060_423_671 78
239 3300046559 Ga0495667_1001454 Ga0495667_1001454_170_412 78
240 3300046642 Ga0495634_0209552 Ga0495634_0209552_376_624 78
241 3300046663 Ga0495635_0186516 Ga0495635_0186516_941_1183 78
242 3300046678 Ga0495599_0599005 Ga0495599_0599005_142_378 78
243 3300046683 Ga0495658_0257363 Ga0495658_0257363_661_903 78
244 3300046689 Ga0495613_0134204 Ga0495613_0134204_864_1100 78
245 3300047319 Ga0495674_0861523 Ga0495674_0861523_378_620 78
246 3300047319 Ga0495674_1187984 Ga0495674_1187984_101_349 78
247 3300047444 Ga0495675_0206808 Ga0495675_0206808_69_317 78
248 3300047444 Ga0495675_0791135 Ga0495675_0791135_140_382 78
249 3300047471 Ga0495684_0014303 Ga0495684_0014303_1819_2067 78
250 3300047471 Ga0495684_0400449 Ga0495684_0400449_407_643 78
251 3300049522 Ga0501299_044676 Ga0501299_044676_651_887 78
252 3300049570 Ga0501033_0121637 Ga0501033_0121637_980_1216 78
253 3300049571 Ga0501034_0014249 Ga0501034_0014249_6245_6481 78
254 3300049571 Ga0501034_1559036 Ga0501034_1559036_178_414 78
255 3300049572 Ga0501036_0016068 Ga0501036_0016068_4944_5180 78
256 3300049573 Ga0501037_0008278 Ga0501037_0008278_590_826 78
257 3300049573 Ga0501037_0534297 Ga0501037_0534297_101_337 78
258 3300049574 Ga0501038_0098335 Ga0501038_0098335_1762_1998 78
259 3300049575 Ga0501039_0268375 Ga0501039_0268375_884_1120 78
260 3300049576 Ga0501040_0001996 Ga0501040_0001996_5016_5252 78
261 3300049576 Ga0501040_0183808 Ga0501040_0183808_1176_1412 78
262 3300049577 Ga0501041_0005352 Ga0501041_0005352_4955_5191 78
263 3300049577 Ga0501041_0248591 Ga0501041_0248591_435_671 78
264 3300049578 Ga0501042_0129906 Ga0501042_0129906_140_376 78
265 3300049579 Ga0501043_0021200 Ga0501043_0021200_4191_4427 78
266 3300049580 Ga0501046_0122994 Ga0501046_0122994_271_507 78
267 3300049581 Ga0501047_0170649 Ga0501047_0170649_430_666 78
268 3300049582 Ga0501048_0643017 Ga0501048_0643017_449_685 78
269 3300049584 Ga0501068_0074502 Ga0501068_0074502_457_693 78
270 3300049586 Ga0501070_0109436 Ga0501070_0109436_1579_1815 78
271 3300049586 Ga0501070_0821567 Ga0501070_0821567_186_422 78
272 3300049588 Ga0501072_0113786 Ga0501072_0113786_1382_1618 78
273 3300049590 Ga0501074_0059480 Ga0501074_0059480_420_656 78
274 3300049590 Ga0501074_0060969 Ga0501074_0060969_180_416 78
275 3300049590 Ga0501074_0918817 Ga0501074_0918817_320_556 78
276 3300049591 Ga0501075_0003616 Ga0501075_0003616_9883_10119 78
277 3300049591 Ga0501075_0071624 Ga0501075_0071624_542_778 78
278 3300049592 Ga0501076_0000714 Ga0501076_0000714_18548_18784 78
279 3300049592 Ga0501076_0005455 Ga0501076_0005455_148_384 78
280 3300049593 Ga0501077_0349552 Ga0501077_0349552_501_737 78
281 3300049654 Ga0501207_070610 Ga0501207_070610_207_443 78
282 3300049669 Ga0501235_151274 Ga0501235_151274_315_551 78
283 3300049741 Ga0501079_0011475 Ga0501079_0011475_5078_5314 78
284 3300049742 Ga0501080_0060052 Ga0501080_0060052_1430_1666 78
285 3300049742 Ga0501080_0071633 Ga0501080_0071633_129_365 78
286 3300049742 Ga0501080_0226803 Ga0501080_0226803_482_718 78
287 3300049743 Ga0501081_0008125 Ga0501081_0008125_1440_1676 78
288 3300049743 Ga0501081_0016525 Ga0501081_0016525_59_295 78
289 3300049744 Ga0501083_0076218 Ga0501083_0076218_34_270 78
290 3300049822 Ga0501035_0084836 Ga0501035_0084836_1969_2205 78
291 3300049822 Ga0501035_0455860 Ga0501035_0455860_644_895 78
292 3300049823 Ga0501044_0005183 Ga0501044_0005183_12028_12264 78
293 3300049823 Ga0501044_0009239 Ga0501044_0009239_8724_8960 78
294 3300049824 Ga0501045_0037192 Ga0501045_0037192_2698_2934 78
295 3300049824 Ga0501045_0056715 Ga0501045_0056715_250_486 78
296 3300053077 Ga0495601_0413770 Ga0495601_0413770_279_521 78
297 3300053085 Ga0495619_0061619 Ga0495619_0061619_831_1073 78
298 3300053085 Ga0495619_0562063 Ga0495619_0562063_249_497 78
299 3300054114 Ga0501084_0021649 Ga0501084_0021649_3862_4098 78
300 3300054114 Ga0501084_0128502 Ga0501084_0128502_1285_1521 78
301 3300054114 Ga0501084_1107097 Ga0501084_1107097_238_474 78
302 3300059424 Ga0590075_209076 Ga0590075_209076_62_298 78
303 3300060353 Ga0501082_0033801 Ga0501082_0033801_2284_2520 78
304 3300060353 Ga0501082_0059943 Ga0501082_0059943_2169_2405 78
305 3300061734 Ga0530510_0010870 Ga0530510_0010870_790_1026 78
306 3300061734 Ga0530510_0315915 Ga0530510_0315915_30_266 78

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20540

DUF6755

Family of unknown function (DUF6755)

11

85

0.97

Feature Viewer

pLDDT pTM Quality
72.79 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map