F398749
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 306 | 188 | 305 | 77 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_101356210|Ga0307416_1013562102 |
| Length | 86 |
| Sequence | VSANKAGRGPVRRPFTREQRTTIIYGMLAFILILVILQLWLLTATMNAYLGGDEAVIWPAAAASMFCLLLNAGLLRYLYYIERVRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 109 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 110 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 111 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 114 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 115 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 116 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 117 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 118 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 119 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 120 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 124 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 148 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 149 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 170 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 171 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 179 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 180 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 186 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 187 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.65 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 98.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_3325057 | 2162886012 | Unclassified | 915 |
| 2 | Ga0065707_10472318 | 3300005295 | Bacteria | 781 |
| 3 | Ga0065707_11069021 | 3300005295 | Bacteria | 522 |
| 4 | Ga0070670_100129959 | 3300005331 | Bacteria | 2175 |
| 5 | Ga0070670_100441771 | 3300005331 | Bacteria | 1152 |
| 6 | Ga0070670_100606332 | 3300005331 | Bacteria | 980 |
| 7 | Ga0070666_10212539 | 3300005335 | Bacteria | 1363 |
| 8 | Ga0070689_100642858 | 3300005340 | Bacteria | 922 |
| 9 | Ga0070691_10001764 | 3300005341 | Bacteria | 9412 |
| 10 | Ga0070687_100142294 | 3300005343 | Bacteria | 1398 |
| 11 | Ga0070668_100984747 | 3300005347 | Unclassified | 757 |
| 12 | Ga0070669_100998199 | 3300005353 | Bacteria | 718 |
| 13 | Ga0070669_101223678 | 3300005353 | Bacteria | 649 |
| 14 | Ga0070669_101238654 | 3300005353 | Bacteria | 645 |
| 15 | Ga0070669_101310349 | 3300005353 | Bacteria | 627 |
| 16 | Ga0070669_101799429 | 3300005353 | Bacteria | 534 |
| 17 | Ga0070675_100139050 | 3300005354 | Bacteria | 2075 |
| 18 | Ga0070675_100372718 | 3300005354 | Bacteria | 1269 |
| 19 | Ga0070675_100965272 | 3300005354 | Bacteria | 782 |
| 20 | Ga0070675_101341865 | 3300005354 | Unclassified | 659 |
| 21 | Ga0070671_100529420 | 3300005355 | Unclassified | 1015 |
| 22 | Ga0070671_100539166 | 3300005355 | Unclassified | 1006 |
| 23 | Ga0070671_101337324 | 3300005355 | Unclassified | 632 |
| 24 | Ga0070674_101046733 | 3300005356 | Unclassified | 718 |
| 25 | Ga0070673_100368892 | 3300005364 | Bacteria | 1278 |
| 26 | Ga0070688_100935807 | 3300005365 | Bacteria | 685 |
| 27 | Ga0070659_101251398 | 3300005366 | Bacteria | 657 |
| 28 | Ga0070667_100173051 | 3300005367 | Bacteria | 1907 |
| 29 | Ga0070667_101038588 | 3300005367 | Unclassified | 765 |
| 30 | Ga0070714_100005531 | 3300005435 | Bacteria | 9649 |
| 31 | Ga0070714_100209508 | 3300005435 | Unclassified | 1786 |
| 32 | Ga0070714_100491788 | 3300005435 | Bacteria | 1169 |
| 33 | Ga0070701_10239213 | 3300005438 | Bacteria | 1091 |
| 34 | Ga0070701_10566648 | 3300005438 | Bacteria | 747 |
| 35 | Ga0070701_11012567 | 3300005438 | Unclassified | 580 |
| 36 | Ga0070705_100055886 | 3300005440 | Bacteria | 2322 |
| 37 | Ga0070705_101623359 | 3300005440 | Unclassified | 545 |
| 38 | Ga0070700_100008636 | 3300005441 | Bacteria | 5553 |
| 39 | Ga0070700_100558813 | 3300005441 | Bacteria | 890 |
| 40 | Ga0070700_100597232 | 3300005441 | Bacteria | 864 |
| 41 | Ga0070694_100408844 | 3300005444 | Bacteria | 1064 |
| 42 | Ga0068867_100254628 | 3300005459 | Bacteria | 1429 |
| 43 | Ga0070698_101026811 | 3300005471 | Bacteria | 772 |
| 44 | Ga0070699_101375692 | 3300005518 | Unclassified | 647 |
| 45 | Ga0070672_100192159 | 3300005543 | Bacteria | 1705 |
| 46 | Ga0070672_100674370 | 3300005543 | Bacteria | 904 |
| 47 | Ga0070672_102158379 | 3300005543 | Unclassified | 502 |
| 48 | Ga0070686_101724375 | 3300005544 | Unclassified | 532 |
| 49 | Ga0070695_100904479 | 3300005545 | Bacteria | 713 |
| 50 | Ga0070696_100057800 | 3300005546 | Bacteria | 2707 |
| 51 | Ga0070665_101426277 | 3300005548 | Unclassified | 701 |
| 52 | Ga0070665_101579418 | 3300005548 | Bacteria | 664 |
| 53 | Ga0070704_100341386 | 3300005549 | Bacteria | 1261 |
| 54 | Ga0070704_100896981 | 3300005549 | Unclassified | 797 |
| 55 | Ga0068855_100479867 | 3300005563 | Unclassified | 1353 |
| 56 | Ga0068855_102164125 | 3300005563 | Bacteria | 559 |
| 57 | Ga0070664_100103849 | 3300005564 | Archaea | 2474 |
| 58 | Ga0068854_100677433 | 3300005578 | Bacteria | 888 |
| 59 | Ga0068856_100336965 | 3300005614 | Unclassified | 1526 |
| 60 | Ga0070702_100516319 | 3300005615 | Unclassified | 880 |
| 61 | Ga0068859_102422268 | 3300005617 | Bacteria | 578 |
| 62 | Ga0068864_102162775 | 3300005618 | Bacteria | 563 |
| 63 | Ga0068861_100010652 | 3300005719 | Bacteria | 6385 |
| 64 | Ga0068861_100443976 | 3300005719 | Bacteria | 1161 |
| 65 | Ga0068861_101143122 | 3300005719 | Unclassified | 750 |
| 66 | Ga0068861_101360128 | 3300005719 | Bacteria | 692 |
| 67 | Ga0068861_101492025 | 3300005719 | Bacteria | 663 |
| 68 | Ga0068861_102554995 | 3300005719 | Unclassified | 514 |
| 69 | Ga0068863_100064197 | 3300005841 | Bacteria | 3473 |
| 70 | Ga0068860_100307052 | 3300005843 | Bacteria | 1555 |
| 71 | Ga0068860_101967982 | 3300005843 | Unclassified | 606 |
| 72 | Ga0068862_100281322 | 3300005844 | Bacteria | 1525 |
| 73 | Ga0068862_100876189 | 3300005844 | Bacteria | 881 |
| 74 | Ga0068862_102668238 | 3300005844 | Unclassified | 511 |
| 75 | Ga0068871_102085427 | 3300006358 | Bacteria | 540 |
| 76 | Ga0075431_100627133 | 3300006847 | Bacteria | 1057 |
| 77 | Ga0075429_101200676 | 3300006880 | Bacteria | 662 |
| 78 | Ga0068865_100867058 | 3300006881 | Unclassified | 783 |
| 79 | Ga0075436_101486196 | 3300006914 | Unclassified | 514 |
| 80 | Ga0097620_102421199 | 3300006931 | Bacteria | 578 |
| 81 | Ga0105240_10219420 | 3300009093 | Bacteria | 2216 |
| 82 | Ga0105240_10349270 | 3300009093 | Bacteria | 1678 |
| 83 | Ga0111539_10134807 | 3300009094 | Bacteria | 2892 |
| 84 | Ga0111539_12214467 | 3300009094 | Bacteria | 638 |
| 85 | Ga0105245_10000186 | 3300009098 | Bacteria | 58710 |
| 86 | Ga0105247_10231357 | 3300009101 | Bacteria | 1255 |
| 87 | Ga0105241_12464326 | 3300009174 | Unclassified | 520 |
| 88 | Ga0105248_10199076 | 3300009177 | Bacteria | 2257 |
| 89 | Ga0105248_10341786 | 3300009177 | Bacteria | 1685 |
| 90 | Ga0105248_13241137 | 3300009177 | Unclassified | 518 |
| 91 | Ga0105249_11043992 | 3300009553 | Bacteria | 887 |
| 92 | Ga0105246_10617049 | 3300011119 | Unclassified | 939 |
| 93 | Ga0157373_10296044 | 3300013100 | Unclassified | 1148 |
| 94 | Ga0157370_10088419 | 3300013104 | Unclassified | 2910 |
| 95 | Ga0157369_10300130 | 3300013105 | Bacteria | 1671 |
| 96 | Ga0157369_10349668 | 3300013105 | Bacteria | 1535 |
| 97 | Ga0157369_10775295 | 3300013105 | Bacteria | 986 |
| 98 | Ga0157369_12238662 | 3300013105 | Bacteria | 554 |
| 99 | Ga0157374_10117311 | 3300013296 | Bacteria | 2565 |
| 100 | Ga0157378_11468063 | 3300013297 | Bacteria | 726 |
| 101 | Ga0163162_10012824 | 3300013306 | Bacteria | 8186 |
| 102 | Ga0163162_12462268 | 3300013306 | Bacteria | 598 |
| 103 | Ga0163162_13280079 | 3300013306 | Unclassified | 518 |
| 104 | Ga0157372_10070680 | 3300013307 | Bacteria | 3928 |
| 105 | Ga0157372_10569695 | 3300013307 | Bacteria | 1320 |
| 106 | Ga0157372_10728313 | 3300013307 | Unclassified | 1153 |
| 107 | Ga0157372_10833415 | 3300013307 | Bacteria | 1071 |
| 108 | Ga0157375_10549189 | 3300013308 | Bacteria | 1317 |
| 109 | Ga0163163_12330557 | 3300014325 | Unclassified | 594 |
| 110 | Ga0157380_10188365 | 3300014326 | Bacteria | 1819 |
| 111 | Ga0157380_11801825 | 3300014326 | Bacteria | 671 |
| 112 | Ga0157377_10749684 | 3300014745 | Bacteria | 714 |
| 113 | Ga0207688_10924301 | 3300025901 | Unclassified | 552 |
| 114 | Ga0207680_10365805 | 3300025903 | Unclassified | 1015 |
| 115 | Ga0207645_10012483 | 3300025907 | Bacteria | 5761 |
| 116 | Ga0207707_10301103 | 3300025912 | Bacteria | 1386 |
| 117 | Ga0207695_10002596 | 3300025913 | Bacteria | 26488 |
| 118 | Ga0207695_10078005 | 3300025913 | Bacteria | 3362 |
| 119 | Ga0207660_10064674 | 3300025917 | Bacteria | 2641 |
| 120 | Ga0207662_10171225 | 3300025918 | Bacteria | 1392 |
| 121 | Ga0207662_10195724 | 3300025918 | Unclassified | 1306 |
| 122 | Ga0207662_11029190 | 3300025918 | Bacteria | 585 |
| 123 | Ga0207652_10064367 | 3300025921 | Bacteria | 3172 |
| 124 | Ga0207646_11753734 | 3300025922 | Bacteria | 532 |
| 125 | Ga0207681_10533289 | 3300025923 | Bacteria | 964 |
| 126 | Ga0207681_10569063 | 3300025923 | Unclassified | 934 |
| 127 | Ga0207681_11230765 | 3300025923 | Unclassified | 629 |
| 128 | Ga0207681_11378608 | 3300025923 | Bacteria | 592 |
| 129 | Ga0207650_10085863 | 3300025925 | Bacteria | 2395 |
| 130 | Ga0207650_10351112 | 3300025925 | Bacteria | 1213 |
| 131 | Ga0207659_10000080 | 3300025926 | Bacteria | 60332 |
| 132 | Ga0207659_10086616 | 3300025926 | Bacteria | 2330 |
| 133 | Ga0207659_10184500 | 3300025926 | Bacteria | 1655 |
| 134 | Ga0207659_10307353 | 3300025926 | Bacteria | 1304 |
| 135 | Ga0207659_10535023 | 3300025926 | Bacteria | 995 |
| 136 | Ga0207687_10000725 | 3300025927 | Bacteria | 22382 |
| 137 | Ga0207664_10139265 | 3300025929 | Bacteria | 2051 |
| 138 | Ga0207644_11722984 | 3300025931 | Bacteria | 525 |
| 139 | Ga0207690_11565081 | 3300025932 | Bacteria | 551 |
| 140 | Ga0207706_10474311 | 3300025933 | Unclassified | 1081 |
| 141 | Ga0207670_10539391 | 3300025936 | Unclassified | 952 |
| 142 | Ga0207670_10560061 | 3300025936 | Bacteria | 935 |
| 143 | Ga0207704_10934884 | 3300025938 | Unclassified | 731 |
| 144 | Ga0207691_10325922 | 3300025940 | Bacteria | 1316 |
| 145 | Ga0207711_11100516 | 3300025941 | Unclassified | 735 |
| 146 | Ga0207679_10599699 | 3300025945 | Unclassified | 992 |
| 147 | Ga0207667_10775555 | 3300025949 | Unclassified | 957 |
| 148 | Ga0207651_10364404 | 3300025960 | Bacteria | 1221 |
| 149 | Ga0207712_10858512 | 3300025961 | Unclassified | 800 |
| 150 | Ga0207712_10969983 | 3300025961 | Bacteria | 753 |
| 151 | Ga0207668_10955583 | 3300025972 | Unclassified | 764 |
| 152 | Ga0207640_12096271 | 3300025981 | Bacteria | 513 |
| 153 | Ga0207658_10328008 | 3300025986 | Bacteria | 1327 |
| 154 | Ga0207703_11584927 | 3300026035 | Unclassified | 630 |
| 155 | Ga0207708_10014645 | 3300026075 | Bacteria | 5869 |
| 156 | Ga0207708_11403761 | 3300026075 | Bacteria | 613 |
| 157 | Ga0207708_11649925 | 3300026075 | Unclassified | 563 |
| 158 | Ga0207641_10206350 | 3300026088 | Bacteria | 1815 |
| 159 | Ga0207648_10009113 | 3300026089 | Bacteria | 9540 |
| 160 | Ga0207676_10902261 | 3300026095 | Bacteria | 867 |
| 161 | Ga0207675_100057364 | 3300026118 | Bacteria | 3633 |
| 162 | Ga0207675_102231504 | 3300026118 | Bacteria | 562 |
| 163 | Ga0207675_102246058 | 3300026118 | Unclassified | 560 |
| 164 | Ga0207675_102420875 | 3300026118 | Bacteria | 537 |
| 165 | Ga0207683_11582622 | 3300026121 | Bacteria | 604 |
| 166 | Ga0207428_10051568 | 3300027907 | Bacteria | 3289 |
| 167 | Ga0268266_11180580 | 3300028379 | Unclassified | 740 |
| 168 | Ga0268266_11399026 | 3300028379 | Unclassified | 675 |
| 169 | Ga0268265_10299642 | 3300028380 | Bacteria | 1447 |
| 170 | Ga0268264_12042413 | 3300028381 | Unclassified | 582 |
| 171 | Ga0307405_10112084 | 3300031731 | Bacteria | 1850 |
| 172 | Ga0307413_10219256 | 3300031824 | Bacteria | 1388 |
| 173 | Ga0307410_10800768 | 3300031852 | Bacteria | 801 |
| 174 | Ga0307410_11555096 | 3300031852 | Unclassified | 584 |
| 175 | Ga0307406_11286758 | 3300031901 | Bacteria | 638 |
| 176 | Ga0307407_10733626 | 3300031903 | Bacteria | 747 |
| 177 | Ga0307412_10430358 | 3300031911 | Bacteria | 1082 |
| 178 | Ga0307412_10451284 | 3300031911 | Bacteria | 1059 |
| 179 | Ga0307409_100097276 | 3300031995 | Bacteria | 2431 |
| 180 | Ga0307409_100438292 | 3300031995 | Bacteria | 1258 |
| 181 | Ga0307409_100911798 | 3300031995 | Bacteria | 893 |
| 182 | Ga0307416_100078495 | 3300032002 | Bacteria | 2778 |
| 183 | Ga0307416_100147117 | 3300032002 | Bacteria | 2153 |
| 184 | Ga0307416_101356210 | 3300032002 | Bacteria | 817 |
| 185 | Ga0307416_101503610 | 3300032002 | Bacteria | 779 |
| 186 | Ga0307414_10167724 | 3300032004 | Bacteria | 1752 |
| 187 | Ga0307411_10080593 | 3300032005 | Bacteria | 2239 |
| 188 | Ga0307411_11551235 | 3300032005 | Bacteria | 610 |
| 189 | Ga0307415_100393894 | 3300032126 | Bacteria | 1180 |
| 190 | Ga0307415_100992870 | 3300032126 | Unclassified | 780 |
| 191 | Ga0373948_0006201 | 3300034817 | Bacteria | 1969 |
| 192 | Ga0373923_0254368 | 3300035111 | Bacteria | 823 |
| 193 | Ga0373956_0112575 | 3300035119 | Bacteria | 1268 |
| 194 | Ga0373937_0062585 | 3300036401 | Bacteria | 3421 |
| 195 | Ga0373937_0613493 | 3300036401 | Bacteria | 1033 |
| 196 | Ga0373925_1692137 | 3300037068 | Unclassified | 517 |
| 197 | Ga0451853_1202376 | 3300041512 | Bacteria | 736 |
| 198 | Ga0439435_0006464 | 3300042436 | Bacteria | 2635 |
| 199 | Ga0495592_0682072 | 3300046454 | Bacteria | 620 |
| 200 | Ga0495603_0403333 | 3300046455 | Unclassified | 784 |
| 201 | Ga0495629_0507920 | 3300046459 | Bacteria | 812 |
| 202 | Ga0495653_0513360 | 3300046463 | Bacteria | 746 |
| 203 | Ga0495639_0057532 | 3300046475 | Bacteria | 1777 |
| 204 | Ga0495618_0258664 | 3300046514 | Bacteria | 1090 |
| 205 | Ga0495618_0465544 | 3300046514 | Unclassified | 766 |
| 206 | Ga0495628_0727762 | 3300046516 | Bacteria | 699 |
| 207 | Ga0495640_0105522 | 3300046533 | Archaea | 1846 |
| 208 | Ga0495640_0448909 | 3300046533 | Bacteria | 788 |
| 209 | Ga0495587_0630982 | 3300046536 | Bacteria | 589 |
| 210 | Ga0495667_0169060 | 3300046559 | Bacteria | 1405 |
| 211 | Ga0495667_1001454 | 3300046559 | Unclassified | 510 |
| 212 | Ga0495634_0209552 | 3300046642 | Bacteria | 1207 |
| 213 | Ga0495635_0103169 | 3300046663 | Bacteria | 1949 |
| 214 | Ga0495635_0186516 | 3300046663 | Archaea | 1409 |
| 215 | Ga0495599_0599005 | 3300046678 | Bacteria | 642 |
| 216 | Ga0495658_0257363 | 3300046683 | Bacteria | 1098 |
| 217 | Ga0495613_0134204 | 3300046689 | Archaea | 1772 |
| 218 | Ga0495600_0749315 | 3300046809 | Bacteria | 585 |
| 219 | Ga0495581_0431691 | 3300047315 | Bacteria | 768 |
| 220 | Ga0495604_0046764 | 3300047317 | Bacteria | 3374 |
| 221 | Ga0495604_0101903 | 3300047317 | Bacteria | 2108 |
| 222 | Ga0495674_0861523 | 3300047319 | Unclassified | 701 |
| 223 | Ga0495674_1187984 | 3300047319 | Unclassified | 577 |
| 224 | Ga0495675_0206808 | 3300047444 | Bacteria | 1193 |
| 225 | Ga0495675_0791135 | 3300047444 | Unclassified | 526 |
| 226 | Ga0495684_0014303 | 3300047471 | Bacteria | 6109 |
| 227 | Ga0495684_0400449 | 3300047471 | Bacteria | 964 |
| 228 | Ga0495602_0274789 | 3300048088 | Bacteria | 1244 |
| 229 | Ga0501298_092819 | 3300049521 | Bacteria | 679 |
| 230 | Ga0501299_044676 | 3300049522 | Unclassified | 899 |
| 231 | Ga0501033_0121637 | 3300049570 | Bacteria | 1894 |
| 232 | Ga0501034_0014249 | 3300049571 | Bacteria | 8196 |
| 233 | Ga0501034_0303171 | 3300049571 | Bacteria | 1534 |
| 234 | Ga0501034_1559036 | 3300049571 | Bacteria | 534 |
| 235 | Ga0501036_0016068 | 3300049572 | Bacteria | 6254 |
| 236 | Ga0501037_0008278 | 3300049573 | Bacteria | 7624 |
| 237 | Ga0501037_0534297 | 3300049573 | Bacteria | 793 |
| 238 | Ga0501038_0098335 | 3300049574 | Bacteria | 2440 |
| 239 | Ga0501039_0268375 | 3300049575 | Bacteria | 1341 |
| 240 | Ga0501040_0001996 | 3300049576 | Bacteria | 13159 |
| 241 | Ga0501040_0183808 | 3300049576 | Bacteria | 1482 |
| 242 | Ga0501041_0005352 | 3300049577 | Bacteria | 7514 |
| 243 | Ga0501041_0248591 | 3300049577 | Unclassified | 1118 |
| 244 | Ga0501042_0129906 | 3300049578 | Bacteria | 1815 |
| 245 | Ga0501043_0021200 | 3300049579 | Bacteria | 5094 |
| 246 | Ga0501046_0122994 | 3300049580 | Bacteria | 1973 |
| 247 | Ga0501047_0012159 | 3300049581 | Bacteria | 8147 |
| 248 | Ga0501047_0056381 | 3300049581 | Bacteria | 3799 |
| 249 | Ga0501047_0170649 | 3300049581 | Bacteria | 2044 |
| 250 | Ga0501048_0643017 | 3300049582 | Archaea | 761 |
| 251 | Ga0501048_1281586 | 3300049582 | Unclassified | 527 |
| 252 | Ga0501068_0074502 | 3300049584 | Bacteria | 2075 |
| 253 | Ga0501070_0073955 | 3300049586 | Bacteria | 2820 |
| 254 | Ga0501070_0074219 | 3300049586 | Bacteria | 2816 |
| 255 | Ga0501070_0109436 | 3300049586 | Bacteria | 2283 |
| 256 | Ga0501070_0821567 | 3300049586 | Unclassified | 729 |
| 257 | Ga0501070_1029036 | 3300049586 | Bacteria | 638 |
| 258 | Ga0501072_0113786 | 3300049588 | Bacteria | 2154 |
| 259 | Ga0501074_0059480 | 3300049590 | Bacteria | 2753 |
| 260 | Ga0501074_0060969 | 3300049590 | Bacteria | 2718 |
| 261 | Ga0501074_0075855 | 3300049590 | Bacteria | 2414 |
| 262 | Ga0501074_0918817 | 3300049590 | Unclassified | 616 |
| 263 | Ga0501075_0003616 | 3300049591 | Bacteria | 10368 |
| 264 | Ga0501075_0071624 | 3300049591 | Bacteria | 2620 |
| 265 | Ga0501075_1517497 | 3300049591 | Unclassified | 507 |
| 266 | Ga0501076_0000714 | 3300049592 | Bacteria | 21429 |
| 267 | Ga0501076_0005455 | 3300049592 | Bacteria | 9152 |
| 268 | Ga0501077_0349552 | 3300049593 | Unclassified | 943 |
| 269 | Ga0501077_0680747 | 3300049593 | Unclassified | 661 |
| 270 | Ga0501207_070610 | 3300049654 | Bacteria | 655 |
| 271 | Ga0501235_151274 | 3300049669 | Bacteria | 601 |
| 272 | Ga0501079_0011475 | 3300049741 | Bacteria | 6763 |
| 273 | Ga0501080_0060052 | 3300049742 | Bacteria | 3538 |
| 274 | Ga0501080_0071633 | 3300049742 | Bacteria | 3224 |
| 275 | Ga0501080_0226803 | 3300049742 | Bacteria | 1708 |
| 276 | Ga0501081_0008125 | 3300049743 | Bacteria | 6811 |
| 277 | Ga0501081_0016525 | 3300049743 | Bacteria | 4879 |
| 278 | Ga0501081_0937335 | 3300049743 | Unclassified | 653 |
| 279 | Ga0501083_0076218 | 3300049744 | Bacteria | 2226 |
| 280 | Ga0501035_0084836 | 3300049822 | Bacteria | 2793 |
| 281 | Ga0501035_0455860 | 3300049822 | Unclassified | 1057 |
| 282 | Ga0501044_0000230 | 3300049823 | Bacteria | 70210 |
| 283 | Ga0501044_0005183 | 3300049823 | Bacteria | 14507 |
| 284 | Ga0501044_0009239 | 3300049823 | Bacteria | 10766 |
| 285 | Ga0501045_0037192 | 3300049824 | Bacteria | 3538 |
| 286 | Ga0501045_0056715 | 3300049824 | Bacteria | 2865 |
| 287 | nmdc:mga03683_389467_c1 | 3300050489 | Bacteria | 664 |
| 288 | nmdc:mga0yw44_1217540_c1 | 3300050492 | Bacteria | 508 |
| 289 | nmdc:mga0qj67_350395_c1 | 3300050509 | Bacteria | 1194 |
| 290 | nmdc:mga06r32_375132_c1 | 3300050510 | Bacteria | 1405 |
| 291 | Ga0495601_0413770 | 3300053077 | Bacteria | 873 |
| 292 | Ga0495619_0061619 | 3300053085 | Bacteria | 2496 |
| 293 | Ga0495619_0117599 | 3300053085 | Bacteria | 1821 |
| 294 | Ga0495619_0562063 | 3300053085 | Bacteria | 782 |
| 295 | Ga0501084_0021649 | 3300054114 | Bacteria | 5360 |
| 296 | Ga0501084_0128502 | 3300054114 | Bacteria | 2133 |
| 297 | Ga0501084_0627401 | 3300054114 | Bacteria | 908 |
| 298 | Ga0501084_1107097 | 3300054114 | Bacteria | 665 |
| 299 | Ga0590071_159303 | 3300059421 | Unclassified | 587 |
| 300 | Ga0590075_209076 | 3300059424 | Unclassified | 517 |
| 301 | Ga0501082_0033801 | 3300060353 | Bacteria | 4410 |
| 302 | Ga0501082_0059943 | 3300060353 | Bacteria | 3279 |
| 303 | Ga0530510_0010870 | 3300061734 | Bacteria | 6386 |
| 304 | Ga0530510_0315915 | 3300061734 | Bacteria | 1170 |
| 305 | Ga0530510_0881230 | 3300061734 | Unclassified | 684 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0507920 | Ga0495629_0507920_282_491 | 69 |
| 2 | 3300046516 | Ga0495628_0727762 | Ga0495628_0727762_357_566 | 69 |
| 3 | 3300046533 | Ga0495640_0448909 | Ga0495640_0448909_531_740 | 69 |
| 4 | 3300046663 | Ga0495635_0103169 | Ga0495635_0103169_576_785 | 69 |
| 5 | 3300046809 | Ga0495600_0749315 | Ga0495600_0749315_355_564 | 69 |
| 6 | 3300047315 | Ga0495581_0431691 | Ga0495581_0431691_43_252 | 69 |
| 7 | 3300047317 | Ga0495604_0046764 | Ga0495604_0046764_160_369 | 69 |
| 8 | 3300047317 | Ga0495604_0101903 | Ga0495604_0101903_1230_1439 | 69 |
| 9 | 3300048088 | Ga0495602_0274789 | Ga0495602_0274789_322_531 | 69 |
| 10 | 3300053085 | Ga0495619_0117599 | Ga0495619_0117599_1034_1243 | 69 |
| 11 | 3300013297 | Ga0157378_11468063 | Ga0157378_114680632 | 70 |
| 12 | 3300041512 | Ga0451853_1202376 | Ga0451853_1202376_243_458 | 70 |
| 13 | 3300025912 | Ga0207707_10301103 | Ga0207707_103011032 | 71 |
| 14 | 3300025917 | Ga0207660_10064674 | Ga0207660_100646742 | 71 |
| 15 | 3300025921 | Ga0207652_10064367 | Ga0207652_100643674 | 71 |
| 16 | 3300037068 | Ga0373925_1692137 | Ga0373925_1692137_203_418 | 71 |
| 17 | 3300046454 | Ga0495592_0682072 | Ga0495592_0682072_393_608 | 71 |
| 18 | 3300046536 | Ga0495587_0630982 | Ga0495587_0630982_296_511 | 71 |
| 19 | 3300049571 | Ga0501034_0303171 | Ga0501034_0303171_693_911 | 71 |
| 20 | iso_pu_bacteria | 2687453257 | 2688067626 | 71 |
| 21 | 3300006847 | Ga0075431_100627133 | Ga0075431_1006271332 | 72 |
| 22 | 3300026121 | Ga0207683_11582622 | Ga0207683_115826222 | 72 |
| 23 | 3300050510 | nmdc:mga06r32_375132_c1 | nmdc:mga06r32_375132_c1_1152_1388 | 72 |
| 24 | 3300005365 | Ga0070688_100935807 | Ga0070688_1009358072 | 73 |
| 25 | 3300005438 | Ga0070701_10566648 | Ga0070701_105666481 | 73 |
| 26 | 3300005441 | Ga0070700_100558813 | Ga0070700_1005588132 | 73 |
| 27 | 3300005617 | Ga0068859_102422268 | Ga0068859_1024222682 | 73 |
| 28 | 3300005618 | Ga0068864_102162775 | Ga0068864_1021627751 | 73 |
| 29 | 3300005719 | Ga0068861_102554995 | Ga0068861_1025549952 | 73 |
| 30 | 3300005844 | Ga0068862_100876189 | Ga0068862_1008761892 | 73 |
| 31 | 3300006931 | Ga0097620_102421199 | Ga0097620_1024211992 | 73 |
| 32 | 3300025926 | Ga0207659_10184500 | Ga0207659_101845003 | 73 |
| 33 | 3300026118 | Ga0207675_102246058 | Ga0207675_1022460582 | 73 |
| 34 | 3300049581 | Ga0501047_0012159 | Ga0501047_0012159_2875_3096 | 73 |
| 35 | 3300049581 | Ga0501047_0056381 | Ga0501047_0056381_683_913 | 73 |
| 36 | 3300049586 | Ga0501070_0073955 | Ga0501070_0073955_1783_2013 | 73 |
| 37 | 3300049586 | Ga0501070_0074219 | Ga0501070_0074219_896_1117 | 73 |
| 38 | 3300049590 | Ga0501074_0075855 | Ga0501074_0075855_998_1219 | 73 |
| 39 | 3300049593 | Ga0501077_0680747 | Ga0501077_0680747_17_238 | 73 |
| 40 | 3300049823 | Ga0501044_0000230 | Ga0501044_0000230_34528_34758 | 73 |
| 41 | 3300009098 | Ga0105245_10000186 | Ga0105245_100001865 | 74 |
| 42 | 3300013306 | Ga0163162_10012824 | Ga0163162_100128244 | 74 |
| 43 | 3300025927 | Ga0207687_10000725 | Ga0207687_1000072515 | 74 |
| 44 | 3300026075 | Ga0207708_11403761 | Ga0207708_114037611 | 74 |
| 45 | 3300049521 | Ga0501298_092819 | Ga0501298_092819_330_554 | 74 |
| 46 | 3300049586 | Ga0501070_1029036 | Ga0501070_1029036_103_330 | 74 |
| 47 | 3300050489 | nmdc:mga03683_389467_c1 | nmdc:mga03683_389467_c1_145_369 | 74 |
| 48 | 3300050492 | nmdc:mga0yw44_1217540_c1 | nmdc:mga0yw44_1217540_c1_220_444 | 74 |
| 49 | 3300050509 | nmdc:mga0qj67_350395_c1 | nmdc:mga0qj67_350395_c1_777_1001 | 74 |
| 50 | 3300005544 | Ga0070686_101724375 | Ga0070686_1017243751 | 76 |
| 51 | 3300006358 | Ga0068871_102085427 | Ga0068871_1020854272 | 76 |
| 52 | 3300049582 | Ga0501048_1281586 | Ga0501048_1281586_83_313 | 76 |
| 53 | 3300049591 | Ga0501075_1517497 | Ga0501075_1517497_36_266 | 76 |
| 54 | 3300049743 | Ga0501081_0937335 | Ga0501081_0937335_265_495 | 76 |
| 55 | 3300054114 | Ga0501084_0627401 | Ga0501084_0627401_433_663 | 76 |
| 56 | 3300059421 | Ga0590071_159303 | Ga0590071_159303_160_390 | 76 |
| 57 | 3300061734 | Ga0530510_0881230 | Ga0530510_0881230_188_418 | 76 |
| 58 | 3300005353 | Ga0070669_101799429 | Ga0070669_1017994292 | 77 |
| 59 | 3300005440 | Ga0070705_101623359 | Ga0070705_1016233591 | 77 |
| 60 | 3300005441 | Ga0070700_100597232 | Ga0070700_1005972322 | 77 |
| 61 | 3300011119 | Ga0105246_10617049 | Ga0105246_106170492 | 77 |
| 62 | 3300031824 | Ga0307413_10219256 | Ga0307413_102192563 | 77 |
| 63 | 3300031852 | Ga0307410_11555096 | Ga0307410_115550962 | 77 |
| 64 | 3300031901 | Ga0307406_11286758 | Ga0307406_112867582 | 77 |
| 65 | 3300031911 | Ga0307412_10430358 | Ga0307412_104303582 | 77 |
| 66 | 3300031995 | Ga0307409_100097276 | Ga0307409_1000972762 | 77 |
| 67 | 3300032002 | Ga0307416_100147117 | Ga0307416_1001471175 | 77 |
| 68 | 2162886012 | MBSR1b_contig_3325057 | MBSR1b_0843.00001770 | 78 |
| 69 | 3300005295 | Ga0065707_10472318 | Ga0065707_104723181 | 78 |
| 70 | 3300005295 | Ga0065707_11069021 | Ga0065707_110690212 | 78 |
| 71 | 3300005331 | Ga0070670_100129959 | Ga0070670_1001299592 | 78 |
| 72 | 3300005331 | Ga0070670_100441771 | Ga0070670_1004417711 | 78 |
| 73 | 3300005331 | Ga0070670_100606332 | Ga0070670_1006063322 | 78 |
| 74 | 3300005335 | Ga0070666_10212539 | Ga0070666_102125392 | 78 |
| 75 | 3300005340 | Ga0070689_100642858 | Ga0070689_1006428582 | 78 |
| 76 | 3300005341 | Ga0070691_10001764 | Ga0070691_100017647 | 78 |
| 77 | 3300005343 | Ga0070687_100142294 | Ga0070687_1001422942 | 78 |
| 78 | 3300005347 | Ga0070668_100984747 | Ga0070668_1009847472 | 78 |
| 79 | 3300005353 | Ga0070669_100998199 | Ga0070669_1009981992 | 78 |
| 80 | 3300005353 | Ga0070669_101223678 | Ga0070669_1012236782 | 78 |
| 81 | 3300005353 | Ga0070669_101238654 | Ga0070669_1012386542 | 78 |
| 82 | 3300005353 | Ga0070669_101310349 | Ga0070669_1013103492 | 78 |
| 83 | 3300005354 | Ga0070675_100139050 | Ga0070675_1001390504 | 78 |
| 84 | 3300005354 | Ga0070675_100372718 | Ga0070675_1003727182 | 78 |
| 85 | 3300005354 | Ga0070675_100965272 | Ga0070675_1009652721 | 78 |
| 86 | 3300005354 | Ga0070675_101341865 | Ga0070675_1013418651 | 78 |
| 87 | 3300005355 | Ga0070671_100529420 | Ga0070671_1005294202 | 78 |
| 88 | 3300005355 | Ga0070671_100539166 | Ga0070671_1005391662 | 78 |
| 89 | 3300005355 | Ga0070671_101337324 | Ga0070671_1013373241 | 78 |
| 90 | 3300005356 | Ga0070674_101046733 | Ga0070674_1010467331 | 78 |
| 91 | 3300005364 | Ga0070673_100368892 | Ga0070673_1003688922 | 78 |
| 92 | 3300005366 | Ga0070659_101251398 | Ga0070659_1012513982 | 78 |
| 93 | 3300005367 | Ga0070667_100173051 | Ga0070667_1001730512 | 78 |
| 94 | 3300005367 | Ga0070667_101038588 | Ga0070667_1010385882 | 78 |
| 95 | 3300005435 | Ga0070714_100005531 | Ga0070714_1000055312 | 78 |
| 96 | 3300005435 | Ga0070714_100209508 | Ga0070714_1002095083 | 78 |
| 97 | 3300005435 | Ga0070714_100491788 | Ga0070714_1004917882 | 78 |
| 98 | 3300005438 | Ga0070701_10239213 | Ga0070701_102392132 | 78 |
| 99 | 3300005438 | Ga0070701_11012567 | Ga0070701_110125672 | 78 |
| 100 | 3300005440 | Ga0070705_100055886 | Ga0070705_1000558864 | 78 |
| 101 | 3300005441 | Ga0070700_100008636 | Ga0070700_1000086366 | 78 |
| 102 | 3300005444 | Ga0070694_100408844 | Ga0070694_1004088441 | 78 |
| 103 | 3300005459 | Ga0068867_100254628 | Ga0068867_1002546282 | 78 |
| 104 | 3300005471 | Ga0070698_101026811 | Ga0070698_1010268112 | 78 |
| 105 | 3300005518 | Ga0070699_101375692 | Ga0070699_1013756922 | 78 |
| 106 | 3300005543 | Ga0070672_100192159 | Ga0070672_1001921592 | 78 |
| 107 | 3300005543 | Ga0070672_100674370 | Ga0070672_1006743702 | 78 |
| 108 | 3300005543 | Ga0070672_102158379 | Ga0070672_1021583792 | 78 |
| 109 | 3300005545 | Ga0070695_100904479 | Ga0070695_1009044792 | 78 |
| 110 | 3300005546 | Ga0070696_100057800 | Ga0070696_1000578004 | 78 |
| 111 | 3300005548 | Ga0070665_101426277 | Ga0070665_1014262772 | 78 |
| 112 | 3300005548 | Ga0070665_101579418 | Ga0070665_1015794181 | 78 |
| 113 | 3300005549 | Ga0070704_100341386 | Ga0070704_1003413862 | 78 |
| 114 | 3300005549 | Ga0070704_100896981 | Ga0070704_1008969811 | 78 |
| 115 | 3300005563 | Ga0068855_100479867 | Ga0068855_1004798672 | 78 |
| 116 | 3300005563 | Ga0068855_102164125 | Ga0068855_1021641252 | 78 |
| 117 | 3300005564 | Ga0070664_100103849 | Ga0070664_1001038493 | 78 |
| 118 | 3300005578 | Ga0068854_100677433 | Ga0068854_1006774331 | 78 |
| 119 | 3300005614 | Ga0068856_100336965 | Ga0068856_1003369653 | 78 |
| 120 | 3300005615 | Ga0070702_100516319 | Ga0070702_1005163191 | 78 |
| 121 | 3300005719 | Ga0068861_100010652 | Ga0068861_1000106524 | 78 |
| 122 | 3300005719 | Ga0068861_100443976 | Ga0068861_1004439762 | 78 |
| 123 | 3300005719 | Ga0068861_101143122 | Ga0068861_1011431221 | 78 |
| 124 | 3300005719 | Ga0068861_101360128 | Ga0068861_1013601281 | 78 |
| 125 | 3300005719 | Ga0068861_101492025 | Ga0068861_1014920252 | 78 |
| 126 | 3300005841 | Ga0068863_100064197 | Ga0068863_1000641972 | 78 |
| 127 | 3300005843 | Ga0068860_100307052 | Ga0068860_1003070522 | 78 |
| 128 | 3300005843 | Ga0068860_101967982 | Ga0068860_1019679822 | 78 |
| 129 | 3300005844 | Ga0068862_100281322 | Ga0068862_1002813222 | 78 |
| 130 | 3300005844 | Ga0068862_102668238 | Ga0068862_1026682381 | 78 |
| 131 | 3300006880 | Ga0075429_101200676 | Ga0075429_1012006762 | 78 |
| 132 | 3300006881 | Ga0068865_100867058 | Ga0068865_1008670582 | 78 |
| 133 | 3300006914 | Ga0075436_101486196 | Ga0075436_1014861962 | 78 |
| 134 | 3300009093 | Ga0105240_10219420 | Ga0105240_102194203 | 78 |
| 135 | 3300009093 | Ga0105240_10349270 | Ga0105240_103492702 | 78 |
| 136 | 3300009094 | Ga0111539_10134807 | Ga0111539_101348071 | 78 |
| 137 | 3300009094 | Ga0111539_12214467 | Ga0111539_122144672 | 78 |
| 138 | 3300009101 | Ga0105247_10231357 | Ga0105247_102313572 | 78 |
| 139 | 3300009174 | Ga0105241_12464326 | Ga0105241_124643262 | 78 |
| 140 | 3300009177 | Ga0105248_10199076 | Ga0105248_101990762 | 78 |
| 141 | 3300009177 | Ga0105248_10341786 | Ga0105248_103417863 | 78 |
| 142 | 3300009177 | Ga0105248_13241137 | Ga0105248_132411372 | 78 |
| 143 | 3300009553 | Ga0105249_11043992 | Ga0105249_110439922 | 78 |
| 144 | 3300013100 | Ga0157373_10296044 | Ga0157373_102960442 | 78 |
| 145 | 3300013104 | Ga0157370_10088419 | Ga0157370_100884192 | 78 |
| 146 | 3300013105 | Ga0157369_10300130 | Ga0157369_103001302 | 78 |
| 147 | 3300013105 | Ga0157369_10349668 | Ga0157369_103496683 | 78 |
| 148 | 3300013105 | Ga0157369_10775295 | Ga0157369_107752952 | 78 |
| 149 | 3300013105 | Ga0157369_12238662 | Ga0157369_122386622 | 78 |
| 150 | 3300013296 | Ga0157374_10117311 | Ga0157374_101173114 | 78 |
| 151 | 3300013306 | Ga0163162_12462268 | Ga0163162_124622682 | 78 |
| 152 | 3300013306 | Ga0163162_13280079 | Ga0163162_132800791 | 78 |
| 153 | 3300013307 | Ga0157372_10070680 | Ga0157372_100706804 | 78 |
| 154 | 3300013307 | Ga0157372_10569695 | Ga0157372_105696952 | 78 |
| 155 | 3300013307 | Ga0157372_10728313 | Ga0157372_107283132 | 78 |
| 156 | 3300013307 | Ga0157372_10833415 | Ga0157372_108334152 | 78 |
| 157 | 3300013308 | Ga0157375_10549189 | Ga0157375_105491892 | 78 |
| 158 | 3300014325 | Ga0163163_12330557 | Ga0163163_123305572 | 78 |
| 159 | 3300014326 | Ga0157380_10188365 | Ga0157380_101883652 | 78 |
| 160 | 3300014326 | Ga0157380_11801825 | Ga0157380_118018252 | 78 |
| 161 | 3300014745 | Ga0157377_10749684 | Ga0157377_107496842 | 78 |
| 162 | 3300025901 | Ga0207688_10924301 | Ga0207688_109243012 | 78 |
| 163 | 3300025903 | Ga0207680_10365805 | Ga0207680_103658052 | 78 |
| 164 | 3300025907 | Ga0207645_10012483 | Ga0207645_100124834 | 78 |
| 165 | 3300025913 | Ga0207695_10002596 | Ga0207695_1000259622 | 78 |
| 166 | 3300025913 | Ga0207695_10078005 | Ga0207695_100780054 | 78 |
| 167 | 3300025918 | Ga0207662_10171225 | Ga0207662_101712252 | 78 |
| 168 | 3300025918 | Ga0207662_10195724 | Ga0207662_101957242 | 78 |
| 169 | 3300025918 | Ga0207662_11029190 | Ga0207662_110291901 | 78 |
| 170 | 3300025922 | Ga0207646_11753734 | Ga0207646_117537342 | 78 |
| 171 | 3300025923 | Ga0207681_10533289 | Ga0207681_105332892 | 78 |
| 172 | 3300025923 | Ga0207681_10569063 | Ga0207681_105690631 | 78 |
| 173 | 3300025923 | Ga0207681_11230765 | Ga0207681_112307651 | 78 |
| 174 | 3300025923 | Ga0207681_11378608 | Ga0207681_113786082 | 78 |
| 175 | 3300025925 | Ga0207650_10085863 | Ga0207650_100858632 | 78 |
| 176 | 3300025925 | Ga0207650_10351112 | Ga0207650_103511122 | 78 |
| 177 | 3300025926 | Ga0207659_10000080 | Ga0207659_1000008042 | 78 |
| 178 | 3300025926 | Ga0207659_10086616 | Ga0207659_100866162 | 78 |
| 179 | 3300025926 | Ga0207659_10307353 | Ga0207659_103073532 | 78 |
| 180 | 3300025926 | Ga0207659_10535023 | Ga0207659_105350232 | 78 |
| 181 | 3300025929 | Ga0207664_10139265 | Ga0207664_101392654 | 78 |
| 182 | 3300025931 | Ga0207644_11722984 | Ga0207644_117229842 | 78 |
| 183 | 3300025932 | Ga0207690_11565081 | Ga0207690_115650812 | 78 |
| 184 | 3300025933 | Ga0207706_10474311 | Ga0207706_104743112 | 78 |
| 185 | 3300025936 | Ga0207670_10539391 | Ga0207670_105393912 | 78 |
| 186 | 3300025936 | Ga0207670_10560061 | Ga0207670_105600612 | 78 |
| 187 | 3300025938 | Ga0207704_10934884 | Ga0207704_109348841 | 78 |
| 188 | 3300025940 | Ga0207691_10325922 | Ga0207691_103259223 | 78 |
| 189 | 3300025941 | Ga0207711_11100516 | Ga0207711_111005162 | 78 |
| 190 | 3300025945 | Ga0207679_10599699 | Ga0207679_105996992 | 78 |
| 191 | 3300025949 | Ga0207667_10775555 | Ga0207667_107755552 | 78 |
| 192 | 3300025960 | Ga0207651_10364404 | Ga0207651_103644042 | 78 |
| 193 | 3300025961 | Ga0207712_10858512 | Ga0207712_108585122 | 78 |
| 194 | 3300025961 | Ga0207712_10969983 | Ga0207712_109699832 | 78 |
| 195 | 3300025972 | Ga0207668_10955583 | Ga0207668_109555831 | 78 |
| 196 | 3300025981 | Ga0207640_12096271 | Ga0207640_120962712 | 78 |
| 197 | 3300025986 | Ga0207658_10328008 | Ga0207658_103280082 | 78 |
| 198 | 3300026035 | Ga0207703_11584927 | Ga0207703_115849272 | 78 |
| 199 | 3300026075 | Ga0207708_10014645 | Ga0207708_100146456 | 78 |
| 200 | 3300026075 | Ga0207708_11649925 | Ga0207708_116499252 | 78 |
| 201 | 3300026088 | Ga0207641_10206350 | Ga0207641_102063502 | 78 |
| 202 | 3300026089 | Ga0207648_10009113 | Ga0207648_100091139 | 78 |
| 203 | 3300026095 | Ga0207676_10902261 | Ga0207676_109022611 | 78 |
| 204 | 3300026118 | Ga0207675_100057364 | Ga0207675_1000573644 | 78 |
| 205 | 3300026118 | Ga0207675_102231504 | Ga0207675_1022315042 | 78 |
| 206 | 3300026118 | Ga0207675_102420875 | Ga0207675_1024208751 | 78 |
| 207 | 3300027907 | Ga0207428_10051568 | Ga0207428_100515684 | 78 |
| 208 | 3300028379 | Ga0268266_11180580 | Ga0268266_111805802 | 78 |
| 209 | 3300028379 | Ga0268266_11399026 | Ga0268266_113990261 | 78 |
| 210 | 3300028380 | Ga0268265_10299642 | Ga0268265_102996422 | 78 |
| 211 | 3300028381 | Ga0268264_12042413 | Ga0268264_120424131 | 78 |
| 212 | 3300031731 | Ga0307405_10112084 | Ga0307405_101120842 | 78 |
| 213 | 3300031852 | Ga0307410_10800768 | Ga0307410_108007682 | 78 |
| 214 | 3300031903 | Ga0307407_10733626 | Ga0307407_107336262 | 78 |
| 215 | 3300031911 | Ga0307412_10451284 | Ga0307412_104512842 | 78 |
| 216 | 3300031995 | Ga0307409_100438292 | Ga0307409_1004382923 | 78 |
| 217 | 3300031995 | Ga0307409_100911798 | Ga0307409_1009117982 | 78 |
| 218 | 3300032002 | Ga0307416_100078495 | Ga0307416_1000784952 | 78 |
| 219 | 3300032002 | Ga0307416_101356210 | Ga0307416_1013562102 | 78 |
| 220 | 3300032002 | Ga0307416_101503610 | Ga0307416_1015036102 | 78 |
| 221 | 3300032004 | Ga0307414_10167724 | Ga0307414_101677243 | 78 |
| 222 | 3300032005 | Ga0307411_10080593 | Ga0307411_100805934 | 78 |
| 223 | 3300032005 | Ga0307411_11551235 | Ga0307411_115512352 | 78 |
| 224 | 3300032126 | Ga0307415_100393894 | Ga0307415_1003938942 | 78 |
| 225 | 3300032126 | Ga0307415_100992870 | Ga0307415_1009928702 | 78 |
| 226 | 3300034817 | Ga0373948_0006201 | Ga0373948_0006201_114_350 | 78 |
| 227 | 3300035111 | Ga0373923_0254368 | Ga0373923_0254368_537_785 | 78 |
| 228 | 3300035119 | Ga0373956_0112575 | Ga0373956_0112575_182_424 | 78 |
| 229 | 3300036401 | Ga0373937_0062585 | Ga0373937_0062585_2126_2374 | 78 |
| 230 | 3300036401 | Ga0373937_0613493 | Ga0373937_0613493_228_470 | 78 |
| 231 | 3300042436 | Ga0439435_0006464 | Ga0439435_0006464_1536_1772 | 78 |
| 232 | 3300046455 | Ga0495603_0403333 | Ga0495603_0403333_96_332 | 78 |
| 233 | 3300046463 | Ga0495653_0513360 | Ga0495653_0513360_308_550 | 78 |
| 234 | 3300046475 | Ga0495639_0057532 | Ga0495639_0057532_539_781 | 78 |
| 235 | 3300046514 | Ga0495618_0258664 | Ga0495618_0258664_710_958 | 78 |
| 236 | 3300046514 | Ga0495618_0465544 | Ga0495618_0465544_54_296 | 78 |
| 237 | 3300046533 | Ga0495640_0105522 | Ga0495640_0105522_393_635 | 78 |
| 238 | 3300046559 | Ga0495667_0169060 | Ga0495667_0169060_423_671 | 78 |
| 239 | 3300046559 | Ga0495667_1001454 | Ga0495667_1001454_170_412 | 78 |
| 240 | 3300046642 | Ga0495634_0209552 | Ga0495634_0209552_376_624 | 78 |
| 241 | 3300046663 | Ga0495635_0186516 | Ga0495635_0186516_941_1183 | 78 |
| 242 | 3300046678 | Ga0495599_0599005 | Ga0495599_0599005_142_378 | 78 |
| 243 | 3300046683 | Ga0495658_0257363 | Ga0495658_0257363_661_903 | 78 |
| 244 | 3300046689 | Ga0495613_0134204 | Ga0495613_0134204_864_1100 | 78 |
| 245 | 3300047319 | Ga0495674_0861523 | Ga0495674_0861523_378_620 | 78 |
| 246 | 3300047319 | Ga0495674_1187984 | Ga0495674_1187984_101_349 | 78 |
| 247 | 3300047444 | Ga0495675_0206808 | Ga0495675_0206808_69_317 | 78 |
| 248 | 3300047444 | Ga0495675_0791135 | Ga0495675_0791135_140_382 | 78 |
| 249 | 3300047471 | Ga0495684_0014303 | Ga0495684_0014303_1819_2067 | 78 |
| 250 | 3300047471 | Ga0495684_0400449 | Ga0495684_0400449_407_643 | 78 |
| 251 | 3300049522 | Ga0501299_044676 | Ga0501299_044676_651_887 | 78 |
| 252 | 3300049570 | Ga0501033_0121637 | Ga0501033_0121637_980_1216 | 78 |
| 253 | 3300049571 | Ga0501034_0014249 | Ga0501034_0014249_6245_6481 | 78 |
| 254 | 3300049571 | Ga0501034_1559036 | Ga0501034_1559036_178_414 | 78 |
| 255 | 3300049572 | Ga0501036_0016068 | Ga0501036_0016068_4944_5180 | 78 |
| 256 | 3300049573 | Ga0501037_0008278 | Ga0501037_0008278_590_826 | 78 |
| 257 | 3300049573 | Ga0501037_0534297 | Ga0501037_0534297_101_337 | 78 |
| 258 | 3300049574 | Ga0501038_0098335 | Ga0501038_0098335_1762_1998 | 78 |
| 259 | 3300049575 | Ga0501039_0268375 | Ga0501039_0268375_884_1120 | 78 |
| 260 | 3300049576 | Ga0501040_0001996 | Ga0501040_0001996_5016_5252 | 78 |
| 261 | 3300049576 | Ga0501040_0183808 | Ga0501040_0183808_1176_1412 | 78 |
| 262 | 3300049577 | Ga0501041_0005352 | Ga0501041_0005352_4955_5191 | 78 |
| 263 | 3300049577 | Ga0501041_0248591 | Ga0501041_0248591_435_671 | 78 |
| 264 | 3300049578 | Ga0501042_0129906 | Ga0501042_0129906_140_376 | 78 |
| 265 | 3300049579 | Ga0501043_0021200 | Ga0501043_0021200_4191_4427 | 78 |
| 266 | 3300049580 | Ga0501046_0122994 | Ga0501046_0122994_271_507 | 78 |
| 267 | 3300049581 | Ga0501047_0170649 | Ga0501047_0170649_430_666 | 78 |
| 268 | 3300049582 | Ga0501048_0643017 | Ga0501048_0643017_449_685 | 78 |
| 269 | 3300049584 | Ga0501068_0074502 | Ga0501068_0074502_457_693 | 78 |
| 270 | 3300049586 | Ga0501070_0109436 | Ga0501070_0109436_1579_1815 | 78 |
| 271 | 3300049586 | Ga0501070_0821567 | Ga0501070_0821567_186_422 | 78 |
| 272 | 3300049588 | Ga0501072_0113786 | Ga0501072_0113786_1382_1618 | 78 |
| 273 | 3300049590 | Ga0501074_0059480 | Ga0501074_0059480_420_656 | 78 |
| 274 | 3300049590 | Ga0501074_0060969 | Ga0501074_0060969_180_416 | 78 |
| 275 | 3300049590 | Ga0501074_0918817 | Ga0501074_0918817_320_556 | 78 |
| 276 | 3300049591 | Ga0501075_0003616 | Ga0501075_0003616_9883_10119 | 78 |
| 277 | 3300049591 | Ga0501075_0071624 | Ga0501075_0071624_542_778 | 78 |
| 278 | 3300049592 | Ga0501076_0000714 | Ga0501076_0000714_18548_18784 | 78 |
| 279 | 3300049592 | Ga0501076_0005455 | Ga0501076_0005455_148_384 | 78 |
| 280 | 3300049593 | Ga0501077_0349552 | Ga0501077_0349552_501_737 | 78 |
| 281 | 3300049654 | Ga0501207_070610 | Ga0501207_070610_207_443 | 78 |
| 282 | 3300049669 | Ga0501235_151274 | Ga0501235_151274_315_551 | 78 |
| 283 | 3300049741 | Ga0501079_0011475 | Ga0501079_0011475_5078_5314 | 78 |
| 284 | 3300049742 | Ga0501080_0060052 | Ga0501080_0060052_1430_1666 | 78 |
| 285 | 3300049742 | Ga0501080_0071633 | Ga0501080_0071633_129_365 | 78 |
| 286 | 3300049742 | Ga0501080_0226803 | Ga0501080_0226803_482_718 | 78 |
| 287 | 3300049743 | Ga0501081_0008125 | Ga0501081_0008125_1440_1676 | 78 |
| 288 | 3300049743 | Ga0501081_0016525 | Ga0501081_0016525_59_295 | 78 |
| 289 | 3300049744 | Ga0501083_0076218 | Ga0501083_0076218_34_270 | 78 |
| 290 | 3300049822 | Ga0501035_0084836 | Ga0501035_0084836_1969_2205 | 78 |
| 291 | 3300049822 | Ga0501035_0455860 | Ga0501035_0455860_644_895 | 78 |
| 292 | 3300049823 | Ga0501044_0005183 | Ga0501044_0005183_12028_12264 | 78 |
| 293 | 3300049823 | Ga0501044_0009239 | Ga0501044_0009239_8724_8960 | 78 |
| 294 | 3300049824 | Ga0501045_0037192 | Ga0501045_0037192_2698_2934 | 78 |
| 295 | 3300049824 | Ga0501045_0056715 | Ga0501045_0056715_250_486 | 78 |
| 296 | 3300053077 | Ga0495601_0413770 | Ga0495601_0413770_279_521 | 78 |
| 297 | 3300053085 | Ga0495619_0061619 | Ga0495619_0061619_831_1073 | 78 |
| 298 | 3300053085 | Ga0495619_0562063 | Ga0495619_0562063_249_497 | 78 |
| 299 | 3300054114 | Ga0501084_0021649 | Ga0501084_0021649_3862_4098 | 78 |
| 300 | 3300054114 | Ga0501084_0128502 | Ga0501084_0128502_1285_1521 | 78 |
| 301 | 3300054114 | Ga0501084_1107097 | Ga0501084_1107097_238_474 | 78 |
| 302 | 3300059424 | Ga0590075_209076 | Ga0590075_209076_62_298 | 78 |
| 303 | 3300060353 | Ga0501082_0033801 | Ga0501082_0033801_2284_2520 | 78 |
| 304 | 3300060353 | Ga0501082_0059943 | Ga0501082_0059943_2169_2405 | 78 |
| 305 | 3300061734 | Ga0530510_0010870 | Ga0530510_0010870_790_1026 | 78 |
| 306 | 3300061734 | Ga0530510_0315915 | Ga0530510_0315915_30_266 | 78 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar