F399187

General Info

Members Datasets Scaffolds Average Seq Length
307 163 614 241

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10714171|Ga0157369_107141712
Length 260
Sequence LEFIVCKNYLFNIEKTIALNVNTSLFNLFLIDIETVPCFQGFEQLPDEFKILWADKISKTVPENLSLEDSYLLRAGILAEFGKIVCISAGYFYQNSNSEICIKVKSISGDDEKEILHNFIQIVNSFQKLNKSFQFAGHNIREFDIPYICRRLLINNIPLPSYLQIHGAKPWEIEMVDTLQWWKFGDYKNYISLDLLANVLNIPSSKGDMDGSKVRSVYYDDKDLERISCYCEKDVIVVANVILRFKNLPLLANECIQIVK

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
126 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
145 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
146 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
147 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
148 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
149 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
150 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
151 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
154 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
157 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
158 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
159 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
160 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
161 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
162 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
163 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 0
Isolates 1.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.4
Nodule 0
Rhizoplane 0.65
Rhizosphere 82.08
Stem 0
Stem Tuber 0
Unclassified 8.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10714171 3300013105 Bacteria 1032
2 SwRhRL2b_contig_439234 2162886007 Bacteria 1178
3 JGI24740J21852_10000816 3300001979 Bacteria 13719
4 JGI24740J21852_10009264 3300001979 Bacteria 3865
5 JGI24740J21852_10024868 3300001979 Bacteria 2025
6 JGI24739J22299_10042628 3300001989 Bacteria 1505
7 JGI25154J39366_1000047 3300002738 Bacteria 126449
8 JGI25406J46586_10005211 3300003203 Bacteria 6028
9 JGI25153J46596_10009659 3300003215 Bacteria 4445
10 JGI25153J46596_10019897 3300003215 Bacteria 2554
11 rootH2_10034930 3300003320 Bacteria 1143
12 rootL2_10125277 3300003322 Bacteria 2605
13 rootH1_10034612 3300003323 Bacteria 8257
14 rootH1_10068438 3300003323 Bacteria 6465
15 rootH1_10172534 3300003323 Unclassified 1716
16 rootH1_10299771 3300003323 Unclassified 1158
17 JGI25160J50197_1007207 3300003354 Bacteria 4379
18 Ga0055528_1000904 3300003790 Bacteria 20018
19 Ga0055530_10000546 3300003791 Bacteria 32621
20 Ga0065165_1000725 3300005262 Bacteria 46083
21 Ga0065704_10088793 3300005289 Bacteria 2910
22 Ga0065712_10141613 3300005290 Bacteria 1404
23 Ga0070658_10024095 3300005327 Bacteria 4883
24 Ga0070658_10083330 3300005327 Bacteria 2628
25 Ga0070658_10223133 3300005327 Bacteria 1594
26 Ga0070676_10121929 3300005328 Bacteria 1637
27 Ga0070683_100000327 3300005329 Bacteria 32861
28 Ga0070683_100027094 3300005329 Bacteria 5166
29 Ga0070683_100366148 3300005329 Bacteria 1373
30 Ga0070683_101112293 3300005329 Bacteria 759
31 Ga0070690_100006021 3300005330 Bacteria 6857
32 Ga0070670_100030358 3300005331 Bacteria 4655
33 Ga0070670_100134749 3300005331 Unclassified 2134
34 Ga0070670_100224954 3300005331 Unclassified 1633
35 Ga0068869_100115698 3300005334 Bacteria 2045
36 Ga0068869_100229211 3300005334 Bacteria 1475
37 Ga0070680_100024234 3300005336 Bacteria 4844
38 Ga0070680_100054334 3300005336 Bacteria 3270
39 Ga0070680_100110353 3300005336 Bacteria 2290
40 Ga0070680_100168093 3300005336 Bacteria 1845
41 Ga0070680_100289325 3300005336 Unclassified 1389
42 Ga0070682_100015674 3300005337 Bacteria 4395
43 Ga0070682_100109120 3300005337 Bacteria 1841
44 Ga0070682_100237906 3300005337 Bacteria 1306
45 Ga0070660_100003880 3300005339 Bacteria 10328
46 Ga0070660_100032247 3300005339 Bacteria 3941
47 Ga0070660_100046096 3300005339 Bacteria 3340
48 Ga0070660_100088518 3300005339 Bacteria 2438
49 Ga0070660_100325836 3300005339 Bacteria 1262
50 Ga0070668_100671414 3300005347 Bacteria 912
51 Ga0070675_100076369 3300005354 Bacteria 2786
52 Ga0070671_100119932 3300005355 Bacteria 2213
53 Ga0070671_100131737 3300005355 Bacteria 2106
54 Ga0070673_100337618 3300005364 Bacteria 1334
55 Ga0070688_100095871 3300005365 Bacteria 1948
56 Ga0070688_100510548 3300005365 Bacteria 908
57 Ga0070659_100002032 3300005366 Bacteria 14470
58 Ga0070659_100031680 3300005366 Bacteria 4096
59 Ga0070659_100343994 3300005366 Bacteria 1250
60 Ga0070667_100049143 3300005367 Bacteria 3552
61 Ga0070667_100361920 3300005367 Bacteria 1315
62 Ga0070663_100198044 3300005455 Bacteria 1566
63 Ga0070662_100162290 3300005457 Bacteria 1749
64 Ga0070681_10166661 3300005458 Bacteria 2126
65 Ga0070681_10320912 3300005458 Unclassified 1458
66 Ga0070681_10492967 3300005458 Bacteria 1138
67 Ga0070681_10777451 3300005458 Bacteria 874
68 Ga0068867_100015402 3300005459 Bacteria 5422
69 Ga0068867_100055277 3300005459 Unclassified 2935
70 Ga0068867_100099436 3300005459 Bacteria 2219
71 Ga0068867_100493930 3300005459 Bacteria 1051
72 Ga0070685_10321657 3300005466 Bacteria 1049
73 Ga0070679_100000684 3300005530 Bacteria 29020
74 Ga0070679_100014092 3300005530 Bacteria 7667
75 Ga0070679_100020995 3300005530 Bacteria 6372
76 Ga0070679_100267968 3300005530 Unclassified 1662
77 Ga0070679_100404523 3300005530 Bacteria 1311
78 Ga0070684_100025591 3300005535 Bacteria 4963
79 Ga0068853_100031032 3300005539 Bacteria 4518
80 Ga0068853_100063777 3300005539 Bacteria 3192
81 Ga0068853_100202059 3300005539 Bacteria 1809
82 Ga0068853_100559240 3300005539 Unclassified 1084
83 Ga0070672_100184586 3300005543 Bacteria 1739
84 Ga0070693_100120426 3300005547 Bacteria 1627
85 Ga0068855_100078189 3300005563 Bacteria 3838
86 Ga0068855_100130748 3300005563 Bacteria 2867
87 Ga0068855_100825857 3300005563 Bacteria 983
88 Ga0070664_100008438 3300005564 Bacteria 8332
89 Ga0068857_100134664 3300005577 Bacteria 2231
90 Ga0068857_100548902 3300005577 Unclassified 1088
91 Ga0068856_100094123 3300005614 Bacteria 2982
92 Ga0068856_100307811 3300005614 Bacteria 1602
93 Ga0068856_100463214 3300005614 Bacteria 1288
94 Ga0068856_100921135 3300005614 Bacteria 893
95 Ga0068852_100001739 3300005616 Bacteria 14830
96 Ga0068852_100070548 3300005616 Unclassified 3066
97 Ga0068852_100155665 3300005616 Bacteria 2129
98 Ga0068852_100291805 3300005616 Bacteria 1576
99 Ga0068852_100812277 3300005616 Bacteria 950
100 Ga0068859_100012921 3300005617 Bacteria 8389
101 Ga0068864_100060469 3300005618 Bacteria 3280
102 Ga0068864_100194141 3300005618 Bacteria 1862
103 Ga0068864_100341030 3300005618 Bacteria 1412
104 Ga0068861_100262445 3300005719 Unclassified 1479
105 Ga0068851_10010842 3300005834 Bacteria 4260
106 Ga0068863_100026579 3300005841 Bacteria 5520
107 Ga0068863_100500601 3300005841 Bacteria 1196
108 Ga0068860_100003819 3300005843 Bacteria 15494
109 Ga0068860_100313901 3300005843 Bacteria 1537
110 Ga0068862_100009911 3300005844 Bacteria 7870
111 Ga0081539_10000081 3300005985 Bacteria 222614
112 Ga0075366_10109303 3300006195 Bacteria 1663
113 Ga0097621_100013633 3300006237 Bacteria 6066
114 Ga0097621_100104152 3300006237 Bacteria 2390
115 Ga0097621_100136672 3300006237 Bacteria 2091
116 Ga0068871_100015477 3300006358 Bacteria 5710
117 Ga0068871_100065354 3300006358 Bacteria 2979
118 Ga0068871_100116347 3300006358 Bacteria 2254
119 Ga0068871_100416578 3300006358 Unclassified 1199
120 Ga0097620_100005656 3300006931 Bacteria 12725
121 Ga0097620_100012921 3300006931 Bacteria 8389
122 Ga0105241_10078340 3300009174 Bacteria 2582
123 Ga0105242_10607496 3300009176 Bacteria 1057
124 Ga0105242_10672714 3300009176 Bacteria 1009
125 Ga0105237_10032139 3300009545 Bacteria 5314
126 Ga0105237_10044181 3300009545 Unclassified 4486
127 Ga0105249_10449959 3300009553 Bacteria 1326
128 Ga0105239_10015250 3300010375 Bacteria 8515
129 Ga0105239_10094636 3300010375 Bacteria 3300
130 Ga0157373_10027592 3300013100 Bacteria 4097
131 Ga0157373_10061994 3300013100 Bacteria 2648
132 Ga0157373_10079048 3300013100 Bacteria 2320
133 Ga0157373_10254184 3300013100 Bacteria 1243
134 Ga0157371_10030858 3300013102 Bacteria 3863
135 Ga0157371_10033955 3300013102 Bacteria 3663
136 Ga0157371_10077024 3300013102 Bacteria 2362
137 Ga0157371_10086118 3300013102 Bacteria 2226
138 Ga0157371_10506958 3300013102 Bacteria 891
139 Ga0157370_10003146 3300013104 Bacteria 19553
140 Ga0157370_10374456 3300013104 Bacteria 1312
141 Ga0157370_10395900 3300013104 Bacteria 1272
142 Ga0157369_10043502 3300013105 Bacteria 4895
143 Ga0157369_10055692 3300013105 Bacteria 4268
144 Ga0157369_10212402 3300013105 Bacteria 2028
145 Ga0157369_10216009 3300013105 Bacteria 2008
146 Ga0157374_10022865 3300013296 Bacteria 5583
147 Ga0157374_10053256 3300013296 Bacteria 3772
148 Ga0157374_10114252 3300013296 Bacteria 2599
149 Ga0157378_10025749 3300013297 Bacteria 5182
150 Ga0157378_10039405 3300013297 Bacteria 4191
151 Ga0157378_10062010 3300013297 Bacteria 3338
152 Ga0157378_11034222 3300013297 Unclassified 857
153 Ga0163162_10035511 3300013306 Bacteria 4966
154 Ga0163162_10127950 3300013306 Bacteria 2647
155 Ga0163162_10174512 3300013306 Bacteria 2274
156 Ga0163162_10190048 3300013306 Bacteria 2181
157 Ga0163162_10493218 3300013306 Bacteria 1356
158 Ga0163162_10850516 3300013306 Bacteria 1027
159 Ga0157372_10037906 3300013307 Bacteria 5319
160 Ga0157372_10040705 3300013307 Bacteria 5134
161 Ga0157372_10054848 3300013307 Bacteria 4449
162 Ga0157372_10135298 3300013307 Bacteria 2838
163 Ga0157372_10152306 3300013307 Bacteria 2670
164 Ga0157372_10172387 3300013307 Bacteria 2503
165 Ga0157372_10220891 3300013307 Bacteria 2196
166 Ga0157372_10364206 3300013307 Unclassified 1685
167 Ga0157372_10645174 3300013307 Bacteria 1233
168 Ga0157375_10029693 3300013308 Bacteria 5145
169 Ga0157375_10111631 3300013308 Bacteria 2833
170 Ga0157375_10203858 3300013308 Unclassified 2134
171 Ga0157375_10254805 3300013308 Bacteria 1916
172 Ga0157375_11099585 3300013308 Unclassified 930
173 Ga0157375_11245777 3300013308 Bacteria 873
174 Ga0163163_10176660 3300014325 Bacteria 2182
175 Ga0157380_11053356 3300014326 Bacteria 850
176 Ga0157379_10113617 3300014968 Bacteria 2434
177 Ga0157376_10223679 3300014969 Bacteria 1745
178 Ga0157376_10247248 3300014969 Bacteria 1664
179 Ga0163161_10178760 3300017792 Bacteria 1626
180 Ga0213876_10003162 3300021384 Bacteria 9479
181 Ga0209646_1000003 3300025246 Bacteria 1160860
182 Ga0209673_1000194 3300025273 Bacteria 122640
183 Ga0209564_1008897 3300025295 Bacteria 4875
184 Ga0209564_1017216 3300025295 Bacteria 2829
185 Ga0209758_1010355 3300025297 Bacteria 5594
186 Ga0209758_1025083 3300025297 Bacteria 2628
187 Ga0209758_1025108 3300025297 Bacteria 2626
188 Ga0209050_1000658 3300025298 Bacteria 53407
189 Ga0207426_1000455 3300025302 Bacteria 64858
190 Ga0207426_1002176 3300025302 Bacteria 13256
191 Ga0209257_1000025 3300025304 Bacteria 724838
192 Ga0209257_1001487 3300025304 Bacteria 27514
193 Ga0207680_10215876 3300025903 Bacteria 1313
194 Ga0207685_10125865 3300025905 Bacteria 1131
195 Ga0207705_10033885 3300025909 Bacteria 3649
196 Ga0207705_10205891 3300025909 Bacteria 1491
197 Ga0207707_10181769 3300025912 Bacteria 1836
198 Ga0207707_10202307 3300025912 Bacteria 1731
199 Ga0207707_10254514 3300025912 Bacteria 1525
200 Ga0207695_10026373 3300025913 Bacteria 6486
201 Ga0207695_10374617 3300025913 Bacteria 1310
202 Ga0207671_10026197 3300025914 Bacteria 4371
203 Ga0207671_10117019 3300025914 Unclassified 2034
204 Ga0207660_10062612 3300025917 Bacteria 2680
205 Ga0207657_10006170 3300025919 Bacteria 12459
206 Ga0207657_10008795 3300025919 Bacteria 10215
207 Ga0207657_10028099 3300025919 Bacteria 5139
208 Ga0207657_10092057 3300025919 Bacteria 2527
209 Ga0207652_10048224 3300025921 Bacteria 3641
210 Ga0207650_10070219 3300025925 Bacteria 2632
211 Ga0207650_10093180 3300025925 Bacteria 2305
212 Ga0207659_10099172 3300025926 Bacteria 2192
213 Ga0207659_10491812 3300025926 Bacteria 1037
214 Ga0207644_10480713 3300025931 Bacteria 1023
215 Ga0207690_10026756 3300025932 Bacteria 3636
216 Ga0207690_10217680 3300025932 Bacteria 1459
217 Ga0207706_10076094 3300025933 Bacteria 2952
218 Ga0207670_10629063 3300025936 Bacteria 883
219 Ga0207691_10144944 3300025940 Bacteria 2091
220 Ga0207689_10132816 3300025942 Bacteria 2049
221 Ga0207689_10175792 3300025942 Bacteria 1765
222 Ga0207661_10077785 3300025944 Bacteria 2729
223 Ga0207679_10074756 3300025945 Bacteria 2568
224 Ga0207667_10136554 3300025949 Bacteria 2525
225 Ga0207667_10318464 3300025949 Bacteria 1588
226 Ga0207667_11135582 3300025949 Bacteria 763
227 Ga0207651_10331955 3300025960 Bacteria 1275
228 Ga0207651_10425315 3300025960 Bacteria 1135
229 Ga0207712_10417592 3300025961 Bacteria 1131
230 Ga0207640_10081805 3300025981 Bacteria 2209
231 Ga0207658_10195894 3300025986 Bacteria 1683
232 Ga0207677_10274994 3300026023 Bacteria 1380
233 Ga0207639_10004569 3300026041 Bacteria 9317
234 Ga0207639_10027319 3300026041 Bacteria 4157
235 Ga0207639_10084543 3300026041 Bacteria 2521
236 Ga0207639_10346043 3300026041 Bacteria 1326
237 Ga0207678_10324122 3300026067 Bacteria 1326
238 Ga0207702_10152478 3300026078 Bacteria 2103
239 Ga0207702_10320244 3300026078 Bacteria 1476
240 Ga0207648_10006815 3300026089 Bacteria 11321
241 Ga0207648_10068601 3300026089 Unclassified 3090
242 Ga0207648_10197486 3300026089 Bacteria 1784
243 Ga0207676_10025028 3300026095 Bacteria 4426
244 Ga0207676_10087035 3300026095 Bacteria 2554
245 Ga0207674_10022778 3300026116 Bacteria 6722
246 Ga0207674_10074667 3300026116 Bacteria 3402
247 Ga0207675_100312601 3300026118 Unclassified 1532
248 Ga0207675_100354682 3300026118 Unclassified 1438
249 Ga0207698_10015124 3300026142 Bacteria 5158
250 Ga0207698_10180484 3300026142 Bacteria 1869
251 Ga0207698_10181990 3300026142 Bacteria 1862
252 Ga0207698_10561375 3300026142 Bacteria 1120
253 Ga0207698_10781342 3300026142 Unclassified 956
254 Ga0268265_10013369 3300028380 Bacteria 5577
255 Ga0268264_10045801 3300028381 Bacteria 3633
256 Ga0268264_10307707 3300028381 Bacteria 1494
257 Ga0307515_10000001 3300028794 Bacteria 4259510
258 Ga0265327_10000115 3300031251 Bacteria 173854
259 Ga0265327_10076296 3300031251 Bacteria 1666
260 Ga0436365_0286889 3300039437 Unclassified 2610
261 Ga0436365_1093720 3300039437 Bacteria 31549
262 Ga0436365_1222761 3300039437 Bacteria 20026
263 Ga0439465_0020070 3300041413 Bacteria 2091
264 Ga0451849_1088020 3300041505 Bacteria 958
265 Ga0439431_0033136 3300041997 Bacteria 1290
266 Ga0466972_0000003 3300044658 Bacteria 391452
267 Ga0453684_0293938 3300044712 Bacteria 1848
268 Ga0466970_0010718 3300044765 Bacteria 4659
269 Ga0495627_008425 3300046453 Bacteria 3867
270 Ga0495622_0118258 3300046557 Bacteria 1211
271 Ga0495633_0000058 3300046558 Bacteria 147584
272 Ga0496101_0137225 3300048904 Bacteria 1862
273 Ga0496109_0562298 3300048912 Bacteria 1076
274 Ga0496126_0010428 3300048929 Bacteria 9739
275 Ga0501033_0155870 3300049570 Bacteria 1646
276 Ga0501034_0049158 3300049571 Bacteria 4256
277 Ga0501034_0576610 3300049571 Bacteria 1032
278 Ga0501037_0367167 3300049573 Unclassified 991
279 Ga0501073_0347503 3300049589 Bacteria 1024
280 Ga0501080_0103773 3300049742 Bacteria 2637
281 Ga0501241_000214 3300049758 Bacteria 13135
282 Ga0501044_0193871 3300049823 Bacteria 1993
283 Ga0501044_0317446 3300049823 Bacteria 1483
284 Ga0501044_0408475 3300049823 Bacteria 1269
285 nmdc:mga0k408_313652_c1 3300050493 Bacteria 936
286 nmdc:mga0k408_53338_c1 3300050493 Unclassified 2343
287 nmdc:mga07m45_53322_c1 3300050496 Bacteria 2284
288 Ga0500646_0006979 3300053090 Bacteria 2878
289 Ga0500646_0011446 3300053090 Bacteria 2283
290 Ga0500583_0007027 3300053092 Bacteria 3926
291 Ga0500660_106366 3300053100 Bacteria 1209
292 Ga0500569_000151 3300053109 Bacteria 11053
293 Ga0500652_002822 3300053131 Bacteria 5243
294 Ga0500658_0006392 3300053134 Bacteria 4372
295 Ga0500559_0013642 3300053136 Bacteria 3438
296 Ga0500568_0070896 3300053139 Bacteria 1334
297 Ga0500589_061417 3300053147 Bacteria 1721
298 Ga0500590_073566 3300053148 Bacteria 1693
299 Ga0500616_0007054 3300053153 Bacteria 7213
300 Ga0500636_0016069 3300053177 Bacteria 4410
301 Ga0500656_011975 3300053732 Bacteria 973
302 2896113645 2896109856 Bacteria 7140722
303 2929178947 2929177148 Bacteria 7883697
304 2929927192 2929921140 Bacteria 8649150
305 2945981353 2945977869 Bacteria 7777518
306 2946019248 2946013367 Bacteria 7766675
307 8003151068 8003151029 Bacteria 8187759
308 Ga0157369_10714171
309 SwRhRL2b_contig_439234
310 JGI24740J21852_10000816
311 JGI24740J21852_10009264
312 JGI24740J21852_10024868
313 JGI24739J22299_10042628
314 JGI25154J39366_1000047
315 JGI25406J46586_10005211
316 JGI25153J46596_10009659
317 JGI25153J46596_10019897
318 rootH2_10034930
319 rootL2_10125277
320 rootH1_10034612
321 rootH1_10068438
322 rootH1_10172534
323 rootH1_10299771
324 JGI25160J50197_1007207
325 Ga0055528_1000904
326 Ga0055530_10000546
327 Ga0065165_1000725
328 Ga0065704_10088793
329 Ga0065712_10141613
330 Ga0070658_10024095
331 Ga0070658_10083330
332 Ga0070658_10223133
333 Ga0070676_10121929
334 Ga0070683_100000327
335 Ga0070683_100027094
336 Ga0070683_100366148
337 Ga0070683_101112293
338 Ga0070690_100006021
339 Ga0070670_100030358
340 Ga0070670_100134749
341 Ga0070670_100224954
342 Ga0068869_100115698
343 Ga0068869_100229211
344 Ga0070680_100024234
345 Ga0070680_100054334
346 Ga0070680_100110353
347 Ga0070680_100168093
348 Ga0070680_100289325
349 Ga0070682_100015674
350 Ga0070682_100109120
351 Ga0070682_100237906
352 Ga0070660_100003880
353 Ga0070660_100032247
354 Ga0070660_100046096
355 Ga0070660_100088518
356 Ga0070660_100325836
357 Ga0070668_100671414
358 Ga0070675_100076369
359 Ga0070671_100119932
360 Ga0070671_100131737
361 Ga0070673_100337618
362 Ga0070688_100095871
363 Ga0070688_100510548
364 Ga0070659_100002032
365 Ga0070659_100031680
366 Ga0070659_100343994
367 Ga0070667_100049143
368 Ga0070667_100361920
369 Ga0070663_100198044
370 Ga0070662_100162290
371 Ga0070681_10166661
372 Ga0070681_10320912
373 Ga0070681_10492967
374 Ga0070681_10777451
375 Ga0068867_100015402
376 Ga0068867_100055277
377 Ga0068867_100099436
378 Ga0068867_100493930
379 Ga0070685_10321657
380 Ga0070679_100000684
381 Ga0070679_100014092
382 Ga0070679_100020995
383 Ga0070679_100267968
384 Ga0070679_100404523
385 Ga0070684_100025591
386 Ga0068853_100031032
387 Ga0068853_100063777
388 Ga0068853_100202059
389 Ga0068853_100559240
390 Ga0070672_100184586
391 Ga0070693_100120426
392 Ga0068855_100078189
393 Ga0068855_100130748
394 Ga0068855_100825857
395 Ga0070664_100008438
396 Ga0068857_100134664
397 Ga0068857_100548902
398 Ga0068856_100094123
399 Ga0068856_100307811
400 Ga0068856_100463214
401 Ga0068856_100921135
402 Ga0068852_100001739
403 Ga0068852_100070548
404 Ga0068852_100155665
405 Ga0068852_100291805
406 Ga0068852_100812277
407 Ga0068859_100012921
408 Ga0068864_100060469
409 Ga0068864_100194141
410 Ga0068864_100341030
411 Ga0068861_100262445
412 Ga0068851_10010842
413 Ga0068863_100026579
414 Ga0068863_100500601
415 Ga0068860_100003819
416 Ga0068860_100313901
417 Ga0068862_100009911
418 Ga0081539_10000081
419 Ga0075366_10109303
420 Ga0097621_100013633
421 Ga0097621_100104152
422 Ga0097621_100136672
423 Ga0068871_100015477
424 Ga0068871_100065354
425 Ga0068871_100116347
426 Ga0068871_100416578
427 Ga0097620_100005656
428 Ga0097620_100012921
429 Ga0105241_10078340
430 Ga0105242_10607496
431 Ga0105242_10672714
432 Ga0105237_10032139
433 Ga0105237_10044181
434 Ga0105249_10449959
435 Ga0105239_10015250
436 Ga0105239_10094636
437 Ga0157373_10027592
438 Ga0157373_10061994
439 Ga0157373_10079048
440 Ga0157373_10254184
441 Ga0157371_10030858
442 Ga0157371_10033955
443 Ga0157371_10077024
444 Ga0157371_10086118
445 Ga0157371_10506958
446 Ga0157370_10003146
447 Ga0157370_10374456
448 Ga0157370_10395900
449 Ga0157369_10043502
450 Ga0157369_10055692
451 Ga0157369_10212402
452 Ga0157369_10216009
453 Ga0157374_10022865
454 Ga0157374_10053256
455 Ga0157374_10114252
456 Ga0157378_10025749
457 Ga0157378_10039405
458 Ga0157378_10062010
459 Ga0157378_11034222
460 Ga0163162_10035511
461 Ga0163162_10127950
462 Ga0163162_10174512
463 Ga0163162_10190048
464 Ga0163162_10493218
465 Ga0163162_10850516
466 Ga0157372_10037906
467 Ga0157372_10040705
468 Ga0157372_10054848
469 Ga0157372_10135298
470 Ga0157372_10152306
471 Ga0157372_10172387
472 Ga0157372_10220891
473 Ga0157372_10364206
474 Ga0157372_10645174
475 Ga0157375_10029693
476 Ga0157375_10111631
477 Ga0157375_10203858
478 Ga0157375_10254805
479 Ga0157375_11099585
480 Ga0157375_11245777
481 Ga0163163_10176660
482 Ga0157380_11053356
483 Ga0157379_10113617
484 Ga0157376_10223679
485 Ga0157376_10247248
486 Ga0163161_10178760
487 Ga0213876_10003162
488 Ga0209646_1000003
489 Ga0209673_1000194
490 Ga0209564_1008897
491 Ga0209564_1017216
492 Ga0209758_1010355
493 Ga0209758_1025083
494 Ga0209758_1025108
495 Ga0209050_1000658
496 Ga0207426_1000455
497 Ga0207426_1002176
498 Ga0209257_1000025
499 Ga0209257_1001487
500 Ga0207680_10215876
501 Ga0207685_10125865
502 Ga0207705_10033885
503 Ga0207705_10205891
504 Ga0207707_10181769
505 Ga0207707_10202307
506 Ga0207707_10254514
507 Ga0207695_10026373
508 Ga0207695_10374617
509 Ga0207671_10026197
510 Ga0207671_10117019
511 Ga0207660_10062612
512 Ga0207657_10006170
513 Ga0207657_10008795
514 Ga0207657_10028099
515 Ga0207657_10092057
516 Ga0207652_10048224
517 Ga0207650_10070219
518 Ga0207650_10093180
519 Ga0207659_10099172
520 Ga0207659_10491812
521 Ga0207644_10480713
522 Ga0207690_10026756
523 Ga0207690_10217680
524 Ga0207706_10076094
525 Ga0207670_10629063
526 Ga0207691_10144944
527 Ga0207689_10132816
528 Ga0207689_10175792
529 Ga0207661_10077785
530 Ga0207679_10074756
531 Ga0207667_10136554
532 Ga0207667_10318464
533 Ga0207667_11135582
534 Ga0207651_10331955
535 Ga0207651_10425315
536 Ga0207712_10417592
537 Ga0207640_10081805
538 Ga0207658_10195894
539 Ga0207677_10274994
540 Ga0207639_10004569
541 Ga0207639_10027319
542 Ga0207639_10084543
543 Ga0207639_10346043
544 Ga0207678_10324122
545 Ga0207702_10152478
546 Ga0207702_10320244
547 Ga0207648_10006815
548 Ga0207648_10068601
549 Ga0207648_10197486
550 Ga0207676_10025028
551 Ga0207676_10087035
552 Ga0207674_10022778
553 Ga0207674_10074667
554 Ga0207675_100312601
555 Ga0207675_100354682
556 Ga0207698_10015124
557 Ga0207698_10180484
558 Ga0207698_10181990
559 Ga0207698_10561375
560 Ga0207698_10781342
561 Ga0268265_10013369
562 Ga0268264_10045801
563 Ga0268264_10307707
564 Ga0307515_10000001
565 Ga0265327_10000115
566 Ga0265327_10076296
567 Ga0436365_0286889
568 Ga0436365_1093720
569 Ga0436365_1222761
570 Ga0439465_0020070
571 Ga0451849_1088020
572 Ga0439431_0033136
573 Ga0466972_0000003
574 Ga0453684_0293938
575 Ga0466970_0010718
576 Ga0495627_008425
577 Ga0495622_0118258
578 Ga0495633_0000058
579 Ga0496101_0137225
580 Ga0496109_0562298
581 Ga0496126_0010428
582 Ga0501033_0155870
583 Ga0501034_0049158
584 Ga0501034_0576610
585 Ga0501037_0367167
586 Ga0501073_0347503
587 Ga0501080_0103773
588 Ga0501241_000214
589 Ga0501044_0193871
590 Ga0501044_0317446
591 Ga0501044_0408475
592 nmdc:mga0k408_313652_c1
593 nmdc:mga0k408_53338_c1
594 nmdc:mga07m45_53322_c1
595 Ga0500646_0006979
596 Ga0500646_0011446
597 Ga0500583_0007027
598 Ga0500660_106366
599 Ga0500569_000151
600 Ga0500652_002822
601 Ga0500658_0006392
602 Ga0500559_0013642
603 Ga0500568_0070896
604 Ga0500589_061417
605 Ga0500590_073566
606 Ga0500616_0007054
607 Ga0500636_0016069
608 Ga0500656_011975
609 2896113645
610 2929178947
611 2929927192
612 2945981353
613 2946019248
614 8003151068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13482

RNase_H_2

RNase_H superfamily

75

245

0.81

PF10108

DNA_pol_B_exo2

Predicted 3'-5' exonuclease related to the exonuclease domain of PolB

77

250

0.8

PF03104

DNA_pol_B_exo1

DNA polymerase family B, exonuclease domain

77

198

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lir-assembly2.cif.gz_D crystal structure of chicken tcr for 2.0 0.7245 68 92
5mdn-assembly2.cif.gz_B structure of the family b dna polymerase from the hyperthermophilic archaeon pyrobaculum calidifontis 0.6904 10 226
2xhb-assembly1.cif.gz_A crystal structure of dna polymerase from thermococcus gorgonarius in complex with hypoxanthine-containing dna 0.6565 10 226
6zp2-assembly1.cif.gz_B structure of sars-cov-2 spike protein trimer (k986p, v987p, single arg s1/s2 cleavage site) in locked state 0.6538 65 91
5h12-assembly1.cif.gz_A crystal structure of deep vent dna polymerase 0.6527 10 226
ID Description Score Start End Superfamily
af_P22137_1_370_2.130.10.110 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Clathrin heavy-chain terminal domain 0.9165 66 89 2.130.10.110
af_P27931_139_244_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8459 67 87 2.60.40.10
af_Q57811_1_166_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7873 10 223 3.30.420.10
af_A0A0R0FYU2_84_393_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7746 68 93 2.120.10.80
af_A5Z2X0_902_1075_2.170.210.20 Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;Spindle assembly abnormal protein 6, N-terminal domain 0.7701 67 111 2.170.210.20
ID Description Score Start End GO Terms
AF-A0A4Q3S192-F1-model_v4 3'-5' exonuclease 0.9824 173 241 GO:0003676
GO:0004527
AF-A0A2T7BPN0-F1-model_v4 3'-5' exonuclease 0.9817 1 240 GO:0003676
GO:0004527
AF-A0A848H1Q0-F1-model_v4 3'-5' exonuclease 0.9779 33 241 GO:0003676
GO:0004527
AF-A0A2T7BPN0-F1-model_v4 3'-5' exonuclease 0.9777 1 240 GO:0003676
GO:0004527
AF-A0A3E1NLT5-F1-model_v4 3'-5' exonuclease 0.9753 8 241 GO:0003676
GO:0004527

Map