F400033
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 309 | 156 | 309 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100285206|Ga0070670_1002852062 |
| Length | 228 |
| Sequence | MRPALILFVDDEKAIQRTLVPLLRSRGYTVTTAETGRDALAAIDAERPDLVVLDLGLPDMDGTVVCEQIRARSDVPILILSARLTEPDKIAALDRGADDYITKPFSPEELLARVRAALRRALGQEQAVRGQLTAGSIAIDLERRDVMVAGREVHLTPKEFDLLSLLAARAGQVVTHRAILRAIWGPHSVDQPEHLRVLVGQLRKKIEDDPARPTRLLTEPWVGYRLVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 111 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 114 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 115 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 116 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 124 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 125 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 126 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 127 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 143 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 147 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 156 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.94 |
| Nodule | 0 |
| Rhizoplane | 0.32 |
| Rhizosphere | 97.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10197153 | 3300005293 | Bacteria | 1381 |
| 2 | Ga0065715_10281839 | 3300005293 | Bacteria | 1084 |
| 3 | Ga0065707_10114772 | 3300005295 | Bacteria | 2287 |
| 4 | Ga0065707_10152795 | 3300005295 | Bacteria | 1640 |
| 5 | Ga0070676_10130218 | 3300005328 | Bacteria | 1590 |
| 6 | Ga0070690_100027859 | 3300005330 | Bacteria | 3496 |
| 7 | Ga0070670_100226123 | 3300005331 | Bacteria | 1628 |
| 8 | Ga0070670_100285206 | 3300005331 | Bacteria | 1442 |
| 9 | Ga0070670_100632809 | 3300005331 | Bacteria | 959 |
| 10 | Ga0068869_100097511 | 3300005334 | Bacteria | 2220 |
| 11 | Ga0070680_100191979 | 3300005336 | Bacteria | 1721 |
| 12 | Ga0070689_100062867 | 3300005340 | Bacteria | 2889 |
| 13 | Ga0070687_100011421 | 3300005343 | Bacteria | 3885 |
| 14 | Ga0070692_10005243 | 3300005345 | Bacteria | 5500 |
| 15 | Ga0070669_100001431 | 3300005353 | Bacteria | 17262 |
| 16 | Ga0070675_100016722 | 3300005354 | Bacteria | 5824 |
| 17 | Ga0070675_100020368 | 3300005354 | Bacteria | 5294 |
| 18 | Ga0070675_100022370 | 3300005354 | Bacteria | 5052 |
| 19 | Ga0070675_100104887 | 3300005354 | Bacteria | 2385 |
| 20 | Ga0070675_100149543 | 3300005354 | Bacteria | 2001 |
| 21 | Ga0070675_100745756 | 3300005354 | Bacteria | 893 |
| 22 | Ga0070671_100128003 | 3300005355 | Bacteria | 2138 |
| 23 | Ga0070671_100172061 | 3300005355 | Bacteria | 1832 |
| 24 | Ga0070674_100002233 | 3300005356 | Bacteria | 10659 |
| 25 | Ga0070674_100264823 | 3300005356 | Bacteria | 1356 |
| 26 | Ga0070688_100041091 | 3300005365 | Bacteria | 2837 |
| 27 | Ga0070688_100060777 | 3300005365 | Bacteria | 2387 |
| 28 | Ga0070688_100148692 | 3300005365 | Bacteria | 1599 |
| 29 | Ga0070667_100228756 | 3300005367 | Bacteria | 1657 |
| 30 | Ga0070713_100954256 | 3300005436 | Bacteria | 826 |
| 31 | Ga0070701_10009798 | 3300005438 | Bacteria | 4211 |
| 32 | Ga0070701_10021389 | 3300005438 | Bacteria | 3086 |
| 33 | Ga0070705_100001734 | 3300005440 | Bacteria | 11344 |
| 34 | Ga0070705_100307571 | 3300005440 | Bacteria | 1139 |
| 35 | Ga0070700_100040443 | 3300005441 | Bacteria | 2854 |
| 36 | Ga0070694_100000891 | 3300005444 | Bacteria | 16870 |
| 37 | Ga0070694_100073719 | 3300005444 | Bacteria | 2358 |
| 38 | Ga0070694_100125084 | 3300005444 | Bacteria | 1850 |
| 39 | Ga0070708_100626746 | 3300005445 | Bacteria | 1014 |
| 40 | Ga0070678_100073768 | 3300005456 | Bacteria | 2562 |
| 41 | Ga0070662_100033099 | 3300005457 | Bacteria | 3638 |
| 42 | Ga0068867_100000739 | 3300005459 | Bacteria | 21921 |
| 43 | Ga0068867_100148486 | 3300005459 | Bacteria | 1839 |
| 44 | Ga0068867_100742597 | 3300005459 | Bacteria | 870 |
| 45 | Ga0070706_100432553 | 3300005467 | Bacteria | 1225 |
| 46 | Ga0070706_100626796 | 3300005467 | Bacteria | 999 |
| 47 | Ga0070707_100204658 | 3300005468 | Bacteria | 1924 |
| 48 | Ga0070698_100006428 | 3300005471 | Bacteria | 12742 |
| 49 | Ga0070698_100010289 | 3300005471 | Bacteria | 9990 |
| 50 | Ga0070698_100074933 | 3300005471 | Bacteria | 3389 |
| 51 | Ga0070699_100003974 | 3300005518 | Bacteria | 13074 |
| 52 | Ga0070699_100009544 | 3300005518 | Bacteria | 8410 |
| 53 | Ga0070699_100192497 | 3300005518 | Bacteria | 1812 |
| 54 | Ga0070684_100100333 | 3300005535 | Bacteria | 2585 |
| 55 | Ga0070672_100006410 | 3300005543 | Bacteria | 7909 |
| 56 | Ga0070672_100046878 | 3300005543 | Bacteria | 3351 |
| 57 | Ga0070672_100320157 | 3300005543 | Bacteria | 1318 |
| 58 | Ga0070695_100016446 | 3300005545 | Bacteria | 4477 |
| 59 | Ga0070695_100158857 | 3300005545 | Bacteria | 1585 |
| 60 | Ga0070695_100164787 | 3300005545 | Bacteria | 1559 |
| 61 | Ga0070696_100000400 | 3300005546 | Bacteria | 26895 |
| 62 | Ga0070696_100447630 | 3300005546 | Bacteria | 1018 |
| 63 | Ga0070693_100098313 | 3300005547 | Bacteria | 1778 |
| 64 | Ga0070704_100002527 | 3300005549 | Bacteria | 10296 |
| 65 | Ga0070704_100013602 | 3300005549 | Bacteria | 5057 |
| 66 | Ga0070704_100118774 | 3300005549 | Bacteria | 2026 |
| 67 | Ga0070664_100015290 | 3300005564 | Bacteria | 6274 |
| 68 | Ga0068857_100004987 | 3300005577 | Bacteria | 11274 |
| 69 | Ga0068857_100030064 | 3300005577 | Bacteria | 4793 |
| 70 | Ga0068857_100168956 | 3300005577 | Bacteria | 1987 |
| 71 | Ga0070702_100234020 | 3300005615 | Bacteria | 1236 |
| 72 | Ga0068859_100001058 | 3300005617 | Bacteria | 28155 |
| 73 | Ga0068859_100026627 | 3300005617 | Bacteria | 5798 |
| 74 | Ga0068859_100095395 | 3300005617 | Bacteria | 3027 |
| 75 | Ga0068859_100533292 | 3300005617 | Bacteria | 1269 |
| 76 | Ga0068859_100918793 | 3300005617 | Unclassified | 959 |
| 77 | Ga0068864_100110593 | 3300005618 | Bacteria | 2447 |
| 78 | Ga0068864_100143801 | 3300005618 | Bacteria | 2154 |
| 79 | Ga0068864_100252153 | 3300005618 | Bacteria | 1639 |
| 80 | Ga0068864_100448857 | 3300005618 | Bacteria | 1233 |
| 81 | Ga0068861_100002675 | 3300005719 | Bacteria | 11670 |
| 82 | Ga0068870_10005707 | 3300005840 | Bacteria | 5448 |
| 83 | Ga0068870_10006043 | 3300005840 | Bacteria | 5321 |
| 84 | Ga0068870_10038507 | 3300005840 | Bacteria | 2469 |
| 85 | Ga0068863_100047908 | 3300005841 | Bacteria | 4053 |
| 86 | Ga0068863_100299453 | 3300005841 | Bacteria | 1560 |
| 87 | Ga0068858_100005452 | 3300005842 | Bacteria | 12455 |
| 88 | Ga0068860_100007937 | 3300005843 | Bacteria | 10590 |
| 89 | Ga0068860_100449443 | 3300005843 | Bacteria | 1281 |
| 90 | Ga0068860_100567794 | 3300005843 | Bacteria | 1138 |
| 91 | Ga0068862_100002358 | 3300005844 | Bacteria | 16819 |
| 92 | Ga0068862_100248174 | 3300005844 | Bacteria | 1621 |
| 93 | Ga0081455_10531860 | 3300005937 | Bacteria | 782 |
| 94 | Ga0075368_10026625 | 3300006042 | Bacteria | 2225 |
| 95 | Ga0075364_10090791 | 3300006051 | Bacteria | 2026 |
| 96 | Ga0075367_10018484 | 3300006178 | Bacteria | 3847 |
| 97 | Ga0097621_100160067 | 3300006237 | Bacteria | 1935 |
| 98 | Ga0097621_100372171 | 3300006237 | Bacteria | 1275 |
| 99 | Ga0075428_100034476 | 3300006844 | Bacteria | 5582 |
| 100 | Ga0075430_100007681 | 3300006846 | Bacteria | 9109 |
| 101 | Ga0075430_100088779 | 3300006846 | Bacteria | 2587 |
| 102 | Ga0075431_100077253 | 3300006847 | Bacteria | 3437 |
| 103 | Ga0075431_100118884 | 3300006847 | Bacteria | 2727 |
| 104 | Ga0075431_100135969 | 3300006847 | Bacteria | 2534 |
| 105 | Ga0075433_10022235 | 3300006852 | Bacteria | 5323 |
| 106 | Ga0075433_10062241 | 3300006852 | Bacteria | 3268 |
| 107 | Ga0075433_10091219 | 3300006852 | Bacteria | 2693 |
| 108 | Ga0075433_10096850 | 3300006852 | Bacteria | 2611 |
| 109 | Ga0075433_10106330 | 3300006852 | Bacteria | 2487 |
| 110 | Ga0075434_100012939 | 3300006871 | Bacteria | 7925 |
| 111 | Ga0075434_100214583 | 3300006871 | Bacteria | 1944 |
| 112 | Ga0075434_100258003 | 3300006871 | Bacteria | 1762 |
| 113 | Ga0075429_100190172 | 3300006880 | Bacteria | 1799 |
| 114 | Ga0075429_100455320 | 3300006880 | Bacteria | 1121 |
| 115 | Ga0068865_100037247 | 3300006881 | Bacteria | 3283 |
| 116 | Ga0068865_100146018 | 3300006881 | Bacteria | 1789 |
| 117 | Ga0097620_100001058 | 3300006931 | Bacteria | 28155 |
| 118 | Ga0097620_100026627 | 3300006931 | Bacteria | 5798 |
| 119 | Ga0097620_100095399 | 3300006931 | Bacteria | 3027 |
| 120 | Ga0097620_100533290 | 3300006931 | Bacteria | 1269 |
| 121 | Ga0097620_100918974 | 3300006931 | Unclassified | 959 |
| 122 | Ga0075435_100292094 | 3300007076 | Bacteria | 1393 |
| 123 | Ga0111539_10010458 | 3300009094 | Bacteria | 11679 |
| 124 | Ga0111539_10023946 | 3300009094 | Bacteria | 7501 |
| 125 | Ga0111539_10101534 | 3300009094 | Bacteria | 3377 |
| 126 | Ga0111539_10114043 | 3300009094 | Bacteria | 3170 |
| 127 | Ga0111539_10151691 | 3300009094 | Bacteria | 2712 |
| 128 | Ga0111539_10377392 | 3300009094 | Bacteria | 1651 |
| 129 | Ga0105245_10147149 | 3300009098 | Bacteria | 2223 |
| 130 | Ga0114129_10001641 | 3300009147 | Bacteria | 30388 |
| 131 | Ga0114129_10018179 | 3300009147 | Bacteria | 10009 |
| 132 | Ga0114129_10042430 | 3300009147 | Bacteria | 6406 |
| 133 | Ga0114129_10062321 | 3300009147 | Bacteria | 5210 |
| 134 | Ga0114129_10214863 | 3300009147 | Bacteria | 2597 |
| 135 | Ga0114129_10658639 | 3300009147 | Bacteria | 1350 |
| 136 | Ga0105243_10197325 | 3300009148 | Bacteria | 1763 |
| 137 | Ga0105242_10345687 | 3300009176 | Bacteria | 1372 |
| 138 | Ga0105248_10133880 | 3300009177 | Bacteria | 2797 |
| 139 | Ga0105248_10183634 | 3300009177 | Bacteria | 2357 |
| 140 | Ga0105249_10036507 | 3300009553 | Bacteria | 4458 |
| 141 | Ga0105249_10470525 | 3300009553 | Bacteria | 1298 |
| 142 | Ga0163162_10557253 | 3300013306 | Bacteria | 1274 |
| 143 | Ga0157375_10003610 | 3300013308 | Bacteria | 13422 |
| 144 | Ga0163163_10000009 | 3300014325 | Bacteria | 268331 |
| 145 | Ga0163163_10156791 | 3300014325 | Bacteria | 2321 |
| 146 | Ga0157380_10012074 | 3300014326 | Bacteria | 6252 |
| 147 | Ga0157380_10052861 | 3300014326 | Bacteria | 3218 |
| 148 | Ga0157380_10061399 | 3300014326 | Bacteria | 3007 |
| 149 | Ga0157377_10136742 | 3300014745 | Bacteria | 1502 |
| 150 | Ga0157376_10033775 | 3300014969 | Bacteria | 4123 |
| 151 | Ga0157376_10201685 | 3300014969 | Bacteria | 1831 |
| 152 | Ga0163161_10424200 | 3300017792 | Bacteria | 1071 |
| 153 | Ga0207682_10166794 | 3300025893 | Bacteria | 1000 |
| 154 | Ga0207645_10017784 | 3300025907 | Bacteria | 4686 |
| 155 | Ga0207643_10001995 | 3300025908 | Bacteria | 11262 |
| 156 | Ga0207643_10003554 | 3300025908 | Bacteria | 8393 |
| 157 | Ga0207643_10037281 | 3300025908 | Bacteria | 2728 |
| 158 | Ga0207684_10145461 | 3300025910 | Bacteria | 2039 |
| 159 | Ga0207684_10463351 | 3300025910 | Bacteria | 1088 |
| 160 | Ga0207660_10118724 | 3300025917 | Bacteria | 2001 |
| 161 | Ga0207662_10018825 | 3300025918 | Bacteria | 3921 |
| 162 | Ga0207646_10300301 | 3300025922 | Bacteria | 1451 |
| 163 | Ga0207646_10325677 | 3300025922 | Bacteria | 1388 |
| 164 | Ga0207681_10010377 | 3300025923 | Bacteria | 5699 |
| 165 | Ga0207681_10209949 | 3300025923 | Bacteria | 1500 |
| 166 | Ga0207650_10048223 | 3300025925 | Bacteria | 3141 |
| 167 | Ga0207650_10056655 | 3300025925 | Bacteria | 2913 |
| 168 | Ga0207650_10224830 | 3300025925 | Bacteria | 1512 |
| 169 | Ga0207659_10001821 | 3300025926 | Bacteria | 12624 |
| 170 | Ga0207659_10250244 | 3300025926 | Bacteria | 1438 |
| 171 | Ga0207659_10287784 | 3300025926 | Bacteria | 1345 |
| 172 | Ga0207700_10522955 | 3300025928 | Bacteria | 1051 |
| 173 | Ga0207644_10145377 | 3300025931 | Bacteria | 1830 |
| 174 | Ga0207706_10042749 | 3300025933 | Bacteria | 4016 |
| 175 | Ga0207709_10118093 | 3300025935 | Bacteria | 1786 |
| 176 | Ga0207709_10179572 | 3300025935 | Bacteria | 1493 |
| 177 | Ga0207670_10017822 | 3300025936 | Bacteria | 4300 |
| 178 | Ga0207669_10000865 | 3300025937 | Bacteria | 12878 |
| 179 | Ga0207669_10135618 | 3300025937 | Bacteria | 1699 |
| 180 | Ga0207704_10085638 | 3300025938 | Bacteria | 2052 |
| 181 | Ga0207704_10136337 | 3300025938 | Bacteria | 1709 |
| 182 | Ga0207704_10803673 | 3300025938 | Bacteria | 785 |
| 183 | Ga0207691_10052117 | 3300025940 | Bacteria | 3738 |
| 184 | Ga0207691_10103200 | 3300025940 | Bacteria | 2543 |
| 185 | Ga0207691_10216126 | 3300025940 | Bacteria | 1663 |
| 186 | Ga0207711_10041582 | 3300025941 | Bacteria | 3915 |
| 187 | Ga0207711_10198351 | 3300025941 | Bacteria | 1831 |
| 188 | Ga0207689_10043182 | 3300025942 | Bacteria | 3727 |
| 189 | Ga0207689_10224666 | 3300025942 | Bacteria | 1552 |
| 190 | Ga0207661_10000733 | 3300025944 | Bacteria | 21299 |
| 191 | Ga0207661_10059677 | 3300025944 | Bacteria | 3075 |
| 192 | Ga0207679_10030442 | 3300025945 | Bacteria | 3769 |
| 193 | Ga0207651_10119250 | 3300025960 | Bacteria | 1997 |
| 194 | Ga0207651_10573978 | 3300025960 | Bacteria | 983 |
| 195 | Ga0207712_10119944 | 3300025961 | Bacteria | 1988 |
| 196 | Ga0207712_10218235 | 3300025961 | Bacteria | 1523 |
| 197 | Ga0207668_10041095 | 3300025972 | Bacteria | 3124 |
| 198 | Ga0207668_10145402 | 3300025972 | Bacteria | 1829 |
| 199 | Ga0207658_10172123 | 3300025986 | Bacteria | 1785 |
| 200 | Ga0207703_10014676 | 3300026035 | Bacteria | 6113 |
| 201 | Ga0207703_10299390 | 3300026035 | Bacteria | 1466 |
| 202 | Ga0207639_10504697 | 3300026041 | Bacteria | 1106 |
| 203 | Ga0207708_10020926 | 3300026075 | Bacteria | 4936 |
| 204 | Ga0207708_10055041 | 3300026075 | Bacteria | 3033 |
| 205 | Ga0207708_10217159 | 3300026075 | Bacteria | 1531 |
| 206 | Ga0207641_10027782 | 3300026088 | Bacteria | 4674 |
| 207 | Ga0207641_10202478 | 3300026088 | Bacteria | 1831 |
| 208 | Ga0207648_10002044 | 3300026089 | Bacteria | 21990 |
| 209 | Ga0207648_10682401 | 3300026089 | Bacteria | 951 |
| 210 | Ga0207676_10003264 | 3300026095 | Bacteria | 11543 |
| 211 | Ga0207676_10162349 | 3300026095 | Bacteria | 1937 |
| 212 | Ga0207676_10568353 | 3300026095 | Bacteria | 1085 |
| 213 | Ga0207674_10011409 | 3300026116 | Bacteria | 9984 |
| 214 | Ga0207674_10040087 | 3300026116 | Bacteria | 4854 |
| 215 | Ga0207675_100000566 | 3300026118 | Bacteria | 36197 |
| 216 | Ga0207675_100512171 | 3300026118 | Bacteria | 1195 |
| 217 | Ga0207683_10044065 | 3300026121 | Bacteria | 3900 |
| 218 | Ga0207428_10001394 | 3300027907 | Bacteria | 25518 |
| 219 | Ga0207428_10003929 | 3300027907 | Bacteria | 14253 |
| 220 | Ga0207428_10105086 | 3300027907 | Bacteria | 2178 |
| 221 | Ga0268265_10000816 | 3300028380 | Bacteria | 29554 |
| 222 | Ga0268264_10004728 | 3300028381 | Bacteria | 11567 |
| 223 | Ga0268264_10021509 | 3300028381 | Bacteria | 5266 |
| 224 | Ga0268264_10244833 | 3300028381 | Bacteria | 1663 |
| 225 | Ga0307408_100139775 | 3300031548 | Bacteria | 1900 |
| 226 | Ga0307413_10204956 | 3300031824 | Bacteria | 1427 |
| 227 | Ga0307410_10032809 | 3300031852 | Bacteria | 3347 |
| 228 | Ga0307410_10210972 | 3300031852 | Bacteria | 1488 |
| 229 | Ga0307412_10517680 | 3300031911 | Bacteria | 996 |
| 230 | Ga0307409_100026757 | 3300031995 | Bacteria | 4075 |
| 231 | Ga0307409_100154743 | 3300031995 | Bacteria | 1996 |
| 232 | Ga0307416_100049921 | 3300032002 | Bacteria | 3330 |
| 233 | Ga0307416_100187249 | 3300032002 | Bacteria | 1947 |
| 234 | Ga0307414_10088140 | 3300032004 | Bacteria | 2296 |
| 235 | Ga0307414_10114949 | 3300032004 | Bacteria | 2057 |
| 236 | Ga0307415_100134624 | 3300032126 | Bacteria | 1877 |
| 237 | Ga0307415_100405428 | 3300032126 | Bacteria | 1165 |
| 238 | Ga0373937_0139175 | 3300036401 | Bacteria | 2270 |
| 239 | Ga0373937_0952168 | 3300036401 | Bacteria | 807 |
| 240 | Ga0395905_0290118 | 3300037471 | Bacteria | 1523 |
| 241 | Ga0395901_0270925 | 3300038443 | Bacteria | 1766 |
| 242 | Ga0436363_1570569 | 3300039450 | Bacteria | 1445 |
| 243 | Ga0439444_0035117 | 3300042437 | Bacteria | 960 |
| 244 | Ga0451576_0022502 | 3300045051 | Bacteria | 6834 |
| 245 | Ga0451576_0043926 | 3300045051 | Bacteria | 4713 |
| 246 | Ga0451576_0051453 | 3300045051 | Bacteria | 4319 |
| 247 | Ga0451576_0108579 | 3300045051 | Bacteria | 2887 |
| 248 | Ga0451576_0191289 | 3300045051 | Bacteria | 2137 |
| 249 | Ga0451576_0267674 | 3300045051 | Bacteria | 1786 |
| 250 | Ga0451576_0370859 | 3300045051 | Bacteria | 1500 |
| 251 | Ga0495629_0138277 | 3300046459 | Bacteria | 1695 |
| 252 | Ga0495629_0376572 | 3300046459 | Bacteria | 966 |
| 253 | Ga0495584_0012987 | 3300046491 | Bacteria | 4252 |
| 254 | Ga0495642_0054059 | 3300046528 | Bacteria | 1655 |
| 255 | Ga0495642_0217564 | 3300046528 | Bacteria | 834 |
| 256 | Ga0495598_0095332 | 3300046537 | Bacteria | 977 |
| 257 | Ga0495609_0081155 | 3300046538 | Bacteria | 1418 |
| 258 | Ga0495621_0011499 | 3300046539 | Bacteria | 2740 |
| 259 | Ga0495621_0035421 | 3300046539 | Bacteria | 1729 |
| 260 | Ga0495621_0131523 | 3300046539 | Unclassified | 974 |
| 261 | Ga0495656_0077226 | 3300046615 | Bacteria | 1494 |
| 262 | Ga0495656_0148466 | 3300046615 | Bacteria | 1130 |
| 263 | Ga0495656_0220878 | 3300046615 | Bacteria | 947 |
| 264 | Ga0495659_0030638 | 3300046664 | Bacteria | 1873 |
| 265 | Ga0495659_0044286 | 3300046664 | Bacteria | 1600 |
| 266 | Ga0495659_0061432 | 3300046664 | Bacteria | 1388 |
| 267 | Ga0495588_0056363 | 3300046674 | Bacteria | 2029 |
| 268 | Ga0495658_0222397 | 3300046683 | Bacteria | 1182 |
| 269 | Ga0495670_0065393 | 3300046691 | Bacteria | 1833 |
| 270 | Ga0495636_0006584 | 3300047318 | Bacteria | 4568 |
| 271 | Ga0495636_0087240 | 3300047318 | Bacteria | 1350 |
| 272 | Ga0495672_0051308 | 3300047320 | Bacteria | 2430 |
| 273 | Ga0495676_0055702 | 3300047321 | Bacteria | 3133 |
| 274 | Ga0495685_030259 | 3300047447 | Bacteria | 1862 |
| 275 | Ga0496110_0000920 | 3300048913 | Bacteria | 20628 |
| 276 | Ga0501067_0021836 | 3300049583 | Bacteria | 3542 |
| 277 | Ga0501069_0132254 | 3300049585 | Bacteria | 1429 |
| 278 | Ga0501073_0001725 | 3300049589 | Bacteria | 16245 |
| 279 | nmdc:mga0k408_215576_c1 | 3300050493 | Bacteria | 1146 |
| 280 | nmdc:mga05p37_165176_c1 | 3300050507 | Bacteria | 2702 |
| 281 | nmdc:mga05p37_2372_c1 | 3300050507 | Bacteria | 21926 |
| 282 | nmdc:mga05p37_344995_c1 | 3300050507 | Bacteria | 1755 |
| 283 | nmdc:mga05p37_382019_c1 | 3300050507 | Bacteria | 1650 |
| 284 | nmdc:mga05p37_734208_c1 | 3300050507 | Bacteria | 1091 |
| 285 | nmdc:mga05p37_7838_c1 | 3300050507 | Bacteria | 12606 |
| 286 | nmdc:mga09592_152881_c2 | 3300050508 | Bacteria | 1699 |
| 287 | nmdc:mga09592_232262_c1 | 3300050508 | Bacteria | 1598 |
| 288 | nmdc:mga09592_70623_c1 | 3300050508 | Bacteria | 2963 |
| 289 | nmdc:mga0qj67_528479_c1 | 3300050509 | Bacteria | 947 |
| 290 | nmdc:mga0qj67_87686_c1 | 3300050509 | Bacteria | 2498 |
| 291 | nmdc:mga06r32_228112_c1 | 3300050510 | Bacteria | 1850 |
| 292 | nmdc:mga08y16_12609_c1 | 3300050511 | Bacteria | 8892 |
| 293 | nmdc:mga08y16_162855_c1 | 3300050511 | Bacteria | 2317 |
| 294 | nmdc:mga08y16_38388_c1 | 3300050511 | Bacteria | 5029 |
| 295 | nmdc:mga08y16_61749_c1 | 3300050511 | Bacteria | 3913 |
| 296 | nmdc:mga08y16_80211_c2 | 3300050511 | Bacteria | 1075 |
| 297 | nmdc:mga0n895_15412_c1 | 3300050512 | Bacteria | 6969 |
| 298 | nmdc:mga0n895_238889_c1 | 3300050512 | Bacteria | 1844 |
| 299 | nmdc:mga0n895_422285_c1 | 3300050512 | Bacteria | 1348 |
| 300 | nmdc:mga0rr50_353755_c1 | 3300050513 | Bacteria | 1236 |
| 301 | nmdc:mga0rr50_69980_c1 | 3300050513 | Bacteria | 2672 |
| 302 | nmdc:mga0rr50_7931_c1 | 3300050513 | Bacteria | 6586 |
| 303 | nmdc:mga0a205_1361_c2 | 3300050515 | Bacteria | 14296 |
| 304 | nmdc:mga0a205_156324_c1 | 3300050515 | Bacteria | 2179 |
| 305 | nmdc:mga0a205_46508_c1 | 3300050515 | Bacteria | 4186 |
| 306 | nmdc:mga0a205_66489_c1 | 3300050515 | Bacteria | 3483 |
| 307 | nmdc:mga0a205_93766_c1 | 3300050515 | Bacteria | 2900 |
| 308 | Ga0500652_112848 | 3300053131 | Bacteria | 1136 |
| 309 | Ga0500568_0009641 | 3300053139 | Bacteria | 4574 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046539 | Ga0495621_0131523 | Ga0495621_0131523_319_951 | 210 |
| 2 | 3300046459 | Ga0495629_0376572 | Ga0495629_0376572_272_940 | 222 |
| 3 | 3300005331 | Ga0070670_100285206 | Ga0070670_1002852062 | 225 |
| 4 | 3300005547 | Ga0070693_100098313 | Ga0070693_1000983132 | 225 |
| 5 | 3300006237 | Ga0097621_100160067 | Ga0097621_1001600672 | 225 |
| 6 | 3300009177 | Ga0105248_10183634 | Ga0105248_101836342 | 225 |
| 7 | 3300014325 | Ga0163163_10000009 | Ga0163163_1000000928 | 225 |
| 8 | 3300014969 | Ga0157376_10033775 | Ga0157376_100337753 | 225 |
| 9 | 3300025925 | Ga0207650_10224830 | Ga0207650_102248302 | 225 |
| 10 | 3300025941 | Ga0207711_10198351 | Ga0207711_101983512 | 225 |
| 11 | 3300026035 | Ga0207703_10299390 | Ga0207703_102993901 | 225 |
| 12 | 3300028381 | Ga0268264_10244833 | Ga0268264_102448331 | 225 |
| 13 | 3300031824 | Ga0307413_10204956 | Ga0307413_102049562 | 225 |
| 14 | 3300031852 | Ga0307410_10032809 | Ga0307410_100328091 | 225 |
| 15 | 3300031995 | Ga0307409_100154743 | Ga0307409_1001547432 | 225 |
| 16 | 3300032004 | Ga0307414_10114949 | Ga0307414_101149492 | 225 |
| 17 | 3300036401 | Ga0373937_0952168 | Ga0373937_0952168_61_747 | 225 |
| 18 | 3300045051 | Ga0451576_0267674 | Ga0451576_0267674_1079_1765 | 225 |
| 19 | 3300005293 | Ga0065715_10197153 | Ga0065715_101971532 | 226 |
| 20 | 3300005293 | Ga0065715_10281839 | Ga0065715_102818392 | 226 |
| 21 | 3300005295 | Ga0065707_10114772 | Ga0065707_101147721 | 226 |
| 22 | 3300005295 | Ga0065707_10152795 | Ga0065707_101527952 | 226 |
| 23 | 3300005328 | Ga0070676_10130218 | Ga0070676_101302182 | 226 |
| 24 | 3300005330 | Ga0070690_100027859 | Ga0070690_1000278594 | 226 |
| 25 | 3300005331 | Ga0070670_100226123 | Ga0070670_1002261232 | 226 |
| 26 | 3300005331 | Ga0070670_100632809 | Ga0070670_1006328091 | 226 |
| 27 | 3300005334 | Ga0068869_100097511 | Ga0068869_1000975112 | 226 |
| 28 | 3300005336 | Ga0070680_100191979 | Ga0070680_1001919792 | 226 |
| 29 | 3300005340 | Ga0070689_100062867 | Ga0070689_1000628672 | 226 |
| 30 | 3300005343 | Ga0070687_100011421 | Ga0070687_1000114213 | 226 |
| 31 | 3300005345 | Ga0070692_10005243 | Ga0070692_100052432 | 226 |
| 32 | 3300005353 | Ga0070669_100001431 | Ga0070669_1000014317 | 226 |
| 33 | 3300005354 | Ga0070675_100016722 | Ga0070675_1000167223 | 226 |
| 34 | 3300005354 | Ga0070675_100020368 | Ga0070675_1000203684 | 226 |
| 35 | 3300005354 | Ga0070675_100022370 | Ga0070675_1000223702 | 226 |
| 36 | 3300005354 | Ga0070675_100104887 | Ga0070675_1001048872 | 226 |
| 37 | 3300005354 | Ga0070675_100149543 | Ga0070675_1001495432 | 226 |
| 38 | 3300005354 | Ga0070675_100745756 | Ga0070675_1007457562 | 226 |
| 39 | 3300005355 | Ga0070671_100128003 | Ga0070671_1001280032 | 226 |
| 40 | 3300005355 | Ga0070671_100172061 | Ga0070671_1001720612 | 226 |
| 41 | 3300005356 | Ga0070674_100002233 | Ga0070674_1000022337 | 226 |
| 42 | 3300005356 | Ga0070674_100264823 | Ga0070674_1002648232 | 226 |
| 43 | 3300005365 | Ga0070688_100041091 | Ga0070688_1000410913 | 226 |
| 44 | 3300005365 | Ga0070688_100060777 | Ga0070688_1000607772 | 226 |
| 45 | 3300005365 | Ga0070688_100148692 | Ga0070688_1001486922 | 226 |
| 46 | 3300005367 | Ga0070667_100228756 | Ga0070667_1002287561 | 226 |
| 47 | 3300005436 | Ga0070713_100954256 | Ga0070713_1009542561 | 226 |
| 48 | 3300005438 | Ga0070701_10009798 | Ga0070701_100097983 | 226 |
| 49 | 3300005438 | Ga0070701_10021389 | Ga0070701_100213893 | 226 |
| 50 | 3300005440 | Ga0070705_100001734 | Ga0070705_1000017348 | 226 |
| 51 | 3300005440 | Ga0070705_100307571 | Ga0070705_1003075712 | 226 |
| 52 | 3300005441 | Ga0070700_100040443 | Ga0070700_1000404433 | 226 |
| 53 | 3300005444 | Ga0070694_100000891 | Ga0070694_1000008919 | 226 |
| 54 | 3300005444 | Ga0070694_100073719 | Ga0070694_1000737192 | 226 |
| 55 | 3300005444 | Ga0070694_100125084 | Ga0070694_1001250842 | 226 |
| 56 | 3300005445 | Ga0070708_100626746 | Ga0070708_1006267462 | 226 |
| 57 | 3300005456 | Ga0070678_100073768 | Ga0070678_1000737682 | 226 |
| 58 | 3300005457 | Ga0070662_100033099 | Ga0070662_1000330992 | 226 |
| 59 | 3300005459 | Ga0068867_100000739 | Ga0068867_1000007394 | 226 |
| 60 | 3300005459 | Ga0068867_100148486 | Ga0068867_1001484862 | 226 |
| 61 | 3300005459 | Ga0068867_100742597 | Ga0068867_1007425971 | 226 |
| 62 | 3300005467 | Ga0070706_100432553 | Ga0070706_1004325532 | 226 |
| 63 | 3300005467 | Ga0070706_100626796 | Ga0070706_1006267962 | 226 |
| 64 | 3300005468 | Ga0070707_100204658 | Ga0070707_1002046582 | 226 |
| 65 | 3300005471 | Ga0070698_100006428 | Ga0070698_10000642810 | 226 |
| 66 | 3300005471 | Ga0070698_100010289 | Ga0070698_1000102892 | 226 |
| 67 | 3300005471 | Ga0070698_100074933 | Ga0070698_1000749332 | 226 |
| 68 | 3300005518 | Ga0070699_100003974 | Ga0070699_10000397410 | 226 |
| 69 | 3300005518 | Ga0070699_100009544 | Ga0070699_1000095444 | 226 |
| 70 | 3300005518 | Ga0070699_100192497 | Ga0070699_1001924972 | 226 |
| 71 | 3300005535 | Ga0070684_100100333 | Ga0070684_1001003334 | 226 |
| 72 | 3300005543 | Ga0070672_100006410 | Ga0070672_1000064107 | 226 |
| 73 | 3300005543 | Ga0070672_100046878 | Ga0070672_1000468783 | 226 |
| 74 | 3300005543 | Ga0070672_100320157 | Ga0070672_1003201572 | 226 |
| 75 | 3300005545 | Ga0070695_100016446 | Ga0070695_1000164463 | 226 |
| 76 | 3300005545 | Ga0070695_100158857 | Ga0070695_1001588572 | 226 |
| 77 | 3300005545 | Ga0070695_100164787 | Ga0070695_1001647872 | 226 |
| 78 | 3300005546 | Ga0070696_100000400 | Ga0070696_10000040019 | 226 |
| 79 | 3300005546 | Ga0070696_100447630 | Ga0070696_1004476301 | 226 |
| 80 | 3300005549 | Ga0070704_100002527 | Ga0070704_1000025276 | 226 |
| 81 | 3300005549 | Ga0070704_100013602 | Ga0070704_1000136023 | 226 |
| 82 | 3300005549 | Ga0070704_100118774 | Ga0070704_1001187743 | 226 |
| 83 | 3300005564 | Ga0070664_100015290 | Ga0070664_1000152903 | 226 |
| 84 | 3300005577 | Ga0068857_100004987 | Ga0068857_1000049874 | 226 |
| 85 | 3300005577 | Ga0068857_100030064 | Ga0068857_1000300643 | 226 |
| 86 | 3300005577 | Ga0068857_100168956 | Ga0068857_1001689563 | 226 |
| 87 | 3300005615 | Ga0070702_100234020 | Ga0070702_1002340202 | 226 |
| 88 | 3300005617 | Ga0068859_100001058 | Ga0068859_1000010589 | 226 |
| 89 | 3300005617 | Ga0068859_100026627 | Ga0068859_1000266274 | 226 |
| 90 | 3300005617 | Ga0068859_100095395 | Ga0068859_1000953952 | 226 |
| 91 | 3300005617 | Ga0068859_100533292 | Ga0068859_1005332922 | 226 |
| 92 | 3300005617 | Ga0068859_100918793 | Ga0068859_1009187932 | 226 |
| 93 | 3300005618 | Ga0068864_100110593 | Ga0068864_1001105932 | 226 |
| 94 | 3300005618 | Ga0068864_100143801 | Ga0068864_1001438012 | 226 |
| 95 | 3300005618 | Ga0068864_100252153 | Ga0068864_1002521532 | 226 |
| 96 | 3300005618 | Ga0068864_100448857 | Ga0068864_1004488572 | 226 |
| 97 | 3300005719 | Ga0068861_100002675 | Ga0068861_1000026757 | 226 |
| 98 | 3300005840 | Ga0068870_10005707 | Ga0068870_100057073 | 226 |
| 99 | 3300005840 | Ga0068870_10006043 | Ga0068870_100060435 | 226 |
| 100 | 3300005840 | Ga0068870_10038507 | Ga0068870_100385072 | 226 |
| 101 | 3300005841 | Ga0068863_100047908 | Ga0068863_1000479083 | 226 |
| 102 | 3300005841 | Ga0068863_100299453 | Ga0068863_1002994532 | 226 |
| 103 | 3300005842 | Ga0068858_100005452 | Ga0068858_1000054523 | 226 |
| 104 | 3300005843 | Ga0068860_100007937 | Ga0068860_1000079379 | 226 |
| 105 | 3300005843 | Ga0068860_100449443 | Ga0068860_1004494432 | 226 |
| 106 | 3300005843 | Ga0068860_100567794 | Ga0068860_1005677942 | 226 |
| 107 | 3300005844 | Ga0068862_100002358 | Ga0068862_10000235810 | 226 |
| 108 | 3300005844 | Ga0068862_100248174 | Ga0068862_1002481742 | 226 |
| 109 | 3300005937 | Ga0081455_10531860 | Ga0081455_105318601 | 226 |
| 110 | 3300006042 | Ga0075368_10026625 | Ga0075368_100266252 | 226 |
| 111 | 3300006051 | Ga0075364_10090791 | Ga0075364_100907912 | 226 |
| 112 | 3300006178 | Ga0075367_10018484 | Ga0075367_100184842 | 226 |
| 113 | 3300006237 | Ga0097621_100372171 | Ga0097621_1003721712 | 226 |
| 114 | 3300006844 | Ga0075428_100034476 | Ga0075428_1000344764 | 226 |
| 115 | 3300006846 | Ga0075430_100007681 | Ga0075430_1000076817 | 226 |
| 116 | 3300006846 | Ga0075430_100088779 | Ga0075430_1000887793 | 226 |
| 117 | 3300006847 | Ga0075431_100077253 | Ga0075431_1000772534 | 226 |
| 118 | 3300006847 | Ga0075431_100118884 | Ga0075431_1001188843 | 226 |
| 119 | 3300006847 | Ga0075431_100135969 | Ga0075431_1001359692 | 226 |
| 120 | 3300006852 | Ga0075433_10022235 | Ga0075433_100222354 | 226 |
| 121 | 3300006852 | Ga0075433_10062241 | Ga0075433_100622412 | 226 |
| 122 | 3300006852 | Ga0075433_10091219 | Ga0075433_100912193 | 226 |
| 123 | 3300006852 | Ga0075433_10096850 | Ga0075433_100968504 | 226 |
| 124 | 3300006852 | Ga0075433_10106330 | Ga0075433_101063302 | 226 |
| 125 | 3300006871 | Ga0075434_100012939 | Ga0075434_1000129393 | 226 |
| 126 | 3300006871 | Ga0075434_100214583 | Ga0075434_1002145832 | 226 |
| 127 | 3300006871 | Ga0075434_100258003 | Ga0075434_1002580032 | 226 |
| 128 | 3300006880 | Ga0075429_100190172 | Ga0075429_1001901723 | 226 |
| 129 | 3300006880 | Ga0075429_100455320 | Ga0075429_1004553202 | 226 |
| 130 | 3300006881 | Ga0068865_100037247 | Ga0068865_1000372472 | 226 |
| 131 | 3300006881 | Ga0068865_100146018 | Ga0068865_1001460183 | 226 |
| 132 | 3300006931 | Ga0097620_100001058 | Ga0097620_1000010589 | 226 |
| 133 | 3300006931 | Ga0097620_100026627 | Ga0097620_1000266272 | 226 |
| 134 | 3300006931 | Ga0097620_100095399 | Ga0097620_1000953992 | 226 |
| 135 | 3300006931 | Ga0097620_100533290 | Ga0097620_1005332902 | 226 |
| 136 | 3300006931 | Ga0097620_100918974 | Ga0097620_1009189742 | 226 |
| 137 | 3300007076 | Ga0075435_100292094 | Ga0075435_1002920942 | 226 |
| 138 | 3300009094 | Ga0111539_10010458 | Ga0111539_100104588 | 226 |
| 139 | 3300009094 | Ga0111539_10023946 | Ga0111539_100239464 | 226 |
| 140 | 3300009094 | Ga0111539_10101534 | Ga0111539_101015343 | 226 |
| 141 | 3300009094 | Ga0111539_10114043 | Ga0111539_101140433 | 226 |
| 142 | 3300009094 | Ga0111539_10151691 | Ga0111539_101516912 | 226 |
| 143 | 3300009094 | Ga0111539_10377392 | Ga0111539_103773922 | 226 |
| 144 | 3300009098 | Ga0105245_10147149 | Ga0105245_101471493 | 226 |
| 145 | 3300009147 | Ga0114129_10001641 | Ga0114129_100016413 | 226 |
| 146 | 3300009147 | Ga0114129_10018179 | Ga0114129_100181794 | 226 |
| 147 | 3300009147 | Ga0114129_10042430 | Ga0114129_100424304 | 226 |
| 148 | 3300009147 | Ga0114129_10062321 | Ga0114129_100623214 | 226 |
| 149 | 3300009147 | Ga0114129_10214863 | Ga0114129_102148633 | 226 |
| 150 | 3300009147 | Ga0114129_10658639 | Ga0114129_106586392 | 226 |
| 151 | 3300009148 | Ga0105243_10197325 | Ga0105243_101973252 | 226 |
| 152 | 3300009176 | Ga0105242_10345687 | Ga0105242_103456872 | 226 |
| 153 | 3300009177 | Ga0105248_10133880 | Ga0105248_101338802 | 226 |
| 154 | 3300009553 | Ga0105249_10036507 | Ga0105249_100365073 | 226 |
| 155 | 3300009553 | Ga0105249_10470525 | Ga0105249_104705252 | 226 |
| 156 | 3300013306 | Ga0163162_10557253 | Ga0163162_105572532 | 226 |
| 157 | 3300013308 | Ga0157375_10003610 | Ga0157375_1000361011 | 226 |
| 158 | 3300014325 | Ga0163163_10156791 | Ga0163163_101567912 | 226 |
| 159 | 3300014326 | Ga0157380_10012074 | Ga0157380_100120742 | 226 |
| 160 | 3300014326 | Ga0157380_10052861 | Ga0157380_100528612 | 226 |
| 161 | 3300014326 | Ga0157380_10061399 | Ga0157380_100613994 | 226 |
| 162 | 3300014745 | Ga0157377_10136742 | Ga0157377_101367422 | 226 |
| 163 | 3300014969 | Ga0157376_10201685 | Ga0157376_102016852 | 226 |
| 164 | 3300017792 | Ga0163161_10424200 | Ga0163161_104242002 | 226 |
| 165 | 3300025893 | Ga0207682_10166794 | Ga0207682_101667942 | 226 |
| 166 | 3300025907 | Ga0207645_10017784 | Ga0207645_100177842 | 226 |
| 167 | 3300025908 | Ga0207643_10001995 | Ga0207643_100019959 | 226 |
| 168 | 3300025908 | Ga0207643_10003554 | Ga0207643_100035544 | 226 |
| 169 | 3300025908 | Ga0207643_10037281 | Ga0207643_100372812 | 226 |
| 170 | 3300025910 | Ga0207684_10145461 | Ga0207684_101454612 | 226 |
| 171 | 3300025910 | Ga0207684_10463351 | Ga0207684_104633512 | 226 |
| 172 | 3300025917 | Ga0207660_10118724 | Ga0207660_101187242 | 226 |
| 173 | 3300025918 | Ga0207662_10018825 | Ga0207662_100188253 | 226 |
| 174 | 3300025922 | Ga0207646_10300301 | Ga0207646_103003012 | 226 |
| 175 | 3300025922 | Ga0207646_10325677 | Ga0207646_103256772 | 226 |
| 176 | 3300025923 | Ga0207681_10010377 | Ga0207681_100103776 | 226 |
| 177 | 3300025923 | Ga0207681_10209949 | Ga0207681_102099493 | 226 |
| 178 | 3300025925 | Ga0207650_10048223 | Ga0207650_100482232 | 226 |
| 179 | 3300025925 | Ga0207650_10056655 | Ga0207650_100566551 | 226 |
| 180 | 3300025926 | Ga0207659_10001821 | Ga0207659_100018215 | 226 |
| 181 | 3300025926 | Ga0207659_10250244 | Ga0207659_102502442 | 226 |
| 182 | 3300025926 | Ga0207659_10287784 | Ga0207659_102877842 | 226 |
| 183 | 3300025928 | Ga0207700_10522955 | Ga0207700_105229552 | 226 |
| 184 | 3300025931 | Ga0207644_10145377 | Ga0207644_101453772 | 226 |
| 185 | 3300025933 | Ga0207706_10042749 | Ga0207706_100427492 | 226 |
| 186 | 3300025935 | Ga0207709_10118093 | Ga0207709_101180932 | 226 |
| 187 | 3300025935 | Ga0207709_10179572 | Ga0207709_101795722 | 226 |
| 188 | 3300025936 | Ga0207670_10017822 | Ga0207670_100178224 | 226 |
| 189 | 3300025937 | Ga0207669_10000865 | Ga0207669_100008659 | 226 |
| 190 | 3300025937 | Ga0207669_10135618 | Ga0207669_101356182 | 226 |
| 191 | 3300025938 | Ga0207704_10085638 | Ga0207704_100856382 | 226 |
| 192 | 3300025938 | Ga0207704_10136337 | Ga0207704_101363371 | 226 |
| 193 | 3300025938 | Ga0207704_10803673 | Ga0207704_108036731 | 226 |
| 194 | 3300025940 | Ga0207691_10052117 | Ga0207691_100521173 | 226 |
| 195 | 3300025940 | Ga0207691_10103200 | Ga0207691_101032003 | 226 |
| 196 | 3300025940 | Ga0207691_10216126 | Ga0207691_102161262 | 226 |
| 197 | 3300025941 | Ga0207711_10041582 | Ga0207711_100415823 | 226 |
| 198 | 3300025942 | Ga0207689_10043182 | Ga0207689_100431824 | 226 |
| 199 | 3300025942 | Ga0207689_10224666 | Ga0207689_102246662 | 226 |
| 200 | 3300025944 | Ga0207661_10000733 | Ga0207661_100007335 | 226 |
| 201 | 3300025944 | Ga0207661_10059677 | Ga0207661_100596771 | 226 |
| 202 | 3300025945 | Ga0207679_10030442 | Ga0207679_100304422 | 226 |
| 203 | 3300025960 | Ga0207651_10119250 | Ga0207651_101192502 | 226 |
| 204 | 3300025960 | Ga0207651_10573978 | Ga0207651_105739781 | 226 |
| 205 | 3300025961 | Ga0207712_10119944 | Ga0207712_101199442 | 226 |
| 206 | 3300025961 | Ga0207712_10218235 | Ga0207712_102182351 | 226 |
| 207 | 3300025972 | Ga0207668_10041095 | Ga0207668_100410954 | 226 |
| 208 | 3300025972 | Ga0207668_10145402 | Ga0207668_101454022 | 226 |
| 209 | 3300025986 | Ga0207658_10172123 | Ga0207658_101721234 | 226 |
| 210 | 3300026035 | Ga0207703_10014676 | Ga0207703_100146765 | 226 |
| 211 | 3300026041 | Ga0207639_10504697 | Ga0207639_105046972 | 226 |
| 212 | 3300026075 | Ga0207708_10020926 | Ga0207708_100209263 | 226 |
| 213 | 3300026075 | Ga0207708_10055041 | Ga0207708_100550413 | 226 |
| 214 | 3300026075 | Ga0207708_10217159 | Ga0207708_102171592 | 226 |
| 215 | 3300026088 | Ga0207641_10027782 | Ga0207641_100277822 | 226 |
| 216 | 3300026088 | Ga0207641_10202478 | Ga0207641_102024782 | 226 |
| 217 | 3300026089 | Ga0207648_10002044 | Ga0207648_1000204415 | 226 |
| 218 | 3300026089 | Ga0207648_10682401 | Ga0207648_106824012 | 226 |
| 219 | 3300026095 | Ga0207676_10003264 | Ga0207676_100032646 | 226 |
| 220 | 3300026095 | Ga0207676_10162349 | Ga0207676_101623492 | 226 |
| 221 | 3300026095 | Ga0207676_10568353 | Ga0207676_105683532 | 226 |
| 222 | 3300026116 | Ga0207674_10011409 | Ga0207674_100114098 | 226 |
| 223 | 3300026116 | Ga0207674_10040087 | Ga0207674_100400873 | 226 |
| 224 | 3300026118 | Ga0207675_100000566 | Ga0207675_10000056626 | 226 |
| 225 | 3300026118 | Ga0207675_100512171 | Ga0207675_1005121712 | 226 |
| 226 | 3300026121 | Ga0207683_10044065 | Ga0207683_100440653 | 226 |
| 227 | 3300027907 | Ga0207428_10001394 | Ga0207428_1000139410 | 226 |
| 228 | 3300027907 | Ga0207428_10003929 | Ga0207428_1000392913 | 226 |
| 229 | 3300027907 | Ga0207428_10105086 | Ga0207428_101050862 | 226 |
| 230 | 3300028380 | Ga0268265_10000816 | Ga0268265_1000081619 | 226 |
| 231 | 3300028381 | Ga0268264_10004728 | Ga0268264_100047289 | 226 |
| 232 | 3300028381 | Ga0268264_10021509 | Ga0268264_100215093 | 226 |
| 233 | 3300031548 | Ga0307408_100139775 | Ga0307408_1001397753 | 226 |
| 234 | 3300031852 | Ga0307410_10210972 | Ga0307410_102109721 | 226 |
| 235 | 3300031911 | Ga0307412_10517680 | Ga0307412_105176802 | 226 |
| 236 | 3300031995 | Ga0307409_100026757 | Ga0307409_1000267573 | 226 |
| 237 | 3300032002 | Ga0307416_100049921 | Ga0307416_1000499213 | 226 |
| 238 | 3300032002 | Ga0307416_100187249 | Ga0307416_1001872493 | 226 |
| 239 | 3300032004 | Ga0307414_10088140 | Ga0307414_100881402 | 226 |
| 240 | 3300032126 | Ga0307415_100134624 | Ga0307415_1001346242 | 226 |
| 241 | 3300032126 | Ga0307415_100405428 | Ga0307415_1004054282 | 226 |
| 242 | 3300036401 | Ga0373937_0139175 | Ga0373937_0139175_1369_2064 | 226 |
| 243 | 3300037471 | Ga0395905_0290118 | Ga0395905_0290118_221_904 | 226 |
| 244 | 3300038443 | Ga0395901_0270925 | Ga0395901_0270925_520_1203 | 226 |
| 245 | 3300039450 | Ga0436363_1570569 | Ga0436363_1570569_48_749 | 226 |
| 246 | 3300042437 | Ga0439444_0035117 | Ga0439444_0035117_37_723 | 226 |
| 247 | 3300045051 | Ga0451576_0022502 | Ga0451576_0022502_418_1104 | 226 |
| 248 | 3300045051 | Ga0451576_0043926 | Ga0451576_0043926_3151_3858 | 226 |
| 249 | 3300045051 | Ga0451576_0051453 | Ga0451576_0051453_2152_2853 | 226 |
| 250 | 3300045051 | Ga0451576_0108579 | Ga0451576_0108579_1024_1710 | 226 |
| 251 | 3300045051 | Ga0451576_0191289 | Ga0451576_0191289_1334_2020 | 226 |
| 252 | 3300045051 | Ga0451576_0370859 | Ga0451576_0370859_336_1037 | 226 |
| 253 | 3300046459 | Ga0495629_0138277 | Ga0495629_0138277_851_1552 | 226 |
| 254 | 3300046491 | Ga0495584_0012987 | Ga0495584_0012987_451_1143 | 226 |
| 255 | 3300046528 | Ga0495642_0054059 | Ga0495642_0054059_879_1571 | 226 |
| 256 | 3300046528 | Ga0495642_0217564 | Ga0495642_0217564_68_766 | 226 |
| 257 | 3300046537 | Ga0495598_0095332 | Ga0495598_0095332_145_837 | 226 |
| 258 | 3300046538 | Ga0495609_0081155 | Ga0495609_0081155_544_1236 | 226 |
| 259 | 3300046539 | Ga0495621_0011499 | Ga0495621_0011499_923_1624 | 226 |
| 260 | 3300046539 | Ga0495621_0035421 | Ga0495621_0035421_252_935 | 226 |
| 261 | 3300046615 | Ga0495656_0077226 | Ga0495656_0077226_76_768 | 226 |
| 262 | 3300046615 | Ga0495656_0148466 | Ga0495656_0148466_49_732 | 226 |
| 263 | 3300046615 | Ga0495656_0220878 | Ga0495656_0220878_66_749 | 226 |
| 264 | 3300046664 | Ga0495659_0030638 | Ga0495659_0030638_89_775 | 226 |
| 265 | 3300046664 | Ga0495659_0044286 | Ga0495659_0044286_749_1447 | 226 |
| 266 | 3300046664 | Ga0495659_0061432 | Ga0495659_0061432_564_1256 | 226 |
| 267 | 3300046674 | Ga0495588_0056363 | Ga0495588_0056363_1185_1877 | 226 |
| 268 | 3300046683 | Ga0495658_0222397 | Ga0495658_0222397_410_1102 | 226 |
| 269 | 3300046691 | Ga0495670_0065393 | Ga0495670_0065393_73_768 | 226 |
| 270 | 3300047318 | Ga0495636_0006584 | Ga0495636_0006584_3761_4459 | 226 |
| 271 | 3300047318 | Ga0495636_0087240 | Ga0495636_0087240_117_809 | 226 |
| 272 | 3300047320 | Ga0495672_0051308 | Ga0495672_0051308_1232_1930 | 226 |
| 273 | 3300047321 | Ga0495676_0055702 | Ga0495676_0055702_742_1443 | 226 |
| 274 | 3300047447 | Ga0495685_030259 | Ga0495685_030259_248_940 | 226 |
| 275 | 3300048913 | Ga0496110_0000920 | Ga0496110_0000920_10887_11570 | 226 |
| 276 | 3300049583 | Ga0501067_0021836 | Ga0501067_0021836_26_712 | 226 |
| 277 | 3300049585 | Ga0501069_0132254 | Ga0501069_0132254_637_1323 | 226 |
| 278 | 3300049589 | Ga0501073_0001725 | Ga0501073_0001725_4549_5232 | 226 |
| 279 | 3300050493 | nmdc:mga0k408_215576_c1 | nmdc:mga0k408_215576_c1_431_1126 | 226 |
| 280 | 3300050507 | nmdc:mga05p37_165176_c1 | nmdc:mga05p37_165176_c1_198_890 | 226 |
| 281 | 3300050507 | nmdc:mga05p37_2372_c1 | nmdc:mga05p37_2372_c1_15262_15963 | 226 |
| 282 | 3300050507 | nmdc:mga05p37_344995_c1 | nmdc:mga05p37_344995_c1_917_1600 | 226 |
| 283 | 3300050507 | nmdc:mga05p37_382019_c1 | nmdc:mga05p37_382019_c1_810_1508 | 226 |
| 284 | 3300050507 | nmdc:mga05p37_734208_c1 | nmdc:mga05p37_734208_c1_247_936 | 226 |
| 285 | 3300050507 | nmdc:mga05p37_7838_c1 | nmdc:mga05p37_7838_c1_374_1057 | 226 |
| 286 | 3300050508 | nmdc:mga09592_152881_c2 | nmdc:mga09592_152881_c2_326_1012 | 226 |
| 287 | 3300050508 | nmdc:mga09592_232262_c1 | nmdc:mga09592_232262_c1_624_1307 | 226 |
| 288 | 3300050508 | nmdc:mga09592_70623_c1 | nmdc:mga09592_70623_c1_2101_2802 | 226 |
| 289 | 3300050509 | nmdc:mga0qj67_528479_c1 | nmdc:mga0qj67_528479_c1_130_813 | 226 |
| 290 | 3300050509 | nmdc:mga0qj67_87686_c1 | nmdc:mga0qj67_87686_c1_894_1577 | 226 |
| 291 | 3300050510 | nmdc:mga06r32_228112_c1 | nmdc:mga06r32_228112_c1_494_1180 | 226 |
| 292 | 3300050511 | nmdc:mga08y16_12609_c1 | nmdc:mga08y16_12609_c1_4269_4952 | 226 |
| 293 | 3300050511 | nmdc:mga08y16_162855_c1 | nmdc:mga08y16_162855_c1_317_1000 | 226 |
| 294 | 3300050511 | nmdc:mga08y16_38388_c1 | nmdc:mga08y16_38388_c1_4095_4781 | 226 |
| 295 | 3300050511 | nmdc:mga08y16_61749_c1 | nmdc:mga08y16_61749_c1_2855_3538 | 226 |
| 296 | 3300050511 | nmdc:mga08y16_80211_c2 | nmdc:mga08y16_80211_c2_345_1028 | 226 |
| 297 | 3300050512 | nmdc:mga0n895_15412_c1 | nmdc:mga0n895_15412_c1_1455_2138 | 226 |
| 298 | 3300050512 | nmdc:mga0n895_238889_c1 | nmdc:mga0n895_238889_c1_1007_1699 | 226 |
| 299 | 3300050512 | nmdc:mga0n895_422285_c1 | nmdc:mga0n895_422285_c1_83_784 | 226 |
| 300 | 3300050513 | nmdc:mga0rr50_353755_c1 | nmdc:mga0rr50_353755_c1_516_1208 | 226 |
| 301 | 3300050513 | nmdc:mga0rr50_69980_c1 | nmdc:mga0rr50_69980_c1_908_1609 | 226 |
| 302 | 3300050513 | nmdc:mga0rr50_7931_c1 | nmdc:mga0rr50_7931_c1_3508_4191 | 226 |
| 303 | 3300050515 | nmdc:mga0a205_1361_c2 | nmdc:mga0a205_1361_c2_8035_8718 | 226 |
| 304 | 3300050515 | nmdc:mga0a205_156324_c1 | nmdc:mga0a205_156324_c1_1007_1699 | 226 |
| 305 | 3300050515 | nmdc:mga0a205_46508_c1 | nmdc:mga0a205_46508_c1_2479_3174 | 226 |
| 306 | 3300050515 | nmdc:mga0a205_66489_c1 | nmdc:mga0a205_66489_c1_645_1397 | 226 |
| 307 | 3300050515 | nmdc:mga0a205_93766_c1 | nmdc:mga0a205_93766_c1_1975_2658 | 226 |
| 308 | 3300053131 | Ga0500652_112848 | Ga0500652_112848_55_738 | 226 |
| 309 | 3300053139 | Ga0500568_0009641 | Ga0500568_0009641_1902_2600 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9761 | 1 | 120 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9746 | 3 | 118 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.974 | 3 | 118 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9732 | 3 | 118 |
| 2zwm-assembly1.cif.gz_B | crystal structure of yycf receiver domain from bacillus subtilis | 0.9712 | 1 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9931 | 2 | 79 | 3.40.50.2300 |
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9826 | 2 | 83 | 3.40.50.2300 |
| af_P9WGM7_2_84_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9803 | 2 | 77 | 3.40.50.2300 |
| af_Q2G2U6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9787 | 3 | 84 | 3.40.50.2300 |
| af_P69228_9_89_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9786 | 1 | 77 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1ATB7-F1-model_v4 | Two component transcriptional regulator, winged helix family | 0.8255 | 2 | 150 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A2S5LA93-F1-model_v4 | Two-component system response regulator KdpE | 0.7951 | 3 | 157 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A377DWT1-F1-model_v4 | Two-component response regulator | 0.7849 | 1 | 154 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A0R2PGL1-F1-model_v4 | Two-component system response regulator | 0.7774 | 2 | 157 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-T1ATB7-F1-model_v4 | Two component transcriptional regulator, winged helix family | 0.7759 | 2 | 150 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar