F400338

General Info

Members Datasets Scaffolds Average Seq Length
309 214 301 368

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0002039|Ga0453684_0002039_24047_25201
Length 384
Sequence MKTALITGITGQDGAYLAEYLLKKGYIVHGMKRRSSLFNTDRIDHLYQDPHVENRNLFLHYGDLTDSMNITRIIQEVQPDEIYNLAAMSHVAVSFETPEYVANADGIGTLRILEAVRLLGLTKKTRIYQASTSELYGLVQEVPQSEKTPFYPRSPYAVAKMYGYWITVNYREAYGMHASNGILFNHESPIRGETFVTRKVTRALSKIALGLQDAVFMGNLNSQRDWGHAKDYIRAMYLILQQEKPSDYVIATGITTTIRDFIDLAAQEIGLQLEFRGENADEIGVLVNVDQEKFIEKVGDKYLDQIVSRAAVKDVIVGVDKRYFRPTEVDLLIGDPTKSRTVLGWEPRYDLAALIADMMQSDIKLMQRETYLKEGGYDIMNYFE

Samples

Sample ID Description Type Environment
1 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
4 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
5 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
6 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
7 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
8 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
155 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
156 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
157 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
158 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
159 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
191 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
192 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
193 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
194 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
195 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
196 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
197 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
198 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
199 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
200 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
201 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
212 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
213 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 0.32
Isolates 2.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.09
Nodule 0.65
Rhizoplane 1.62
Rhizosphere 84.47
Stem 0
Stem Tuber 0
Unclassified 5.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10059364 3300003322 Bacteria 7924
2 rootL2_10165617 3300003322 Bacteria 3485
3 Ga0032354_1082644 3300003693 Bacteria 2217
4 Ga0055539_1000314 3300003752 Bacteria 25189
5 Ga0055533_1000043 3300003756 Bacteria 229262
6 Ga0055526_1020240 3300003771 Bacteria 2379
7 Ga0065714_10079532 3300005288 Bacteria 2504
8 Ga0070658_10038506 3300005327 Bacteria 3855
9 Ga0070658_10052418 3300005327 Bacteria 3309
10 Ga0070658_10274866 3300005327 Bacteria 1433
11 Ga0070683_100006684 3300005329 Bacteria 9681
12 Ga0070690_100005240 3300005330 Bacteria 7266
13 Ga0068869_100008093 3300005334 Bacteria 6761
14 Ga0070666_10001632 3300005335 Bacteria 13650
15 Ga0068868_100001711 3300005338 Bacteria 15014
16 Ga0068868_100016631 3300005338 Bacteria 5469
17 Ga0070689_100016452 3300005340 Bacteria 5413
18 Ga0070689_100075355 3300005340 Bacteria 2642
19 Ga0070689_100301440 3300005340 Bacteria 1334
20 Ga0070661_100224793 3300005344 Bacteria 1441
21 Ga0070675_100039657 3300005354 Bacteria 3844
22 Ga0070675_100116765 3300005354 Bacteria 2264
23 Ga0070675_100172154 3300005354 Bacteria 1868
24 Ga0070675_100205154 3300005354 Bacteria 1712
25 Ga0070671_100011735 3300005355 Bacteria 7047
26 Ga0070671_100022761 3300005355 Bacteria 5119
27 Ga0070671_100025118 3300005355 Bacteria 4885
28 Ga0070673_100029243 3300005364 Bacteria 4107
29 Ga0070673_100030057 3300005364 Bacteria 4060
30 Ga0070673_100124797 3300005364 Bacteria 2153
31 Ga0070659_100017895 3300005366 Bacteria 5339
32 Ga0070667_100003595 3300005367 Bacteria 13187
33 Ga0070667_100016999 3300005367 Bacteria 6022
34 Ga0070700_100000251 3300005441 Bacteria 28879
35 Ga0070678_100013590 3300005456 Bacteria 5112
36 Ga0070678_100093384 3300005456 Bacteria 2313
37 Ga0070681_10009141 3300005458 Bacteria 9737
38 Ga0068867_100001121 3300005459 Bacteria 18333
39 Ga0070698_100002653 3300005471 Bacteria 19726
40 Ga0070698_100005248 3300005471 Bacteria 14175
41 Ga0070698_100039979 3300005471 Bacteria 4822
42 Ga0070684_100001894 3300005535 Bacteria 15331
43 Ga0070672_100041655 3300005543 Bacteria 3532
44 Ga0070672_100104842 3300005543 Bacteria 2298
45 Ga0070686_100001500 3300005544 Bacteria 13119
46 Ga0070696_100016224 3300005546 Bacteria 5012
47 Ga0070693_100007604 3300005547 Bacteria 5305
48 Ga0070693_100092897 3300005547 Bacteria 1823
49 Ga0070665_100007526 3300005548 Bacteria 11073
50 Ga0070704_100089333 3300005549 Bacteria 2292
51 Ga0070664_100129172 3300005564 Bacteria 2219
52 Ga0068857_100029094 3300005577 Bacteria 4875
53 Ga0070702_100003313 3300005615 Bacteria 7186
54 Ga0070702_100033838 3300005615 Bacteria 2813
55 Ga0068852_100019630 3300005616 Bacteria 5355
56 Ga0068859_100007469 3300005617 Bacteria 11096
57 Ga0068859_100007750 3300005617 Bacteria 10900
58 Ga0068859_100011508 3300005617 Bacteria 8894
59 Ga0068859_100154980 3300005617 Bacteria 2368
60 Ga0068864_100205293 3300005618 Bacteria 1812
61 Ga0068866_10001503 3300005718 Bacteria 9933
62 Ga0068861_100002831 3300005719 Bacteria 11407
63 Ga0068851_10009475 3300005834 Bacteria 4530
64 Ga0068851_10065366 3300005834 Bacteria 1871
65 Ga0068863_100033750 3300005841 Bacteria 4876
66 Ga0068858_100012895 3300005842 Bacteria 7882
67 Ga0068858_100032111 3300005842 Bacteria 4877
68 Ga0068858_100152658 3300005842 Bacteria 2172
69 Ga0068860_100003237 3300005843 Bacteria 16794
70 Ga0068860_100005896 3300005843 Bacteria 12335
71 Ga0068860_100038850 3300005843 Bacteria 4554
72 Ga0068862_100025064 3300005844 Bacteria 5006
73 Ga0075366_10049667 3300006195 Bacteria 2489
74 Ga0075366_10098470 3300006195 Bacteria 1754
75 Ga0075366_10139246 3300006195 Bacteria 1466
76 Ga0097621_100006983 3300006237 Bacteria 8042
77 Ga0097621_100010906 3300006237 Bacteria 6671
78 Ga0097621_100128953 3300006237 Bacteria 2151
79 Ga0075370_10001816 3300006353 Bacteria 9552
80 Ga0068871_100001992 3300006358 Bacteria 13825
81 Ga0068871_100032487 3300006358 Bacteria 4124
82 Ga0075428_100010603 3300006844 Bacteria 10243
83 Ga0075428_100062501 3300006844 Bacteria 4076
84 Ga0075431_100171781 3300006847 Bacteria 2227
85 Ga0075429_100021893 3300006880 Bacteria 5541
86 Ga0068865_100005736 3300006881 Bacteria 7544
87 Ga0068865_100242093 3300006881 Bacteria 1420
88 Ga0097620_100007469 3300006931 Bacteria 11096
89 Ga0097620_100007750 3300006931 Bacteria 10900
90 Ga0097620_100011508 3300006931 Bacteria 8894
91 Ga0097620_100154982 3300006931 Bacteria 2368
92 Ga0079104_1000001 3300006946 Bacteria 521847
93 Ga0111539_10228072 3300009094 Bacteria 2169
94 Ga0111539_10488648 3300009094 Bacteria 1434
95 Ga0105245_10000503 3300009098 Bacteria 35833
96 Ga0105245_10043230 3300009098 Bacteria 4019
97 Ga0105247_10001465 3300009101 Bacteria 16996
98 Ga0105243_10003257 3300009148 Bacteria 13213
99 Ga0105242_10004193 3300009176 Bacteria 11239
100 Ga0105248_10271591 3300009177 Bacteria 1909
101 Ga0105238_10378112 3300009551 Bacteria 1407
102 Ga0105249_10010761 3300009553 Bacteria 8038
103 Ga0105239_10038833 3300010375 Bacteria 5216
104 Ga0157374_10010333 3300013296 Bacteria 8028
105 Ga0157374_10123594 3300013296 Bacteria 2500
106 Ga0157378_10014702 3300013297 Bacteria 6856
107 Ga0157378_10014912 3300013297 Bacteria 6801
108 Ga0157378_10021640 3300013297 Bacteria 5655
109 Ga0157378_10021840 3300013297 Bacteria 5627
110 Ga0157378_10057026 3300013297 Bacteria 3481
111 Ga0157378_10328676 3300013297 Bacteria 1487
112 Ga0163162_10199667 3300013306 Bacteria 2128
113 Ga0163162_10275368 3300013306 Bacteria 1815
114 Ga0157372_10056408 3300013307 Bacteria 4389
115 Ga0163163_10004647 3300014325 Bacteria 11735
116 Ga0157380_10010574 3300014326 Bacteria 6637
117 Ga0157377_10002753 3300014745 Bacteria 7827
118 Ga0157377_10034111 3300014745 Bacteria 2783
119 Ga0157379_10007489 3300014968 Bacteria 9449
120 Ga0157379_10350399 3300014968 Bacteria 1352
121 Ga0157376_10241846 3300014969 Bacteria 1682
122 Ga0163161_10158922 3300017792 Bacteria 1722
123 Ga0213872_10000566 3300021361 Bacteria 28609
124 Ga0209674_100067 3300025226 Bacteria 253824
125 Ga0209563_100068 3300025230 Bacteria 254802
126 Ga0207427_101341 3300025231 Bacteria 9119
127 Ga0209677_100049 3300025253 Bacteria 180721
128 Ga0209759_1000443 3300025256 Bacteria 48263
129 Ga0209564_1005019 3300025295 Bacteria 7761
130 Ga0209050_1032342 3300025298 Bacteria 1611
131 Ga0207426_1012215 3300025302 Bacteria 3237
132 Ga0207697_10025756 3300025315 Bacteria 2405
133 Ga0207642_10003662 3300025899 Bacteria 4879
134 Ga0207710_10003815 3300025900 Bacteria 6659
135 Ga0207680_10001344 3300025903 Bacteria 11635
136 Ga0207645_10021073 3300025907 Bacteria 4255
137 Ga0207643_10137883 3300025908 Bacteria 1455
138 Ga0207705_10099579 3300025909 Bacteria 2137
139 Ga0207707_10009441 3300025912 Bacteria 8461
140 Ga0207660_10078266 3300025917 Bacteria 2423
141 Ga0207662_10021088 3300025918 Bacteria 3720
142 Ga0207649_10062300 3300025920 Bacteria 2351
143 Ga0207649_10076536 3300025920 Bacteria 2153
144 Ga0207649_10227599 3300025920 Bacteria 1332
145 Ga0207681_10228634 3300025923 Bacteria 1443
146 Ga0207650_10004145 3300025925 Bacteria 9909
147 Ga0207659_10027961 3300025926 Bacteria 3825
148 Ga0207659_10153739 3300025926 Bacteria 1799
149 Ga0207687_10009290 3300025927 Bacteria 6431
150 Ga0207687_10259976 3300025927 Bacteria 1384
151 Ga0207644_10012557 3300025931 Bacteria 5629
152 Ga0207644_10223970 3300025931 Bacteria 1492
153 Ga0207686_10018334 3300025934 Bacteria 3962
154 Ga0207709_10013282 3300025935 Bacteria 4543
155 Ga0207670_10022629 3300025936 Bacteria 3898
156 Ga0207704_10045593 3300025938 Bacteria 2606
157 Ga0207691_10023601 3300025940 Bacteria 5792
158 Ga0207691_10108960 3300025940 Bacteria 2464
159 Ga0207689_10003415 3300025942 Bacteria 14498
160 Ga0207689_10016468 3300025942 Bacteria 6257
161 Ga0207689_10108259 3300025942 Bacteria 2284
162 Ga0207661_10008081 3300025944 Bacteria 7506
163 Ga0207679_10057102 3300025945 Bacteria 2885
164 Ga0207651_10007927 3300025960 Bacteria 5692
165 Ga0207651_10046726 3300025960 Bacteria 2914
166 Ga0207712_10062067 3300025961 Bacteria 2655
167 Ga0207658_10013982 3300025986 Bacteria 5494
168 Ga0207658_10094528 3300025986 Bacteria 2326
169 Ga0207658_10098261 3300025986 Bacteria 2287
170 Ga0207677_10145903 3300026023 Bacteria 1818
171 Ga0207703_10195529 3300026035 Bacteria 1794
172 Ga0207703_10244639 3300026035 Bacteria 1614
173 Ga0207708_10031734 3300026075 Bacteria 4011
174 Ga0207708_10220497 3300026075 Bacteria 1519
175 Ga0207641_10002912 3300026088 Bacteria 15494
176 Ga0207641_10023892 3300026088 Bacteria 5039
177 Ga0207641_10155849 3300026088 Bacteria 2072
178 Ga0207648_10003132 3300026089 Bacteria 17452
179 Ga0207648_10278530 3300026089 Bacteria 1495
180 Ga0207676_10075152 3300026095 Bacteria 2725
181 Ga0207676_10285159 3300026095 Bacteria 1501
182 Ga0207674_10004856 3300026116 Bacteria 16098
183 Ga0207675_100004569 3300026118 Bacteria 13354
184 Ga0207683_10022617 3300026121 Bacteria 5399
185 Ga0207698_10159277 3300026142 Bacteria 1972
186 Ga0209281_1000151 3300027111 Bacteria 167268
187 Ga0268266_10010998 3300028379 Bacteria 7875
188 Ga0268265_10062418 3300028380 Bacteria 2863
189 Ga0268264_10032822 3300028381 Bacteria 4260
190 Ga0268264_10050572 3300028381 Bacteria 3461
191 Ga0268264_10074717 3300028381 Bacteria 2880
192 Ga0265336_10000011 3300028666 Bacteria 275816
193 Ga0307515_10000655 3300028794 Bacteria 79837
194 Ga0265338_10014981 3300028800 Bacteria 8569
195 Ga0265324_10000968 3300029957 Bacteria 17842
196 Ga0265327_10000012 3300031251 Bacteria 530403
197 Ga0307513_10030364 3300031456 Bacteria 6141
198 Ga0307509_10012377 3300031507 Bacteria 10208
199 Ga0307508_10000686 3300031616 Bacteria 40604
200 Ga0307508_10211656 3300031616 Bacteria 1539
201 Ga0307415_100094583 3300032126 Bacteria 2173
202 Ga0307510_10022214 3300033180 Bacteria 7374
203 Ga0373948_0012056 3300034817 Bacteria 1539
204 Ga0373934_0019134 3300035086 Bacteria 2626
205 Ga0373939_0000150 3300035114 Bacteria 19585
206 Ga0373931_0000597 3300035691 Bacteria 14897
207 Ga0316584_0031920 3300036712 Bacteria 3895
208 Ga0395898_0010362 3300037466 Bacteria 9749
209 Ga0395905_0001420 3300037471 Bacteria 28906
210 Ga0395905_0001825 3300037471 Bacteria 24608
211 Ga0395905_0026733 3300037471 Bacteria 5442
212 Ga0395901_0003389 3300038443 Bacteria 16046
213 Ga0400483_065274 3300039062 Bacteria 1879
214 Ga0400483_111530 3300039062 Bacteria 4263
215 Ga0400483_189257 3300039062 Bacteria 4009
216 Ga0436365_1479007 3300039437 Bacteria 1650
217 Ga0436360_1173569 3300039438 Bacteria 2153
218 Ga0436361_0969594 3300039447 Bacteria 2206
219 Ga0439447_001010 3300041407 Bacteria 10250
220 Ga0450923_001916 3300042125 Bacteria 2875
221 Ga0450888_000204 3300042126 Bacteria 5299
222 Ga0450890_000091 3300042127 Bacteria 15118
223 Ga0450891_001478 3300042129 Bacteria 2428
224 Ga0450892_000214 3300042130 Bacteria 6910
225 Ga0439464_0000834 3300042439 Bacteria 6811
226 Ga0453683_0002713 3300044673 Bacteria 13510
227 Ga0453683_0012419 3300044673 Bacteria 5581
228 Ga0453683_0072501 3300044673 Bacteria 2155
229 Ga0466965_0042102 3300044683 Bacteria 2251
230 Ga0466961_0038130 3300044693 Bacteria 3083
231 Ga0453684_0002039 3300044712 Bacteria 51562
232 Ga0453684_0006401 3300044712 Bacteria 22421
233 Ga0453684_0024115 3300044712 Bacteria 8911
234 Ga0453684_0042295 3300044712 Bacteria 6144
235 Ga0453684_0074981 3300044712 Bacteria 4255
236 Ga0453684_0195596 3300044712 Bacteria 2362
237 Ga0453684_0284611 3300044712 Bacteria 1884
238 Ga0466957_0095089 3300044842 Bacteria 1871
239 Ga0451576_0002222 3300045051 Bacteria 29859
240 Ga0451576_0004896 3300045051 Bacteria 17110
241 Ga0451576_0031094 3300045051 Bacteria 5695
242 Ga0466958_0001524 3300045836 Bacteria 11104
243 Ga0495580_0096148 3300046472 Bacteria 2060
244 Ga0495582_0197429 3300046473 Bacteria 1149
245 Ga0495633_0000089 3300046558 Bacteria 123616
246 Ga0495625_0054436 3300046660 Bacteria 2858
247 Ga0495659_0001273 3300046664 Bacteria 8700
248 Ga0495669_0002968 3300046684 Bacteria 6969
249 Ga0495686_0001993 3300047472 Bacteria 20281
250 Ga0496101_0173254 3300048904 Bacteria 1659
251 Ga0496104_0047510 3300048907 Bacteria 4045
252 Ga0496105_0012102 3300048908 Bacteria 6832
253 Ga0496109_0002899 3300048912 Bacteria 14331
254 Ga0496109_0110009 3300048912 Bacteria 2561
255 Ga0501298_005827 3300049521 Bacteria 1995
256 Ga0501033_0068209 3300049570 Bacteria 2615
257 Ga0501034_0002811 3300049571 Bacteria 20358
258 Ga0501036_0138353 3300049572 Bacteria 2055
259 Ga0501038_0001736 3300049574 Bacteria 20261
260 Ga0501038_0005499 3300049574 Bacteria 11761
261 Ga0501039_0015737 3300049575 Bacteria 5789
262 Ga0501043_0020117 3300049579 Bacteria 5238
263 Ga0501046_0018235 3300049580 Bacteria 5844
264 Ga0501047_0000127 3300049581 Bacteria 93760
265 Ga0501047_0019071 3300049581 Bacteria 6581
266 Ga0501047_0039224 3300049581 Bacteria 4582
267 Ga0501047_0203657 3300049581 Bacteria 1839
268 Ga0501070_0036529 3300049586 Bacteria 4102
269 Ga0501070_0044555 3300049586 Bacteria 3691
270 Ga0501070_0097985 3300049586 Bacteria 2425
271 Ga0501074_0003047 3300049590 Bacteria 11811
272 Ga0501201_000538 3300049651 Bacteria 3515
273 Ga0501202_001797 3300049652 Bacteria 3508
274 Ga0501207_001176 3300049654 Bacteria 3215
275 Ga0501217_004723 3300049661 Bacteria 2811
276 Ga0501223_001080 3300049663 Bacteria 6424
277 Ga0501233_008107 3300049668 Bacteria 2018
278 Ga0501235_001997 3300049669 Bacteria 4371
279 Ga0501243_002466 3300049675 Bacteria 2714
280 Ga0501252_002452 3300049682 Bacteria 1841
281 Ga0501259_001771 3300049688 Bacteria 3576
282 Ga0501260_003521 3300049689 Bacteria 1410
283 Ga0501245_000277 3300049708 Bacteria 5962
284 Ga0501080_0027496 3300049742 Bacteria 5289
285 Ga0501080_0128430 3300049742 Bacteria 2347
286 Ga0501265_001647 3300049762 Bacteria 2523
287 Ga0501044_0006787 3300049823 Bacteria 12617
288 Ga0501044_0033875 3300049823 Bacteria 5363
289 nmdc:mga0k408_36118_c2 3300050493 Bacteria 1503
290 nmdc:mga0k408_410_c1 3300050493 Bacteria 23446
291 nmdc:mga0k408_92671_c1 3300050493 Bacteria 1776
292 nmdc:mga07m45_2855_c1 3300050496 Bacteria 8179
293 nmdc:mga08y16_211515_c1 3300050511 Bacteria 2008
294 Ga0500578_0000079 3300053086 Bacteria 107137
295 Ga0500578_0050086 3300053086 Bacteria 2679
296 Ga0500658_0000010 3300053134 Bacteria 248149
297 Ga0500568_0003456 3300053139 Bacteria 8799
298 Ga0500588_0001545 3300053146 Bacteria 4421
299 Ga0500619_000016 3300053154 Bacteria 54289
300 Ga0500645_000535 3300053730 Bacteria 25399
301 Ga0466962_0001148 3300061719 Bacteria 12224

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0042102 Ga0466965_0042102_235_1260 319
2 3300061719 Ga0466962_0001148 Ga0466962_0001148_1263_2288 319
3 3300046473 Ga0495582_0197429 Ga0495582_0197429_80_1066 328
4 iso_pu_bacteria 2919114240 2919117891 330
5 3300026089 Ga0207648_10278530 Ga0207648_102785301 334
6 3300028800 Ga0265338_10014981 Ga0265338_100149811 334
7 3300048904 Ga0496101_0173254 Ga0496101_0173254_628_1632 334
8 3300005456 Ga0070678_100093384 Ga0070678_1000933842 337
9 3300025908 Ga0207643_10137883 Ga0207643_101378831 337
10 3300049581 Ga0501047_0000127 Ga0501047_0000127_77814_78827 337
11 3300050493 nmdc:mga0k408_36118_c2 nmdc:mga0k408_36118_c2_55_1089 344
12 3300003693 Ga0032354_1082644 Ga0032354_10826441 353
13 3300005548 Ga0070665_100007526 Ga0070665_10000752611 353
14 3300028379 Ga0268266_10010998 Ga0268266_100109984 353
15 3300049570 Ga0501033_0068209 Ga0501033_0068209_1528_2604 353
16 3300049572 Ga0501036_0138353 Ga0501036_0138353_239_1384 353
17 3300049574 Ga0501038_0005499 Ga0501038_0005499_5498_6643 353
18 3300049575 Ga0501039_0015737 Ga0501039_0015737_3298_4443 353
19 3300049586 Ga0501070_0097985 Ga0501070_0097985_402_1547 353
20 3300049742 Ga0501080_0128430 Ga0501080_0128430_826_1971 353
21 3300049823 Ga0501044_0006787 Ga0501044_0006787_9996_11141 353
22 3300005547 Ga0070693_100092897 Ga0070693_1000928972 356
23 3300017792 Ga0163161_10158922 Ga0163161_101589222 356
24 3300025315 Ga0207697_10025756 Ga0207697_100257562 356
25 3300005458 Ga0070681_10009141 Ga0070681_100091417 359
26 3300005577 Ga0068857_100029094 Ga0068857_1000290943 359
27 3300025912 Ga0207707_10009441 Ga0207707_100094414 359
28 3300005617 Ga0068859_100011508 Ga0068859_1000115087 360
29 3300006931 Ga0097620_100011508 Ga0097620_1000115087 360
30 3300046684 Ga0495669_0002968 Ga0495669_0002968_3496_4578 360
31 3300005330 Ga0070690_100005240 Ga0070690_1000052406 361
32 3300005334 Ga0068869_100008093 Ga0068869_1000080936 361
33 3300005340 Ga0070689_100016452 Ga0070689_1000164526 361
34 3300005441 Ga0070700_100000251 Ga0070700_1000002513 361
35 3300005459 Ga0068867_100001121 Ga0068867_10000112118 361
36 3300005544 Ga0070686_100001500 Ga0070686_1000015006 361
37 3300005546 Ga0070696_100016224 Ga0070696_1000162242 361
38 3300005549 Ga0070704_100089333 Ga0070704_1000893332 361
39 3300005564 Ga0070664_100129172 Ga0070664_1001291722 361
40 3300005615 Ga0070702_100003313 Ga0070702_1000033136 361
41 3300005617 Ga0068859_100007750 Ga0068859_1000077506 361
42 3300005718 Ga0068866_10001503 Ga0068866_100015039 361
43 3300005719 Ga0068861_100002831 Ga0068861_1000028318 361
44 3300005842 Ga0068858_100032111 Ga0068858_1000321114 361
45 3300005843 Ga0068860_100038850 Ga0068860_1000388503 361
46 3300005844 Ga0068862_100025064 Ga0068862_1000250644 361
47 3300006237 Ga0097621_100006983 Ga0097621_1000069834 361
48 3300006358 Ga0068871_100001992 Ga0068871_1000019927 361
49 3300006881 Ga0068865_100005736 Ga0068865_1000057364 361
50 3300006931 Ga0097620_100007750 Ga0097620_1000077506 361
51 3300009098 Ga0105245_10000503 Ga0105245_1000050310 361
52 3300009148 Ga0105243_10003257 Ga0105243_100032575 361
53 3300009176 Ga0105242_10004193 Ga0105242_100041935 361
54 3300009177 Ga0105248_10271591 Ga0105248_102715912 361
55 3300009553 Ga0105249_10010761 Ga0105249_100107616 361
56 3300013297 Ga0157378_10014912 Ga0157378_100149124 361
57 3300014969 Ga0157376_10241846 Ga0157376_102418462 361
58 3300025899 Ga0207642_10003662 Ga0207642_100036622 361
59 3300025917 Ga0207660_10078266 Ga0207660_100782663 361
60 3300025927 Ga0207687_10009290 Ga0207687_100092903 361
61 3300025935 Ga0207709_10013282 Ga0207709_100132823 361
62 3300025936 Ga0207670_10022629 Ga0207670_100226292 361
63 3300025938 Ga0207704_10045593 Ga0207704_100455932 361
64 3300025942 Ga0207689_10003415 Ga0207689_100034157 361
65 3300025961 Ga0207712_10062067 Ga0207712_100620672 361
66 3300026035 Ga0207703_10195529 Ga0207703_101955292 361
67 3300026075 Ga0207708_10031734 Ga0207708_100317343 361
68 3300026089 Ga0207648_10003132 Ga0207648_1000313219 361
69 3300026118 Ga0207675_100004569 Ga0207675_1000045699 361
70 3300028380 Ga0268265_10062418 Ga0268265_100624182 361
71 3300028381 Ga0268264_10032822 Ga0268264_100328222 361
72 3300044673 Ga0453683_0012419 Ga0453683_0012419_706_1821 361
73 3300005335 Ga0070666_10001632 Ga0070666_100016328 362
74 3300005338 Ga0068868_100016631 Ga0068868_1000166315 362
75 3300005340 Ga0070689_100075355 Ga0070689_1000753553 362
76 3300005355 Ga0070671_100025118 Ga0070671_1000251182 362
77 3300005364 Ga0070673_100124797 Ga0070673_1001247972 362
78 3300005367 Ga0070667_100016999 Ga0070667_1000169993 362
79 3300005547 Ga0070693_100007604 Ga0070693_1000076044 362
80 3300005617 Ga0068859_100154980 Ga0068859_1001549802 362
81 3300005842 Ga0068858_100012895 Ga0068858_1000128953 362
82 3300005843 Ga0068860_100003237 Ga0068860_10000323714 362
83 3300006237 Ga0097621_100010906 Ga0097621_1000109064 362
84 3300006358 Ga0068871_100032487 Ga0068871_1000324872 362
85 3300006881 Ga0068865_100242093 Ga0068865_1002420932 362
86 3300006931 Ga0097620_100154982 Ga0097620_1001549822 362
87 3300009098 Ga0105245_10043230 Ga0105245_100432302 362
88 3300009551 Ga0105238_10378112 Ga0105238_103781121 362
89 3300013296 Ga0157374_10123594 Ga0157374_101235942 362
90 3300013297 Ga0157378_10057026 Ga0157378_100570263 362
91 3300013306 Ga0163162_10275368 Ga0163162_102753681 362
92 3300014325 Ga0163163_10004647 Ga0163163_100046479 362
93 3300014968 Ga0157379_10007489 Ga0157379_100074898 362
94 3300025903 Ga0207680_10001344 Ga0207680_100013445 362
95 3300025920 Ga0207649_10227599 Ga0207649_102275992 362
96 3300025927 Ga0207687_10259976 Ga0207687_102599762 362
97 3300025934 Ga0207686_10018334 Ga0207686_100183342 362
98 3300025986 Ga0207658_10094528 Ga0207658_100945282 362
99 3300025986 Ga0207658_10098261 Ga0207658_100982612 362
100 3300026088 Ga0207641_10023892 Ga0207641_100238923 362
101 3300026095 Ga0207676_10075152 Ga0207676_100751522 362
102 3300028381 Ga0268264_10050572 Ga0268264_100505721 362
103 3300032126 Ga0307415_100094583 Ga0307415_1000945832 362
104 3300039438 Ga0436360_1173569 Ga0436360_1173569_748_1836 362
105 3300039447 Ga0436361_0969594 Ga0436361_0969594_44_1132 362
106 3300046664 Ga0495659_0001273 Ga0495659_0001273_578_1690 362
107 3300048907 Ga0496104_0047510 Ga0496104_0047510_1782_2870 362
108 3300048908 Ga0496105_0012102 Ga0496105_0012102_3804_4892 362
109 3300048912 Ga0496109_0002899 Ga0496109_0002899_430_1518 362
110 iso_pu_bacteria 2818991460 2819676529 365
111 3300044673 Ga0453683_0002713 Ga0453683_0002713_11984_13141 366
112 3300044712 Ga0453684_0074981 Ga0453684_0074981_1920_3077 366
113 iso_pu_bacteria 2929177148 2929178103 366
114 iso_pu_bacteria 2945977869 2945980465 366
115 iso_pu_bacteria 2946013367 2946013673 366
116 3300031507 Ga0307509_10012377 Ga0307509_1001237710 368
117 3300045836 Ga0466958_0001524 Ga0466958_0001524_522_1634 368
118 3300003752 Ga0055539_1000314 Ga0055539_100031410 369
119 3300003756 Ga0055533_1000043 Ga0055533_100004352 369
120 3300005327 Ga0070658_10038506 Ga0070658_100385062 369
121 3300005327 Ga0070658_10052418 Ga0070658_100524183 369
122 3300005329 Ga0070683_100006684 Ga0070683_1000066848 369
123 3300005344 Ga0070661_100224793 Ga0070661_1002247932 369
124 3300005354 Ga0070675_100116765 Ga0070675_1001167652 369
125 3300005354 Ga0070675_100172154 Ga0070675_1001721542 369
126 3300005355 Ga0070671_100022761 Ga0070671_1000227612 369
127 3300005366 Ga0070659_100017895 Ga0070659_1000178955 369
128 3300005535 Ga0070684_100001894 Ga0070684_10000189410 369
129 3300005543 Ga0070672_100104842 Ga0070672_1001048422 369
130 3300005616 Ga0068852_100019630 Ga0068852_1000196302 369
131 3300005618 Ga0068864_100205293 Ga0068864_1002052932 369
132 3300006195 Ga0075366_10049667 Ga0075366_100496672 369
133 3300006195 Ga0075366_10139246 Ga0075366_101392462 369
134 3300006353 Ga0075370_10001816 Ga0075370_100018168 369
135 3300021361 Ga0213872_10000566 Ga0213872_1000056620 369
136 3300025226 Ga0209674_100067 Ga0209674_10006752 369
137 3300025230 Ga0209563_100068 Ga0209563_10006852 369
138 3300025231 Ga0207427_101341 Ga0207427_1013412 369
139 3300025253 Ga0209677_100049 Ga0209677_100049109 369
140 3300025256 Ga0209759_1000443 Ga0209759_100044316 369
141 3300025909 Ga0207705_10099579 Ga0207705_100995792 369
142 3300025920 Ga0207649_10062300 Ga0207649_100623002 369
143 3300025920 Ga0207649_10076536 Ga0207649_100765362 369
144 3300025926 Ga0207659_10153739 Ga0207659_101537391 369
145 3300025931 Ga0207644_10012557 Ga0207644_100125575 369
146 3300025931 Ga0207644_10223970 Ga0207644_102239702 369
147 3300025940 Ga0207691_10023601 Ga0207691_100236015 369
148 3300025944 Ga0207661_10008081 Ga0207661_100080813 369
149 3300025945 Ga0207679_10057102 Ga0207679_100571022 369
150 3300025960 Ga0207651_10007927 Ga0207651_100079273 369
151 3300026075 Ga0207708_10220497 Ga0207708_102204971 369
152 3300026095 Ga0207676_10285159 Ga0207676_102851592 369
153 3300026116 Ga0207674_10004856 Ga0207674_100048564 369
154 3300028666 Ga0265336_10000011 Ga0265336_1000001142 369
155 3300028794 Ga0307515_10000655 Ga0307515_1000065514 369
156 3300029957 Ga0265324_10000968 Ga0265324_100009686 369
157 3300033180 Ga0307510_10022214 Ga0307510_100222148 369
158 3300034817 Ga0373948_0012056 Ga0373948_0012056_177_1343 369
159 3300035086 Ga0373934_0019134 Ga0373934_0019134_1216_2337 369
160 3300035114 Ga0373939_0000150 Ga0373939_0000150_12143_13267 369
161 3300035691 Ga0373931_0000597 Ga0373931_0000597_13717_14841 369
162 3300037466 Ga0395898_0010362 Ga0395898_0010362_29_1150 369
163 3300037471 Ga0395905_0001420 Ga0395905_0001420_5228_6337 369
164 3300037471 Ga0395905_0001825 Ga0395905_0001825_5647_6777 369
165 3300038443 Ga0395901_0003389 Ga0395901_0003389_2496_3617 369
166 3300039437 Ga0436365_1479007 Ga0436365_1479007_67_1176 369
167 3300042126 Ga0450888_000204 Ga0450888_000204_2073_3197 369
168 3300042127 Ga0450890_000091 Ga0450890_000091_8908_10032 369
169 3300042129 Ga0450891_001478 Ga0450891_001478_303_1427 369
170 3300042130 Ga0450892_000214 Ga0450892_000214_5062_6186 369
171 3300044693 Ga0466961_0038130 Ga0466961_0038130_1936_3057 369
172 3300044842 Ga0466957_0095089 Ga0466957_0095089_657_1778 369
173 3300047472 Ga0495686_0001993 Ga0495686_0001993_618_1745 369
174 3300048912 Ga0496109_0110009 Ga0496109_0110009_1299_2444 369
175 3300050493 nmdc:mga0k408_410_c1 nmdc:mga0k408_410_c1_14277_15410 369
176 3300050496 nmdc:mga07m45_2855_c1 nmdc:mga07m45_2855_c1_2841_3968 369
177 3300053086 Ga0500578_0000079 Ga0500578_0000079_41742_42866 369
178 3300053154 Ga0500619_000016 Ga0500619_000016_23713_24828 369
179 iso_pu_bacteria 2643221639 2644222749 369
180 3300003771 Ga0055526_1020240 Ga0055526_10202402 370
181 3300005288 Ga0065714_10079532 Ga0065714_100795322 370
182 3300005338 Ga0068868_100001711 Ga0068868_1000017119 370
183 3300005354 Ga0070675_100205154 Ga0070675_1002051542 370
184 3300005364 Ga0070673_100030057 Ga0070673_1000300572 370
185 3300005367 Ga0070667_100003595 Ga0070667_1000035959 370
186 3300005471 Ga0070698_100002653 Ga0070698_1000026536 370
187 3300005471 Ga0070698_100005248 Ga0070698_1000052489 370
188 3300005471 Ga0070698_100039979 Ga0070698_1000399794 370
189 3300005617 Ga0068859_100007469 Ga0068859_1000074694 370
190 3300005834 Ga0068851_10009475 Ga0068851_100094753 370
191 3300005834 Ga0068851_10065366 Ga0068851_100653662 370
192 3300005841 Ga0068863_100033750 Ga0068863_1000337504 370
193 3300005843 Ga0068860_100005896 Ga0068860_10000589610 370
194 3300006844 Ga0075428_100010603 Ga0075428_1000106037 370
195 3300006844 Ga0075428_100062501 Ga0075428_1000625014 370
196 3300006847 Ga0075431_100171781 Ga0075431_1001717812 370
197 3300006880 Ga0075429_100021893 Ga0075429_1000218938 370
198 3300006931 Ga0097620_100007469 Ga0097620_1000074694 370
199 3300006946 Ga0079104_1000001 Ga0079104_1000001422 370
200 3300009094 Ga0111539_10228072 Ga0111539_102280722 370
201 3300009094 Ga0111539_10488648 Ga0111539_104886482 370
202 3300010375 Ga0105239_10038833 Ga0105239_100388334 370
203 3300013296 Ga0157374_10010333 Ga0157374_100103332 370
204 3300013297 Ga0157378_10014702 Ga0157378_100147024 370
205 3300013297 Ga0157378_10021640 Ga0157378_100216402 370
206 3300013297 Ga0157378_10328676 Ga0157378_103286762 370
207 3300013307 Ga0157372_10056408 Ga0157372_100564083 370
208 3300014326 Ga0157380_10010574 Ga0157380_100105743 370
209 3300014745 Ga0157377_10034111 Ga0157377_100341112 370
210 3300014968 Ga0157379_10350399 Ga0157379_103503991 370
211 3300025295 Ga0209564_1005019 Ga0209564_10050195 370
212 3300025298 Ga0209050_1032342 Ga0209050_10323422 370
213 3300025302 Ga0207426_1012215 Ga0207426_10122151 370
214 3300025923 Ga0207681_10228634 Ga0207681_102286342 370
215 3300025925 Ga0207650_10004145 Ga0207650_100041458 370
216 3300025926 Ga0207659_10027961 Ga0207659_100279614 370
217 3300025942 Ga0207689_10016468 Ga0207689_100164685 370
218 3300025986 Ga0207658_10013982 Ga0207658_100139823 370
219 3300026088 Ga0207641_10002912 Ga0207641_100029127 370
220 3300026088 Ga0207641_10155849 Ga0207641_101558492 370
221 3300027111 Ga0209281_1000151 Ga0209281_1000151105 370
222 3300028381 Ga0268264_10074717 Ga0268264_100747172 370
223 3300031251 Ga0265327_10000012 Ga0265327_1000001276 370
224 3300036712 Ga0316584_0031920 Ga0316584_0031920_235_1347 370
225 3300037471 Ga0395905_0026733 Ga0395905_0026733_120_1232 370
226 3300041407 Ga0439447_001010 Ga0439447_001010_3390_4502 370
227 3300042125 Ga0450923_001916 Ga0450923_001916_1344_2456 370
228 3300042439 Ga0439464_0000834 Ga0439464_0000834_4187_5314 370
229 3300044712 Ga0453684_0002039 Ga0453684_0002039_24047_25201 370
230 3300044712 Ga0453684_0006401 Ga0453684_0006401_5274_6428 370
231 3300044712 Ga0453684_0024115 Ga0453684_0024115_6492_7604 370
232 3300044712 Ga0453684_0042295 Ga0453684_0042295_2672_3784 370
233 3300045051 Ga0451576_0002222 Ga0451576_0002222_1390_2523 370
234 3300049521 Ga0501298_005827 Ga0501298_005827_144_1256 370
235 3300049571 Ga0501034_0002811 Ga0501034_0002811_13435_14547 370
236 3300049574 Ga0501038_0001736 Ga0501038_0001736_3832_4953 370
237 3300049579 Ga0501043_0020117 Ga0501043_0020117_2783_3895 370
238 3300049581 Ga0501047_0039224 Ga0501047_0039224_522_1634 370
239 3300049581 Ga0501047_0203657 Ga0501047_0203657_317_1438 370
240 3300049586 Ga0501070_0036529 Ga0501070_0036529_1851_2972 370
241 3300049586 Ga0501070_0044555 Ga0501070_0044555_2503_3624 370
242 3300049590 Ga0501074_0003047 Ga0501074_0003047_2557_3678 370
243 3300049651 Ga0501201_000538 Ga0501201_000538_1771_2883 370
244 3300049652 Ga0501202_001797 Ga0501202_001797_230_1342 370
245 3300049654 Ga0501207_001176 Ga0501207_001176_1403_2515 370
246 3300049661 Ga0501217_004723 Ga0501217_004723_1238_2350 370
247 3300049663 Ga0501223_001080 Ga0501223_001080_5302_6414 370
248 3300049668 Ga0501233_008107 Ga0501233_008107_840_1952 370
249 3300049669 Ga0501235_001997 Ga0501235_001997_1333_2445 370
250 3300049675 Ga0501243_002466 Ga0501243_002466_373_1485 370
251 3300049682 Ga0501252_002452 Ga0501252_002452_489_1601 370
252 3300049688 Ga0501259_001771 Ga0501259_001771_701_1813 370
253 3300049689 Ga0501260_003521 Ga0501260_003521_230_1342 370
254 3300049708 Ga0501245_000277 Ga0501245_000277_3215_4327 370
255 3300049742 Ga0501080_0027496 Ga0501080_0027496_314_1435 370
256 3300049762 Ga0501265_001647 Ga0501265_001647_44_1156 370
257 3300049823 Ga0501044_0033875 Ga0501044_0033875_3023_4135 370
258 3300050511 nmdc:mga08y16_211515_c1 nmdc:mga08y16_211515_c1_330_1442 370
259 3300053086 Ga0500578_0050086 Ga0500578_0050086_438_1550 370
260 3300053134 Ga0500658_0000010 Ga0500658_0000010_84757_85869 370
261 3300053139 Ga0500568_0003456 Ga0500568_0003456_3528_4676 370
262 3300053730 Ga0500645_000535 Ga0500645_000535_1238_2350 370
263 3300003322 rootL2_10059364 rootL2_100593646 371
264 3300003322 rootL2_10165617 rootL2_101656171 371
265 3300005327 Ga0070658_10274866 Ga0070658_102748661 371
266 3300005340 Ga0070689_100301440 Ga0070689_1003014401 371
267 3300005354 Ga0070675_100039657 Ga0070675_1000396574 371
268 3300005355 Ga0070671_100011735 Ga0070671_1000117357 371
269 3300005364 Ga0070673_100029243 Ga0070673_1000292431 371
270 3300005456 Ga0070678_100013590 Ga0070678_1000135903 371
271 3300005543 Ga0070672_100041655 Ga0070672_1000416552 371
272 3300005615 Ga0070702_100033838 Ga0070702_1000338382 371
273 3300005842 Ga0068858_100152658 Ga0068858_1001526582 371
274 3300006195 Ga0075366_10098470 Ga0075366_100984702 371
275 3300006237 Ga0097621_100128953 Ga0097621_1001289532 371
276 3300009101 Ga0105247_10001465 Ga0105247_1000146513 371
277 3300013297 Ga0157378_10021840 Ga0157378_100218403 371
278 3300013306 Ga0163162_10199667 Ga0163162_101996672 371
279 3300014745 Ga0157377_10002753 Ga0157377_100027536 371
280 3300025900 Ga0207710_10003815 Ga0207710_100038152 371
281 3300025907 Ga0207645_10021073 Ga0207645_100210736 371
282 3300025918 Ga0207662_10021088 Ga0207662_100210884 371
283 3300025940 Ga0207691_10108960 Ga0207691_101089602 371
284 3300025942 Ga0207689_10108259 Ga0207689_101082592 371
285 3300025960 Ga0207651_10046726 Ga0207651_100467263 371
286 3300026023 Ga0207677_10145903 Ga0207677_101459032 371
287 3300026035 Ga0207703_10244639 Ga0207703_102446392 371
288 3300026121 Ga0207683_10022617 Ga0207683_100226172 371
289 3300026142 Ga0207698_10159277 Ga0207698_101592771 371
290 3300031456 Ga0307513_10030364 Ga0307513_100303643 371
291 3300031616 Ga0307508_10000686 Ga0307508_1000068617 371
292 3300031616 Ga0307508_10211656 Ga0307508_102116561 371
293 3300039062 Ga0400483_065274 Ga0400483_065274_135_1256 371
294 3300039062 Ga0400483_111530 Ga0400483_111530_1316_2437 371
295 3300039062 Ga0400483_189257 Ga0400483_189257_859_1980 371
296 3300044673 Ga0453683_0072501 Ga0453683_0072501_392_1573 371
297 3300044712 Ga0453684_0195596 Ga0453684_0195596_718_1881 371
298 3300044712 Ga0453684_0284611 Ga0453684_0284611_688_1869 371
299 3300045051 Ga0451576_0004896 Ga0451576_0004896_14856_16055 371
300 3300045051 Ga0451576_0031094 Ga0451576_0031094_3638_4819 371
301 3300046472 Ga0495580_0096148 Ga0495580_0096148_34_1149 371
302 3300046558 Ga0495633_0000089 Ga0495633_0000089_119110_120225 371
303 3300046660 Ga0495625_0054436 Ga0495625_0054436_520_1635 371
304 3300049580 Ga0501046_0018235 Ga0501046_0018235_933_2078 371
305 3300049581 Ga0501047_0019071 Ga0501047_0019071_4694_5809 371
306 3300050493 nmdc:mga0k408_92671_c1 nmdc:mga0k408_92671_c1_469_1584 371
307 3300053146 Ga0500588_0001545 Ga0500588_0001545_782_1897 371
308 iso_pu_bacteria 2896317667 2896320805 371
309 iso_pu_bacteria 2898713307 2898713690 371

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

4

251

0.98

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

5

358

0.98

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

4

128

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gpl-assembly1.cif.gz_B crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4k6d-man 0.9713 2 355
6gpj-assembly1.cif.gz_A crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4f-man 0.9709 2 355
6q94-assembly3.cif.gz_H-2 crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man 0.9707 2 354
6gpk-assembly1.cif.gz_C crystal structure of human gdp-d-mannose 4,6-dehydratase (e157q) in complex with gdp-man 0.9677 2 355
6q94-assembly2.cif.gz_D crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man 0.9663 2 355
ID Description Score Start End Superfamily
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9833 3 269 3.40.50.720
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9761 3 269 3.40.50.720
af_Q4D941_50_182_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9688 193 332 3.90.25.10
af_Q4D941_50_182_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9616 193 332 3.90.25.10
af_Q4CM81_7_150_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9559 2 149 3.40.50.720
ID Description Score Start End GO Terms
AF-S9XC08-F1-model_v4 deleted 0.9894 94 190
AF-A0A7Y3G4X4-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9867 201 371 GO:0008446
GO:0042351
AF-A0A625RB69-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9857 60 192 GO:0008446
GO:0042351
AF-A0A146LA67-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) 0.9831 123 288 GO:0008446
GO:0042351
AF-A0A3A4XPU5-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9829 1 263 GO:0008446
GO:0042351

Feature Viewer

pLDDT pTM Quality
89.78 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map