F400338
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 309 | 214 | 301 | 368 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0002039|Ga0453684_0002039_24047_25201 |
| Length | 384 |
| Sequence | MKTALITGITGQDGAYLAEYLLKKGYIVHGMKRRSSLFNTDRIDHLYQDPHVENRNLFLHYGDLTDSMNITRIIQEVQPDEIYNLAAMSHVAVSFETPEYVANADGIGTLRILEAVRLLGLTKKTRIYQASTSELYGLVQEVPQSEKTPFYPRSPYAVAKMYGYWITVNYREAYGMHASNGILFNHESPIRGETFVTRKVTRALSKIALGLQDAVFMGNLNSQRDWGHAKDYIRAMYLILQQEKPSDYVIATGITTTIRDFIDLAAQEIGLQLEFRGENADEIGVLVNVDQEKFIEKVGDKYLDQIVSRAAVKDVIVGVDKRYFRPTEVDLLIGDPTKSRTVLGWEPRYDLAALIADMMQSDIKLMQRETYLKEGGYDIMNYFE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 2 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 3 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 4 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 5 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 6 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 7 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 8 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 83 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 134 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 138 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 139 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 140 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 141 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 142 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 143 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 145 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 147 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 148 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 149 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 150 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 151 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 152 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 153 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 154 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 155 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 156 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 157 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 158 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 159 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 160 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 161 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 162 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 163 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 164 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 177 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 178 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 180 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 191 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 192 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 193 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 194 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 195 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 196 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 197 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 198 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 199 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 200 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 201 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 202 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 204 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 206 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 207 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 209 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 210 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 211 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 212 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 213 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 214 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.09 |
| Metatranscriptomes | 0.32 |
| Isolates | 2.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.09 |
| Nodule | 0.65 |
| Rhizoplane | 1.62 |
| Rhizosphere | 84.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10059364 | 3300003322 | Bacteria | 7924 |
| 2 | rootL2_10165617 | 3300003322 | Bacteria | 3485 |
| 3 | Ga0032354_1082644 | 3300003693 | Bacteria | 2217 |
| 4 | Ga0055539_1000314 | 3300003752 | Bacteria | 25189 |
| 5 | Ga0055533_1000043 | 3300003756 | Bacteria | 229262 |
| 6 | Ga0055526_1020240 | 3300003771 | Bacteria | 2379 |
| 7 | Ga0065714_10079532 | 3300005288 | Bacteria | 2504 |
| 8 | Ga0070658_10038506 | 3300005327 | Bacteria | 3855 |
| 9 | Ga0070658_10052418 | 3300005327 | Bacteria | 3309 |
| 10 | Ga0070658_10274866 | 3300005327 | Bacteria | 1433 |
| 11 | Ga0070683_100006684 | 3300005329 | Bacteria | 9681 |
| 12 | Ga0070690_100005240 | 3300005330 | Bacteria | 7266 |
| 13 | Ga0068869_100008093 | 3300005334 | Bacteria | 6761 |
| 14 | Ga0070666_10001632 | 3300005335 | Bacteria | 13650 |
| 15 | Ga0068868_100001711 | 3300005338 | Bacteria | 15014 |
| 16 | Ga0068868_100016631 | 3300005338 | Bacteria | 5469 |
| 17 | Ga0070689_100016452 | 3300005340 | Bacteria | 5413 |
| 18 | Ga0070689_100075355 | 3300005340 | Bacteria | 2642 |
| 19 | Ga0070689_100301440 | 3300005340 | Bacteria | 1334 |
| 20 | Ga0070661_100224793 | 3300005344 | Bacteria | 1441 |
| 21 | Ga0070675_100039657 | 3300005354 | Bacteria | 3844 |
| 22 | Ga0070675_100116765 | 3300005354 | Bacteria | 2264 |
| 23 | Ga0070675_100172154 | 3300005354 | Bacteria | 1868 |
| 24 | Ga0070675_100205154 | 3300005354 | Bacteria | 1712 |
| 25 | Ga0070671_100011735 | 3300005355 | Bacteria | 7047 |
| 26 | Ga0070671_100022761 | 3300005355 | Bacteria | 5119 |
| 27 | Ga0070671_100025118 | 3300005355 | Bacteria | 4885 |
| 28 | Ga0070673_100029243 | 3300005364 | Bacteria | 4107 |
| 29 | Ga0070673_100030057 | 3300005364 | Bacteria | 4060 |
| 30 | Ga0070673_100124797 | 3300005364 | Bacteria | 2153 |
| 31 | Ga0070659_100017895 | 3300005366 | Bacteria | 5339 |
| 32 | Ga0070667_100003595 | 3300005367 | Bacteria | 13187 |
| 33 | Ga0070667_100016999 | 3300005367 | Bacteria | 6022 |
| 34 | Ga0070700_100000251 | 3300005441 | Bacteria | 28879 |
| 35 | Ga0070678_100013590 | 3300005456 | Bacteria | 5112 |
| 36 | Ga0070678_100093384 | 3300005456 | Bacteria | 2313 |
| 37 | Ga0070681_10009141 | 3300005458 | Bacteria | 9737 |
| 38 | Ga0068867_100001121 | 3300005459 | Bacteria | 18333 |
| 39 | Ga0070698_100002653 | 3300005471 | Bacteria | 19726 |
| 40 | Ga0070698_100005248 | 3300005471 | Bacteria | 14175 |
| 41 | Ga0070698_100039979 | 3300005471 | Bacteria | 4822 |
| 42 | Ga0070684_100001894 | 3300005535 | Bacteria | 15331 |
| 43 | Ga0070672_100041655 | 3300005543 | Bacteria | 3532 |
| 44 | Ga0070672_100104842 | 3300005543 | Bacteria | 2298 |
| 45 | Ga0070686_100001500 | 3300005544 | Bacteria | 13119 |
| 46 | Ga0070696_100016224 | 3300005546 | Bacteria | 5012 |
| 47 | Ga0070693_100007604 | 3300005547 | Bacteria | 5305 |
| 48 | Ga0070693_100092897 | 3300005547 | Bacteria | 1823 |
| 49 | Ga0070665_100007526 | 3300005548 | Bacteria | 11073 |
| 50 | Ga0070704_100089333 | 3300005549 | Bacteria | 2292 |
| 51 | Ga0070664_100129172 | 3300005564 | Bacteria | 2219 |
| 52 | Ga0068857_100029094 | 3300005577 | Bacteria | 4875 |
| 53 | Ga0070702_100003313 | 3300005615 | Bacteria | 7186 |
| 54 | Ga0070702_100033838 | 3300005615 | Bacteria | 2813 |
| 55 | Ga0068852_100019630 | 3300005616 | Bacteria | 5355 |
| 56 | Ga0068859_100007469 | 3300005617 | Bacteria | 11096 |
| 57 | Ga0068859_100007750 | 3300005617 | Bacteria | 10900 |
| 58 | Ga0068859_100011508 | 3300005617 | Bacteria | 8894 |
| 59 | Ga0068859_100154980 | 3300005617 | Bacteria | 2368 |
| 60 | Ga0068864_100205293 | 3300005618 | Bacteria | 1812 |
| 61 | Ga0068866_10001503 | 3300005718 | Bacteria | 9933 |
| 62 | Ga0068861_100002831 | 3300005719 | Bacteria | 11407 |
| 63 | Ga0068851_10009475 | 3300005834 | Bacteria | 4530 |
| 64 | Ga0068851_10065366 | 3300005834 | Bacteria | 1871 |
| 65 | Ga0068863_100033750 | 3300005841 | Bacteria | 4876 |
| 66 | Ga0068858_100012895 | 3300005842 | Bacteria | 7882 |
| 67 | Ga0068858_100032111 | 3300005842 | Bacteria | 4877 |
| 68 | Ga0068858_100152658 | 3300005842 | Bacteria | 2172 |
| 69 | Ga0068860_100003237 | 3300005843 | Bacteria | 16794 |
| 70 | Ga0068860_100005896 | 3300005843 | Bacteria | 12335 |
| 71 | Ga0068860_100038850 | 3300005843 | Bacteria | 4554 |
| 72 | Ga0068862_100025064 | 3300005844 | Bacteria | 5006 |
| 73 | Ga0075366_10049667 | 3300006195 | Bacteria | 2489 |
| 74 | Ga0075366_10098470 | 3300006195 | Bacteria | 1754 |
| 75 | Ga0075366_10139246 | 3300006195 | Bacteria | 1466 |
| 76 | Ga0097621_100006983 | 3300006237 | Bacteria | 8042 |
| 77 | Ga0097621_100010906 | 3300006237 | Bacteria | 6671 |
| 78 | Ga0097621_100128953 | 3300006237 | Bacteria | 2151 |
| 79 | Ga0075370_10001816 | 3300006353 | Bacteria | 9552 |
| 80 | Ga0068871_100001992 | 3300006358 | Bacteria | 13825 |
| 81 | Ga0068871_100032487 | 3300006358 | Bacteria | 4124 |
| 82 | Ga0075428_100010603 | 3300006844 | Bacteria | 10243 |
| 83 | Ga0075428_100062501 | 3300006844 | Bacteria | 4076 |
| 84 | Ga0075431_100171781 | 3300006847 | Bacteria | 2227 |
| 85 | Ga0075429_100021893 | 3300006880 | Bacteria | 5541 |
| 86 | Ga0068865_100005736 | 3300006881 | Bacteria | 7544 |
| 87 | Ga0068865_100242093 | 3300006881 | Bacteria | 1420 |
| 88 | Ga0097620_100007469 | 3300006931 | Bacteria | 11096 |
| 89 | Ga0097620_100007750 | 3300006931 | Bacteria | 10900 |
| 90 | Ga0097620_100011508 | 3300006931 | Bacteria | 8894 |
| 91 | Ga0097620_100154982 | 3300006931 | Bacteria | 2368 |
| 92 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 93 | Ga0111539_10228072 | 3300009094 | Bacteria | 2169 |
| 94 | Ga0111539_10488648 | 3300009094 | Bacteria | 1434 |
| 95 | Ga0105245_10000503 | 3300009098 | Bacteria | 35833 |
| 96 | Ga0105245_10043230 | 3300009098 | Bacteria | 4019 |
| 97 | Ga0105247_10001465 | 3300009101 | Bacteria | 16996 |
| 98 | Ga0105243_10003257 | 3300009148 | Bacteria | 13213 |
| 99 | Ga0105242_10004193 | 3300009176 | Bacteria | 11239 |
| 100 | Ga0105248_10271591 | 3300009177 | Bacteria | 1909 |
| 101 | Ga0105238_10378112 | 3300009551 | Bacteria | 1407 |
| 102 | Ga0105249_10010761 | 3300009553 | Bacteria | 8038 |
| 103 | Ga0105239_10038833 | 3300010375 | Bacteria | 5216 |
| 104 | Ga0157374_10010333 | 3300013296 | Bacteria | 8028 |
| 105 | Ga0157374_10123594 | 3300013296 | Bacteria | 2500 |
| 106 | Ga0157378_10014702 | 3300013297 | Bacteria | 6856 |
| 107 | Ga0157378_10014912 | 3300013297 | Bacteria | 6801 |
| 108 | Ga0157378_10021640 | 3300013297 | Bacteria | 5655 |
| 109 | Ga0157378_10021840 | 3300013297 | Bacteria | 5627 |
| 110 | Ga0157378_10057026 | 3300013297 | Bacteria | 3481 |
| 111 | Ga0157378_10328676 | 3300013297 | Bacteria | 1487 |
| 112 | Ga0163162_10199667 | 3300013306 | Bacteria | 2128 |
| 113 | Ga0163162_10275368 | 3300013306 | Bacteria | 1815 |
| 114 | Ga0157372_10056408 | 3300013307 | Bacteria | 4389 |
| 115 | Ga0163163_10004647 | 3300014325 | Bacteria | 11735 |
| 116 | Ga0157380_10010574 | 3300014326 | Bacteria | 6637 |
| 117 | Ga0157377_10002753 | 3300014745 | Bacteria | 7827 |
| 118 | Ga0157377_10034111 | 3300014745 | Bacteria | 2783 |
| 119 | Ga0157379_10007489 | 3300014968 | Bacteria | 9449 |
| 120 | Ga0157379_10350399 | 3300014968 | Bacteria | 1352 |
| 121 | Ga0157376_10241846 | 3300014969 | Bacteria | 1682 |
| 122 | Ga0163161_10158922 | 3300017792 | Bacteria | 1722 |
| 123 | Ga0213872_10000566 | 3300021361 | Bacteria | 28609 |
| 124 | Ga0209674_100067 | 3300025226 | Bacteria | 253824 |
| 125 | Ga0209563_100068 | 3300025230 | Bacteria | 254802 |
| 126 | Ga0207427_101341 | 3300025231 | Bacteria | 9119 |
| 127 | Ga0209677_100049 | 3300025253 | Bacteria | 180721 |
| 128 | Ga0209759_1000443 | 3300025256 | Bacteria | 48263 |
| 129 | Ga0209564_1005019 | 3300025295 | Bacteria | 7761 |
| 130 | Ga0209050_1032342 | 3300025298 | Bacteria | 1611 |
| 131 | Ga0207426_1012215 | 3300025302 | Bacteria | 3237 |
| 132 | Ga0207697_10025756 | 3300025315 | Bacteria | 2405 |
| 133 | Ga0207642_10003662 | 3300025899 | Bacteria | 4879 |
| 134 | Ga0207710_10003815 | 3300025900 | Bacteria | 6659 |
| 135 | Ga0207680_10001344 | 3300025903 | Bacteria | 11635 |
| 136 | Ga0207645_10021073 | 3300025907 | Bacteria | 4255 |
| 137 | Ga0207643_10137883 | 3300025908 | Bacteria | 1455 |
| 138 | Ga0207705_10099579 | 3300025909 | Bacteria | 2137 |
| 139 | Ga0207707_10009441 | 3300025912 | Bacteria | 8461 |
| 140 | Ga0207660_10078266 | 3300025917 | Bacteria | 2423 |
| 141 | Ga0207662_10021088 | 3300025918 | Bacteria | 3720 |
| 142 | Ga0207649_10062300 | 3300025920 | Bacteria | 2351 |
| 143 | Ga0207649_10076536 | 3300025920 | Bacteria | 2153 |
| 144 | Ga0207649_10227599 | 3300025920 | Bacteria | 1332 |
| 145 | Ga0207681_10228634 | 3300025923 | Bacteria | 1443 |
| 146 | Ga0207650_10004145 | 3300025925 | Bacteria | 9909 |
| 147 | Ga0207659_10027961 | 3300025926 | Bacteria | 3825 |
| 148 | Ga0207659_10153739 | 3300025926 | Bacteria | 1799 |
| 149 | Ga0207687_10009290 | 3300025927 | Bacteria | 6431 |
| 150 | Ga0207687_10259976 | 3300025927 | Bacteria | 1384 |
| 151 | Ga0207644_10012557 | 3300025931 | Bacteria | 5629 |
| 152 | Ga0207644_10223970 | 3300025931 | Bacteria | 1492 |
| 153 | Ga0207686_10018334 | 3300025934 | Bacteria | 3962 |
| 154 | Ga0207709_10013282 | 3300025935 | Bacteria | 4543 |
| 155 | Ga0207670_10022629 | 3300025936 | Bacteria | 3898 |
| 156 | Ga0207704_10045593 | 3300025938 | Bacteria | 2606 |
| 157 | Ga0207691_10023601 | 3300025940 | Bacteria | 5792 |
| 158 | Ga0207691_10108960 | 3300025940 | Bacteria | 2464 |
| 159 | Ga0207689_10003415 | 3300025942 | Bacteria | 14498 |
| 160 | Ga0207689_10016468 | 3300025942 | Bacteria | 6257 |
| 161 | Ga0207689_10108259 | 3300025942 | Bacteria | 2284 |
| 162 | Ga0207661_10008081 | 3300025944 | Bacteria | 7506 |
| 163 | Ga0207679_10057102 | 3300025945 | Bacteria | 2885 |
| 164 | Ga0207651_10007927 | 3300025960 | Bacteria | 5692 |
| 165 | Ga0207651_10046726 | 3300025960 | Bacteria | 2914 |
| 166 | Ga0207712_10062067 | 3300025961 | Bacteria | 2655 |
| 167 | Ga0207658_10013982 | 3300025986 | Bacteria | 5494 |
| 168 | Ga0207658_10094528 | 3300025986 | Bacteria | 2326 |
| 169 | Ga0207658_10098261 | 3300025986 | Bacteria | 2287 |
| 170 | Ga0207677_10145903 | 3300026023 | Bacteria | 1818 |
| 171 | Ga0207703_10195529 | 3300026035 | Bacteria | 1794 |
| 172 | Ga0207703_10244639 | 3300026035 | Bacteria | 1614 |
| 173 | Ga0207708_10031734 | 3300026075 | Bacteria | 4011 |
| 174 | Ga0207708_10220497 | 3300026075 | Bacteria | 1519 |
| 175 | Ga0207641_10002912 | 3300026088 | Bacteria | 15494 |
| 176 | Ga0207641_10023892 | 3300026088 | Bacteria | 5039 |
| 177 | Ga0207641_10155849 | 3300026088 | Bacteria | 2072 |
| 178 | Ga0207648_10003132 | 3300026089 | Bacteria | 17452 |
| 179 | Ga0207648_10278530 | 3300026089 | Bacteria | 1495 |
| 180 | Ga0207676_10075152 | 3300026095 | Bacteria | 2725 |
| 181 | Ga0207676_10285159 | 3300026095 | Bacteria | 1501 |
| 182 | Ga0207674_10004856 | 3300026116 | Bacteria | 16098 |
| 183 | Ga0207675_100004569 | 3300026118 | Bacteria | 13354 |
| 184 | Ga0207683_10022617 | 3300026121 | Bacteria | 5399 |
| 185 | Ga0207698_10159277 | 3300026142 | Bacteria | 1972 |
| 186 | Ga0209281_1000151 | 3300027111 | Bacteria | 167268 |
| 187 | Ga0268266_10010998 | 3300028379 | Bacteria | 7875 |
| 188 | Ga0268265_10062418 | 3300028380 | Bacteria | 2863 |
| 189 | Ga0268264_10032822 | 3300028381 | Bacteria | 4260 |
| 190 | Ga0268264_10050572 | 3300028381 | Bacteria | 3461 |
| 191 | Ga0268264_10074717 | 3300028381 | Bacteria | 2880 |
| 192 | Ga0265336_10000011 | 3300028666 | Bacteria | 275816 |
| 193 | Ga0307515_10000655 | 3300028794 | Bacteria | 79837 |
| 194 | Ga0265338_10014981 | 3300028800 | Bacteria | 8569 |
| 195 | Ga0265324_10000968 | 3300029957 | Bacteria | 17842 |
| 196 | Ga0265327_10000012 | 3300031251 | Bacteria | 530403 |
| 197 | Ga0307513_10030364 | 3300031456 | Bacteria | 6141 |
| 198 | Ga0307509_10012377 | 3300031507 | Bacteria | 10208 |
| 199 | Ga0307508_10000686 | 3300031616 | Bacteria | 40604 |
| 200 | Ga0307508_10211656 | 3300031616 | Bacteria | 1539 |
| 201 | Ga0307415_100094583 | 3300032126 | Bacteria | 2173 |
| 202 | Ga0307510_10022214 | 3300033180 | Bacteria | 7374 |
| 203 | Ga0373948_0012056 | 3300034817 | Bacteria | 1539 |
| 204 | Ga0373934_0019134 | 3300035086 | Bacteria | 2626 |
| 205 | Ga0373939_0000150 | 3300035114 | Bacteria | 19585 |
| 206 | Ga0373931_0000597 | 3300035691 | Bacteria | 14897 |
| 207 | Ga0316584_0031920 | 3300036712 | Bacteria | 3895 |
| 208 | Ga0395898_0010362 | 3300037466 | Bacteria | 9749 |
| 209 | Ga0395905_0001420 | 3300037471 | Bacteria | 28906 |
| 210 | Ga0395905_0001825 | 3300037471 | Bacteria | 24608 |
| 211 | Ga0395905_0026733 | 3300037471 | Bacteria | 5442 |
| 212 | Ga0395901_0003389 | 3300038443 | Bacteria | 16046 |
| 213 | Ga0400483_065274 | 3300039062 | Bacteria | 1879 |
| 214 | Ga0400483_111530 | 3300039062 | Bacteria | 4263 |
| 215 | Ga0400483_189257 | 3300039062 | Bacteria | 4009 |
| 216 | Ga0436365_1479007 | 3300039437 | Bacteria | 1650 |
| 217 | Ga0436360_1173569 | 3300039438 | Bacteria | 2153 |
| 218 | Ga0436361_0969594 | 3300039447 | Bacteria | 2206 |
| 219 | Ga0439447_001010 | 3300041407 | Bacteria | 10250 |
| 220 | Ga0450923_001916 | 3300042125 | Bacteria | 2875 |
| 221 | Ga0450888_000204 | 3300042126 | Bacteria | 5299 |
| 222 | Ga0450890_000091 | 3300042127 | Bacteria | 15118 |
| 223 | Ga0450891_001478 | 3300042129 | Bacteria | 2428 |
| 224 | Ga0450892_000214 | 3300042130 | Bacteria | 6910 |
| 225 | Ga0439464_0000834 | 3300042439 | Bacteria | 6811 |
| 226 | Ga0453683_0002713 | 3300044673 | Bacteria | 13510 |
| 227 | Ga0453683_0012419 | 3300044673 | Bacteria | 5581 |
| 228 | Ga0453683_0072501 | 3300044673 | Bacteria | 2155 |
| 229 | Ga0466965_0042102 | 3300044683 | Bacteria | 2251 |
| 230 | Ga0466961_0038130 | 3300044693 | Bacteria | 3083 |
| 231 | Ga0453684_0002039 | 3300044712 | Bacteria | 51562 |
| 232 | Ga0453684_0006401 | 3300044712 | Bacteria | 22421 |
| 233 | Ga0453684_0024115 | 3300044712 | Bacteria | 8911 |
| 234 | Ga0453684_0042295 | 3300044712 | Bacteria | 6144 |
| 235 | Ga0453684_0074981 | 3300044712 | Bacteria | 4255 |
| 236 | Ga0453684_0195596 | 3300044712 | Bacteria | 2362 |
| 237 | Ga0453684_0284611 | 3300044712 | Bacteria | 1884 |
| 238 | Ga0466957_0095089 | 3300044842 | Bacteria | 1871 |
| 239 | Ga0451576_0002222 | 3300045051 | Bacteria | 29859 |
| 240 | Ga0451576_0004896 | 3300045051 | Bacteria | 17110 |
| 241 | Ga0451576_0031094 | 3300045051 | Bacteria | 5695 |
| 242 | Ga0466958_0001524 | 3300045836 | Bacteria | 11104 |
| 243 | Ga0495580_0096148 | 3300046472 | Bacteria | 2060 |
| 244 | Ga0495582_0197429 | 3300046473 | Bacteria | 1149 |
| 245 | Ga0495633_0000089 | 3300046558 | Bacteria | 123616 |
| 246 | Ga0495625_0054436 | 3300046660 | Bacteria | 2858 |
| 247 | Ga0495659_0001273 | 3300046664 | Bacteria | 8700 |
| 248 | Ga0495669_0002968 | 3300046684 | Bacteria | 6969 |
| 249 | Ga0495686_0001993 | 3300047472 | Bacteria | 20281 |
| 250 | Ga0496101_0173254 | 3300048904 | Bacteria | 1659 |
| 251 | Ga0496104_0047510 | 3300048907 | Bacteria | 4045 |
| 252 | Ga0496105_0012102 | 3300048908 | Bacteria | 6832 |
| 253 | Ga0496109_0002899 | 3300048912 | Bacteria | 14331 |
| 254 | Ga0496109_0110009 | 3300048912 | Bacteria | 2561 |
| 255 | Ga0501298_005827 | 3300049521 | Bacteria | 1995 |
| 256 | Ga0501033_0068209 | 3300049570 | Bacteria | 2615 |
| 257 | Ga0501034_0002811 | 3300049571 | Bacteria | 20358 |
| 258 | Ga0501036_0138353 | 3300049572 | Bacteria | 2055 |
| 259 | Ga0501038_0001736 | 3300049574 | Bacteria | 20261 |
| 260 | Ga0501038_0005499 | 3300049574 | Bacteria | 11761 |
| 261 | Ga0501039_0015737 | 3300049575 | Bacteria | 5789 |
| 262 | Ga0501043_0020117 | 3300049579 | Bacteria | 5238 |
| 263 | Ga0501046_0018235 | 3300049580 | Bacteria | 5844 |
| 264 | Ga0501047_0000127 | 3300049581 | Bacteria | 93760 |
| 265 | Ga0501047_0019071 | 3300049581 | Bacteria | 6581 |
| 266 | Ga0501047_0039224 | 3300049581 | Bacteria | 4582 |
| 267 | Ga0501047_0203657 | 3300049581 | Bacteria | 1839 |
| 268 | Ga0501070_0036529 | 3300049586 | Bacteria | 4102 |
| 269 | Ga0501070_0044555 | 3300049586 | Bacteria | 3691 |
| 270 | Ga0501070_0097985 | 3300049586 | Bacteria | 2425 |
| 271 | Ga0501074_0003047 | 3300049590 | Bacteria | 11811 |
| 272 | Ga0501201_000538 | 3300049651 | Bacteria | 3515 |
| 273 | Ga0501202_001797 | 3300049652 | Bacteria | 3508 |
| 274 | Ga0501207_001176 | 3300049654 | Bacteria | 3215 |
| 275 | Ga0501217_004723 | 3300049661 | Bacteria | 2811 |
| 276 | Ga0501223_001080 | 3300049663 | Bacteria | 6424 |
| 277 | Ga0501233_008107 | 3300049668 | Bacteria | 2018 |
| 278 | Ga0501235_001997 | 3300049669 | Bacteria | 4371 |
| 279 | Ga0501243_002466 | 3300049675 | Bacteria | 2714 |
| 280 | Ga0501252_002452 | 3300049682 | Bacteria | 1841 |
| 281 | Ga0501259_001771 | 3300049688 | Bacteria | 3576 |
| 282 | Ga0501260_003521 | 3300049689 | Bacteria | 1410 |
| 283 | Ga0501245_000277 | 3300049708 | Bacteria | 5962 |
| 284 | Ga0501080_0027496 | 3300049742 | Bacteria | 5289 |
| 285 | Ga0501080_0128430 | 3300049742 | Bacteria | 2347 |
| 286 | Ga0501265_001647 | 3300049762 | Bacteria | 2523 |
| 287 | Ga0501044_0006787 | 3300049823 | Bacteria | 12617 |
| 288 | Ga0501044_0033875 | 3300049823 | Bacteria | 5363 |
| 289 | nmdc:mga0k408_36118_c2 | 3300050493 | Bacteria | 1503 |
| 290 | nmdc:mga0k408_410_c1 | 3300050493 | Bacteria | 23446 |
| 291 | nmdc:mga0k408_92671_c1 | 3300050493 | Bacteria | 1776 |
| 292 | nmdc:mga07m45_2855_c1 | 3300050496 | Bacteria | 8179 |
| 293 | nmdc:mga08y16_211515_c1 | 3300050511 | Bacteria | 2008 |
| 294 | Ga0500578_0000079 | 3300053086 | Bacteria | 107137 |
| 295 | Ga0500578_0050086 | 3300053086 | Bacteria | 2679 |
| 296 | Ga0500658_0000010 | 3300053134 | Bacteria | 248149 |
| 297 | Ga0500568_0003456 | 3300053139 | Bacteria | 8799 |
| 298 | Ga0500588_0001545 | 3300053146 | Bacteria | 4421 |
| 299 | Ga0500619_000016 | 3300053154 | Bacteria | 54289 |
| 300 | Ga0500645_000535 | 3300053730 | Bacteria | 25399 |
| 301 | Ga0466962_0001148 | 3300061719 | Bacteria | 12224 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044683 | Ga0466965_0042102 | Ga0466965_0042102_235_1260 | 319 |
| 2 | 3300061719 | Ga0466962_0001148 | Ga0466962_0001148_1263_2288 | 319 |
| 3 | 3300046473 | Ga0495582_0197429 | Ga0495582_0197429_80_1066 | 328 |
| 4 | iso_pu_bacteria | 2919114240 | 2919117891 | 330 |
| 5 | 3300026089 | Ga0207648_10278530 | Ga0207648_102785301 | 334 |
| 6 | 3300028800 | Ga0265338_10014981 | Ga0265338_100149811 | 334 |
| 7 | 3300048904 | Ga0496101_0173254 | Ga0496101_0173254_628_1632 | 334 |
| 8 | 3300005456 | Ga0070678_100093384 | Ga0070678_1000933842 | 337 |
| 9 | 3300025908 | Ga0207643_10137883 | Ga0207643_101378831 | 337 |
| 10 | 3300049581 | Ga0501047_0000127 | Ga0501047_0000127_77814_78827 | 337 |
| 11 | 3300050493 | nmdc:mga0k408_36118_c2 | nmdc:mga0k408_36118_c2_55_1089 | 344 |
| 12 | 3300003693 | Ga0032354_1082644 | Ga0032354_10826441 | 353 |
| 13 | 3300005548 | Ga0070665_100007526 | Ga0070665_10000752611 | 353 |
| 14 | 3300028379 | Ga0268266_10010998 | Ga0268266_100109984 | 353 |
| 15 | 3300049570 | Ga0501033_0068209 | Ga0501033_0068209_1528_2604 | 353 |
| 16 | 3300049572 | Ga0501036_0138353 | Ga0501036_0138353_239_1384 | 353 |
| 17 | 3300049574 | Ga0501038_0005499 | Ga0501038_0005499_5498_6643 | 353 |
| 18 | 3300049575 | Ga0501039_0015737 | Ga0501039_0015737_3298_4443 | 353 |
| 19 | 3300049586 | Ga0501070_0097985 | Ga0501070_0097985_402_1547 | 353 |
| 20 | 3300049742 | Ga0501080_0128430 | Ga0501080_0128430_826_1971 | 353 |
| 21 | 3300049823 | Ga0501044_0006787 | Ga0501044_0006787_9996_11141 | 353 |
| 22 | 3300005547 | Ga0070693_100092897 | Ga0070693_1000928972 | 356 |
| 23 | 3300017792 | Ga0163161_10158922 | Ga0163161_101589222 | 356 |
| 24 | 3300025315 | Ga0207697_10025756 | Ga0207697_100257562 | 356 |
| 25 | 3300005458 | Ga0070681_10009141 | Ga0070681_100091417 | 359 |
| 26 | 3300005577 | Ga0068857_100029094 | Ga0068857_1000290943 | 359 |
| 27 | 3300025912 | Ga0207707_10009441 | Ga0207707_100094414 | 359 |
| 28 | 3300005617 | Ga0068859_100011508 | Ga0068859_1000115087 | 360 |
| 29 | 3300006931 | Ga0097620_100011508 | Ga0097620_1000115087 | 360 |
| 30 | 3300046684 | Ga0495669_0002968 | Ga0495669_0002968_3496_4578 | 360 |
| 31 | 3300005330 | Ga0070690_100005240 | Ga0070690_1000052406 | 361 |
| 32 | 3300005334 | Ga0068869_100008093 | Ga0068869_1000080936 | 361 |
| 33 | 3300005340 | Ga0070689_100016452 | Ga0070689_1000164526 | 361 |
| 34 | 3300005441 | Ga0070700_100000251 | Ga0070700_1000002513 | 361 |
| 35 | 3300005459 | Ga0068867_100001121 | Ga0068867_10000112118 | 361 |
| 36 | 3300005544 | Ga0070686_100001500 | Ga0070686_1000015006 | 361 |
| 37 | 3300005546 | Ga0070696_100016224 | Ga0070696_1000162242 | 361 |
| 38 | 3300005549 | Ga0070704_100089333 | Ga0070704_1000893332 | 361 |
| 39 | 3300005564 | Ga0070664_100129172 | Ga0070664_1001291722 | 361 |
| 40 | 3300005615 | Ga0070702_100003313 | Ga0070702_1000033136 | 361 |
| 41 | 3300005617 | Ga0068859_100007750 | Ga0068859_1000077506 | 361 |
| 42 | 3300005718 | Ga0068866_10001503 | Ga0068866_100015039 | 361 |
| 43 | 3300005719 | Ga0068861_100002831 | Ga0068861_1000028318 | 361 |
| 44 | 3300005842 | Ga0068858_100032111 | Ga0068858_1000321114 | 361 |
| 45 | 3300005843 | Ga0068860_100038850 | Ga0068860_1000388503 | 361 |
| 46 | 3300005844 | Ga0068862_100025064 | Ga0068862_1000250644 | 361 |
| 47 | 3300006237 | Ga0097621_100006983 | Ga0097621_1000069834 | 361 |
| 48 | 3300006358 | Ga0068871_100001992 | Ga0068871_1000019927 | 361 |
| 49 | 3300006881 | Ga0068865_100005736 | Ga0068865_1000057364 | 361 |
| 50 | 3300006931 | Ga0097620_100007750 | Ga0097620_1000077506 | 361 |
| 51 | 3300009098 | Ga0105245_10000503 | Ga0105245_1000050310 | 361 |
| 52 | 3300009148 | Ga0105243_10003257 | Ga0105243_100032575 | 361 |
| 53 | 3300009176 | Ga0105242_10004193 | Ga0105242_100041935 | 361 |
| 54 | 3300009177 | Ga0105248_10271591 | Ga0105248_102715912 | 361 |
| 55 | 3300009553 | Ga0105249_10010761 | Ga0105249_100107616 | 361 |
| 56 | 3300013297 | Ga0157378_10014912 | Ga0157378_100149124 | 361 |
| 57 | 3300014969 | Ga0157376_10241846 | Ga0157376_102418462 | 361 |
| 58 | 3300025899 | Ga0207642_10003662 | Ga0207642_100036622 | 361 |
| 59 | 3300025917 | Ga0207660_10078266 | Ga0207660_100782663 | 361 |
| 60 | 3300025927 | Ga0207687_10009290 | Ga0207687_100092903 | 361 |
| 61 | 3300025935 | Ga0207709_10013282 | Ga0207709_100132823 | 361 |
| 62 | 3300025936 | Ga0207670_10022629 | Ga0207670_100226292 | 361 |
| 63 | 3300025938 | Ga0207704_10045593 | Ga0207704_100455932 | 361 |
| 64 | 3300025942 | Ga0207689_10003415 | Ga0207689_100034157 | 361 |
| 65 | 3300025961 | Ga0207712_10062067 | Ga0207712_100620672 | 361 |
| 66 | 3300026035 | Ga0207703_10195529 | Ga0207703_101955292 | 361 |
| 67 | 3300026075 | Ga0207708_10031734 | Ga0207708_100317343 | 361 |
| 68 | 3300026089 | Ga0207648_10003132 | Ga0207648_1000313219 | 361 |
| 69 | 3300026118 | Ga0207675_100004569 | Ga0207675_1000045699 | 361 |
| 70 | 3300028380 | Ga0268265_10062418 | Ga0268265_100624182 | 361 |
| 71 | 3300028381 | Ga0268264_10032822 | Ga0268264_100328222 | 361 |
| 72 | 3300044673 | Ga0453683_0012419 | Ga0453683_0012419_706_1821 | 361 |
| 73 | 3300005335 | Ga0070666_10001632 | Ga0070666_100016328 | 362 |
| 74 | 3300005338 | Ga0068868_100016631 | Ga0068868_1000166315 | 362 |
| 75 | 3300005340 | Ga0070689_100075355 | Ga0070689_1000753553 | 362 |
| 76 | 3300005355 | Ga0070671_100025118 | Ga0070671_1000251182 | 362 |
| 77 | 3300005364 | Ga0070673_100124797 | Ga0070673_1001247972 | 362 |
| 78 | 3300005367 | Ga0070667_100016999 | Ga0070667_1000169993 | 362 |
| 79 | 3300005547 | Ga0070693_100007604 | Ga0070693_1000076044 | 362 |
| 80 | 3300005617 | Ga0068859_100154980 | Ga0068859_1001549802 | 362 |
| 81 | 3300005842 | Ga0068858_100012895 | Ga0068858_1000128953 | 362 |
| 82 | 3300005843 | Ga0068860_100003237 | Ga0068860_10000323714 | 362 |
| 83 | 3300006237 | Ga0097621_100010906 | Ga0097621_1000109064 | 362 |
| 84 | 3300006358 | Ga0068871_100032487 | Ga0068871_1000324872 | 362 |
| 85 | 3300006881 | Ga0068865_100242093 | Ga0068865_1002420932 | 362 |
| 86 | 3300006931 | Ga0097620_100154982 | Ga0097620_1001549822 | 362 |
| 87 | 3300009098 | Ga0105245_10043230 | Ga0105245_100432302 | 362 |
| 88 | 3300009551 | Ga0105238_10378112 | Ga0105238_103781121 | 362 |
| 89 | 3300013296 | Ga0157374_10123594 | Ga0157374_101235942 | 362 |
| 90 | 3300013297 | Ga0157378_10057026 | Ga0157378_100570263 | 362 |
| 91 | 3300013306 | Ga0163162_10275368 | Ga0163162_102753681 | 362 |
| 92 | 3300014325 | Ga0163163_10004647 | Ga0163163_100046479 | 362 |
| 93 | 3300014968 | Ga0157379_10007489 | Ga0157379_100074898 | 362 |
| 94 | 3300025903 | Ga0207680_10001344 | Ga0207680_100013445 | 362 |
| 95 | 3300025920 | Ga0207649_10227599 | Ga0207649_102275992 | 362 |
| 96 | 3300025927 | Ga0207687_10259976 | Ga0207687_102599762 | 362 |
| 97 | 3300025934 | Ga0207686_10018334 | Ga0207686_100183342 | 362 |
| 98 | 3300025986 | Ga0207658_10094528 | Ga0207658_100945282 | 362 |
| 99 | 3300025986 | Ga0207658_10098261 | Ga0207658_100982612 | 362 |
| 100 | 3300026088 | Ga0207641_10023892 | Ga0207641_100238923 | 362 |
| 101 | 3300026095 | Ga0207676_10075152 | Ga0207676_100751522 | 362 |
| 102 | 3300028381 | Ga0268264_10050572 | Ga0268264_100505721 | 362 |
| 103 | 3300032126 | Ga0307415_100094583 | Ga0307415_1000945832 | 362 |
| 104 | 3300039438 | Ga0436360_1173569 | Ga0436360_1173569_748_1836 | 362 |
| 105 | 3300039447 | Ga0436361_0969594 | Ga0436361_0969594_44_1132 | 362 |
| 106 | 3300046664 | Ga0495659_0001273 | Ga0495659_0001273_578_1690 | 362 |
| 107 | 3300048907 | Ga0496104_0047510 | Ga0496104_0047510_1782_2870 | 362 |
| 108 | 3300048908 | Ga0496105_0012102 | Ga0496105_0012102_3804_4892 | 362 |
| 109 | 3300048912 | Ga0496109_0002899 | Ga0496109_0002899_430_1518 | 362 |
| 110 | iso_pu_bacteria | 2818991460 | 2819676529 | 365 |
| 111 | 3300044673 | Ga0453683_0002713 | Ga0453683_0002713_11984_13141 | 366 |
| 112 | 3300044712 | Ga0453684_0074981 | Ga0453684_0074981_1920_3077 | 366 |
| 113 | iso_pu_bacteria | 2929177148 | 2929178103 | 366 |
| 114 | iso_pu_bacteria | 2945977869 | 2945980465 | 366 |
| 115 | iso_pu_bacteria | 2946013367 | 2946013673 | 366 |
| 116 | 3300031507 | Ga0307509_10012377 | Ga0307509_1001237710 | 368 |
| 117 | 3300045836 | Ga0466958_0001524 | Ga0466958_0001524_522_1634 | 368 |
| 118 | 3300003752 | Ga0055539_1000314 | Ga0055539_100031410 | 369 |
| 119 | 3300003756 | Ga0055533_1000043 | Ga0055533_100004352 | 369 |
| 120 | 3300005327 | Ga0070658_10038506 | Ga0070658_100385062 | 369 |
| 121 | 3300005327 | Ga0070658_10052418 | Ga0070658_100524183 | 369 |
| 122 | 3300005329 | Ga0070683_100006684 | Ga0070683_1000066848 | 369 |
| 123 | 3300005344 | Ga0070661_100224793 | Ga0070661_1002247932 | 369 |
| 124 | 3300005354 | Ga0070675_100116765 | Ga0070675_1001167652 | 369 |
| 125 | 3300005354 | Ga0070675_100172154 | Ga0070675_1001721542 | 369 |
| 126 | 3300005355 | Ga0070671_100022761 | Ga0070671_1000227612 | 369 |
| 127 | 3300005366 | Ga0070659_100017895 | Ga0070659_1000178955 | 369 |
| 128 | 3300005535 | Ga0070684_100001894 | Ga0070684_10000189410 | 369 |
| 129 | 3300005543 | Ga0070672_100104842 | Ga0070672_1001048422 | 369 |
| 130 | 3300005616 | Ga0068852_100019630 | Ga0068852_1000196302 | 369 |
| 131 | 3300005618 | Ga0068864_100205293 | Ga0068864_1002052932 | 369 |
| 132 | 3300006195 | Ga0075366_10049667 | Ga0075366_100496672 | 369 |
| 133 | 3300006195 | Ga0075366_10139246 | Ga0075366_101392462 | 369 |
| 134 | 3300006353 | Ga0075370_10001816 | Ga0075370_100018168 | 369 |
| 135 | 3300021361 | Ga0213872_10000566 | Ga0213872_1000056620 | 369 |
| 136 | 3300025226 | Ga0209674_100067 | Ga0209674_10006752 | 369 |
| 137 | 3300025230 | Ga0209563_100068 | Ga0209563_10006852 | 369 |
| 138 | 3300025231 | Ga0207427_101341 | Ga0207427_1013412 | 369 |
| 139 | 3300025253 | Ga0209677_100049 | Ga0209677_100049109 | 369 |
| 140 | 3300025256 | Ga0209759_1000443 | Ga0209759_100044316 | 369 |
| 141 | 3300025909 | Ga0207705_10099579 | Ga0207705_100995792 | 369 |
| 142 | 3300025920 | Ga0207649_10062300 | Ga0207649_100623002 | 369 |
| 143 | 3300025920 | Ga0207649_10076536 | Ga0207649_100765362 | 369 |
| 144 | 3300025926 | Ga0207659_10153739 | Ga0207659_101537391 | 369 |
| 145 | 3300025931 | Ga0207644_10012557 | Ga0207644_100125575 | 369 |
| 146 | 3300025931 | Ga0207644_10223970 | Ga0207644_102239702 | 369 |
| 147 | 3300025940 | Ga0207691_10023601 | Ga0207691_100236015 | 369 |
| 148 | 3300025944 | Ga0207661_10008081 | Ga0207661_100080813 | 369 |
| 149 | 3300025945 | Ga0207679_10057102 | Ga0207679_100571022 | 369 |
| 150 | 3300025960 | Ga0207651_10007927 | Ga0207651_100079273 | 369 |
| 151 | 3300026075 | Ga0207708_10220497 | Ga0207708_102204971 | 369 |
| 152 | 3300026095 | Ga0207676_10285159 | Ga0207676_102851592 | 369 |
| 153 | 3300026116 | Ga0207674_10004856 | Ga0207674_100048564 | 369 |
| 154 | 3300028666 | Ga0265336_10000011 | Ga0265336_1000001142 | 369 |
| 155 | 3300028794 | Ga0307515_10000655 | Ga0307515_1000065514 | 369 |
| 156 | 3300029957 | Ga0265324_10000968 | Ga0265324_100009686 | 369 |
| 157 | 3300033180 | Ga0307510_10022214 | Ga0307510_100222148 | 369 |
| 158 | 3300034817 | Ga0373948_0012056 | Ga0373948_0012056_177_1343 | 369 |
| 159 | 3300035086 | Ga0373934_0019134 | Ga0373934_0019134_1216_2337 | 369 |
| 160 | 3300035114 | Ga0373939_0000150 | Ga0373939_0000150_12143_13267 | 369 |
| 161 | 3300035691 | Ga0373931_0000597 | Ga0373931_0000597_13717_14841 | 369 |
| 162 | 3300037466 | Ga0395898_0010362 | Ga0395898_0010362_29_1150 | 369 |
| 163 | 3300037471 | Ga0395905_0001420 | Ga0395905_0001420_5228_6337 | 369 |
| 164 | 3300037471 | Ga0395905_0001825 | Ga0395905_0001825_5647_6777 | 369 |
| 165 | 3300038443 | Ga0395901_0003389 | Ga0395901_0003389_2496_3617 | 369 |
| 166 | 3300039437 | Ga0436365_1479007 | Ga0436365_1479007_67_1176 | 369 |
| 167 | 3300042126 | Ga0450888_000204 | Ga0450888_000204_2073_3197 | 369 |
| 168 | 3300042127 | Ga0450890_000091 | Ga0450890_000091_8908_10032 | 369 |
| 169 | 3300042129 | Ga0450891_001478 | Ga0450891_001478_303_1427 | 369 |
| 170 | 3300042130 | Ga0450892_000214 | Ga0450892_000214_5062_6186 | 369 |
| 171 | 3300044693 | Ga0466961_0038130 | Ga0466961_0038130_1936_3057 | 369 |
| 172 | 3300044842 | Ga0466957_0095089 | Ga0466957_0095089_657_1778 | 369 |
| 173 | 3300047472 | Ga0495686_0001993 | Ga0495686_0001993_618_1745 | 369 |
| 174 | 3300048912 | Ga0496109_0110009 | Ga0496109_0110009_1299_2444 | 369 |
| 175 | 3300050493 | nmdc:mga0k408_410_c1 | nmdc:mga0k408_410_c1_14277_15410 | 369 |
| 176 | 3300050496 | nmdc:mga07m45_2855_c1 | nmdc:mga07m45_2855_c1_2841_3968 | 369 |
| 177 | 3300053086 | Ga0500578_0000079 | Ga0500578_0000079_41742_42866 | 369 |
| 178 | 3300053154 | Ga0500619_000016 | Ga0500619_000016_23713_24828 | 369 |
| 179 | iso_pu_bacteria | 2643221639 | 2644222749 | 369 |
| 180 | 3300003771 | Ga0055526_1020240 | Ga0055526_10202402 | 370 |
| 181 | 3300005288 | Ga0065714_10079532 | Ga0065714_100795322 | 370 |
| 182 | 3300005338 | Ga0068868_100001711 | Ga0068868_1000017119 | 370 |
| 183 | 3300005354 | Ga0070675_100205154 | Ga0070675_1002051542 | 370 |
| 184 | 3300005364 | Ga0070673_100030057 | Ga0070673_1000300572 | 370 |
| 185 | 3300005367 | Ga0070667_100003595 | Ga0070667_1000035959 | 370 |
| 186 | 3300005471 | Ga0070698_100002653 | Ga0070698_1000026536 | 370 |
| 187 | 3300005471 | Ga0070698_100005248 | Ga0070698_1000052489 | 370 |
| 188 | 3300005471 | Ga0070698_100039979 | Ga0070698_1000399794 | 370 |
| 189 | 3300005617 | Ga0068859_100007469 | Ga0068859_1000074694 | 370 |
| 190 | 3300005834 | Ga0068851_10009475 | Ga0068851_100094753 | 370 |
| 191 | 3300005834 | Ga0068851_10065366 | Ga0068851_100653662 | 370 |
| 192 | 3300005841 | Ga0068863_100033750 | Ga0068863_1000337504 | 370 |
| 193 | 3300005843 | Ga0068860_100005896 | Ga0068860_10000589610 | 370 |
| 194 | 3300006844 | Ga0075428_100010603 | Ga0075428_1000106037 | 370 |
| 195 | 3300006844 | Ga0075428_100062501 | Ga0075428_1000625014 | 370 |
| 196 | 3300006847 | Ga0075431_100171781 | Ga0075431_1001717812 | 370 |
| 197 | 3300006880 | Ga0075429_100021893 | Ga0075429_1000218938 | 370 |
| 198 | 3300006931 | Ga0097620_100007469 | Ga0097620_1000074694 | 370 |
| 199 | 3300006946 | Ga0079104_1000001 | Ga0079104_1000001422 | 370 |
| 200 | 3300009094 | Ga0111539_10228072 | Ga0111539_102280722 | 370 |
| 201 | 3300009094 | Ga0111539_10488648 | Ga0111539_104886482 | 370 |
| 202 | 3300010375 | Ga0105239_10038833 | Ga0105239_100388334 | 370 |
| 203 | 3300013296 | Ga0157374_10010333 | Ga0157374_100103332 | 370 |
| 204 | 3300013297 | Ga0157378_10014702 | Ga0157378_100147024 | 370 |
| 205 | 3300013297 | Ga0157378_10021640 | Ga0157378_100216402 | 370 |
| 206 | 3300013297 | Ga0157378_10328676 | Ga0157378_103286762 | 370 |
| 207 | 3300013307 | Ga0157372_10056408 | Ga0157372_100564083 | 370 |
| 208 | 3300014326 | Ga0157380_10010574 | Ga0157380_100105743 | 370 |
| 209 | 3300014745 | Ga0157377_10034111 | Ga0157377_100341112 | 370 |
| 210 | 3300014968 | Ga0157379_10350399 | Ga0157379_103503991 | 370 |
| 211 | 3300025295 | Ga0209564_1005019 | Ga0209564_10050195 | 370 |
| 212 | 3300025298 | Ga0209050_1032342 | Ga0209050_10323422 | 370 |
| 213 | 3300025302 | Ga0207426_1012215 | Ga0207426_10122151 | 370 |
| 214 | 3300025923 | Ga0207681_10228634 | Ga0207681_102286342 | 370 |
| 215 | 3300025925 | Ga0207650_10004145 | Ga0207650_100041458 | 370 |
| 216 | 3300025926 | Ga0207659_10027961 | Ga0207659_100279614 | 370 |
| 217 | 3300025942 | Ga0207689_10016468 | Ga0207689_100164685 | 370 |
| 218 | 3300025986 | Ga0207658_10013982 | Ga0207658_100139823 | 370 |
| 219 | 3300026088 | Ga0207641_10002912 | Ga0207641_100029127 | 370 |
| 220 | 3300026088 | Ga0207641_10155849 | Ga0207641_101558492 | 370 |
| 221 | 3300027111 | Ga0209281_1000151 | Ga0209281_1000151105 | 370 |
| 222 | 3300028381 | Ga0268264_10074717 | Ga0268264_100747172 | 370 |
| 223 | 3300031251 | Ga0265327_10000012 | Ga0265327_1000001276 | 370 |
| 224 | 3300036712 | Ga0316584_0031920 | Ga0316584_0031920_235_1347 | 370 |
| 225 | 3300037471 | Ga0395905_0026733 | Ga0395905_0026733_120_1232 | 370 |
| 226 | 3300041407 | Ga0439447_001010 | Ga0439447_001010_3390_4502 | 370 |
| 227 | 3300042125 | Ga0450923_001916 | Ga0450923_001916_1344_2456 | 370 |
| 228 | 3300042439 | Ga0439464_0000834 | Ga0439464_0000834_4187_5314 | 370 |
| 229 | 3300044712 | Ga0453684_0002039 | Ga0453684_0002039_24047_25201 | 370 |
| 230 | 3300044712 | Ga0453684_0006401 | Ga0453684_0006401_5274_6428 | 370 |
| 231 | 3300044712 | Ga0453684_0024115 | Ga0453684_0024115_6492_7604 | 370 |
| 232 | 3300044712 | Ga0453684_0042295 | Ga0453684_0042295_2672_3784 | 370 |
| 233 | 3300045051 | Ga0451576_0002222 | Ga0451576_0002222_1390_2523 | 370 |
| 234 | 3300049521 | Ga0501298_005827 | Ga0501298_005827_144_1256 | 370 |
| 235 | 3300049571 | Ga0501034_0002811 | Ga0501034_0002811_13435_14547 | 370 |
| 236 | 3300049574 | Ga0501038_0001736 | Ga0501038_0001736_3832_4953 | 370 |
| 237 | 3300049579 | Ga0501043_0020117 | Ga0501043_0020117_2783_3895 | 370 |
| 238 | 3300049581 | Ga0501047_0039224 | Ga0501047_0039224_522_1634 | 370 |
| 239 | 3300049581 | Ga0501047_0203657 | Ga0501047_0203657_317_1438 | 370 |
| 240 | 3300049586 | Ga0501070_0036529 | Ga0501070_0036529_1851_2972 | 370 |
| 241 | 3300049586 | Ga0501070_0044555 | Ga0501070_0044555_2503_3624 | 370 |
| 242 | 3300049590 | Ga0501074_0003047 | Ga0501074_0003047_2557_3678 | 370 |
| 243 | 3300049651 | Ga0501201_000538 | Ga0501201_000538_1771_2883 | 370 |
| 244 | 3300049652 | Ga0501202_001797 | Ga0501202_001797_230_1342 | 370 |
| 245 | 3300049654 | Ga0501207_001176 | Ga0501207_001176_1403_2515 | 370 |
| 246 | 3300049661 | Ga0501217_004723 | Ga0501217_004723_1238_2350 | 370 |
| 247 | 3300049663 | Ga0501223_001080 | Ga0501223_001080_5302_6414 | 370 |
| 248 | 3300049668 | Ga0501233_008107 | Ga0501233_008107_840_1952 | 370 |
| 249 | 3300049669 | Ga0501235_001997 | Ga0501235_001997_1333_2445 | 370 |
| 250 | 3300049675 | Ga0501243_002466 | Ga0501243_002466_373_1485 | 370 |
| 251 | 3300049682 | Ga0501252_002452 | Ga0501252_002452_489_1601 | 370 |
| 252 | 3300049688 | Ga0501259_001771 | Ga0501259_001771_701_1813 | 370 |
| 253 | 3300049689 | Ga0501260_003521 | Ga0501260_003521_230_1342 | 370 |
| 254 | 3300049708 | Ga0501245_000277 | Ga0501245_000277_3215_4327 | 370 |
| 255 | 3300049742 | Ga0501080_0027496 | Ga0501080_0027496_314_1435 | 370 |
| 256 | 3300049762 | Ga0501265_001647 | Ga0501265_001647_44_1156 | 370 |
| 257 | 3300049823 | Ga0501044_0033875 | Ga0501044_0033875_3023_4135 | 370 |
| 258 | 3300050511 | nmdc:mga08y16_211515_c1 | nmdc:mga08y16_211515_c1_330_1442 | 370 |
| 259 | 3300053086 | Ga0500578_0050086 | Ga0500578_0050086_438_1550 | 370 |
| 260 | 3300053134 | Ga0500658_0000010 | Ga0500658_0000010_84757_85869 | 370 |
| 261 | 3300053139 | Ga0500568_0003456 | Ga0500568_0003456_3528_4676 | 370 |
| 262 | 3300053730 | Ga0500645_000535 | Ga0500645_000535_1238_2350 | 370 |
| 263 | 3300003322 | rootL2_10059364 | rootL2_100593646 | 371 |
| 264 | 3300003322 | rootL2_10165617 | rootL2_101656171 | 371 |
| 265 | 3300005327 | Ga0070658_10274866 | Ga0070658_102748661 | 371 |
| 266 | 3300005340 | Ga0070689_100301440 | Ga0070689_1003014401 | 371 |
| 267 | 3300005354 | Ga0070675_100039657 | Ga0070675_1000396574 | 371 |
| 268 | 3300005355 | Ga0070671_100011735 | Ga0070671_1000117357 | 371 |
| 269 | 3300005364 | Ga0070673_100029243 | Ga0070673_1000292431 | 371 |
| 270 | 3300005456 | Ga0070678_100013590 | Ga0070678_1000135903 | 371 |
| 271 | 3300005543 | Ga0070672_100041655 | Ga0070672_1000416552 | 371 |
| 272 | 3300005615 | Ga0070702_100033838 | Ga0070702_1000338382 | 371 |
| 273 | 3300005842 | Ga0068858_100152658 | Ga0068858_1001526582 | 371 |
| 274 | 3300006195 | Ga0075366_10098470 | Ga0075366_100984702 | 371 |
| 275 | 3300006237 | Ga0097621_100128953 | Ga0097621_1001289532 | 371 |
| 276 | 3300009101 | Ga0105247_10001465 | Ga0105247_1000146513 | 371 |
| 277 | 3300013297 | Ga0157378_10021840 | Ga0157378_100218403 | 371 |
| 278 | 3300013306 | Ga0163162_10199667 | Ga0163162_101996672 | 371 |
| 279 | 3300014745 | Ga0157377_10002753 | Ga0157377_100027536 | 371 |
| 280 | 3300025900 | Ga0207710_10003815 | Ga0207710_100038152 | 371 |
| 281 | 3300025907 | Ga0207645_10021073 | Ga0207645_100210736 | 371 |
| 282 | 3300025918 | Ga0207662_10021088 | Ga0207662_100210884 | 371 |
| 283 | 3300025940 | Ga0207691_10108960 | Ga0207691_101089602 | 371 |
| 284 | 3300025942 | Ga0207689_10108259 | Ga0207689_101082592 | 371 |
| 285 | 3300025960 | Ga0207651_10046726 | Ga0207651_100467263 | 371 |
| 286 | 3300026023 | Ga0207677_10145903 | Ga0207677_101459032 | 371 |
| 287 | 3300026035 | Ga0207703_10244639 | Ga0207703_102446392 | 371 |
| 288 | 3300026121 | Ga0207683_10022617 | Ga0207683_100226172 | 371 |
| 289 | 3300026142 | Ga0207698_10159277 | Ga0207698_101592771 | 371 |
| 290 | 3300031456 | Ga0307513_10030364 | Ga0307513_100303643 | 371 |
| 291 | 3300031616 | Ga0307508_10000686 | Ga0307508_1000068617 | 371 |
| 292 | 3300031616 | Ga0307508_10211656 | Ga0307508_102116561 | 371 |
| 293 | 3300039062 | Ga0400483_065274 | Ga0400483_065274_135_1256 | 371 |
| 294 | 3300039062 | Ga0400483_111530 | Ga0400483_111530_1316_2437 | 371 |
| 295 | 3300039062 | Ga0400483_189257 | Ga0400483_189257_859_1980 | 371 |
| 296 | 3300044673 | Ga0453683_0072501 | Ga0453683_0072501_392_1573 | 371 |
| 297 | 3300044712 | Ga0453684_0195596 | Ga0453684_0195596_718_1881 | 371 |
| 298 | 3300044712 | Ga0453684_0284611 | Ga0453684_0284611_688_1869 | 371 |
| 299 | 3300045051 | Ga0451576_0004896 | Ga0451576_0004896_14856_16055 | 371 |
| 300 | 3300045051 | Ga0451576_0031094 | Ga0451576_0031094_3638_4819 | 371 |
| 301 | 3300046472 | Ga0495580_0096148 | Ga0495580_0096148_34_1149 | 371 |
| 302 | 3300046558 | Ga0495633_0000089 | Ga0495633_0000089_119110_120225 | 371 |
| 303 | 3300046660 | Ga0495625_0054436 | Ga0495625_0054436_520_1635 | 371 |
| 304 | 3300049580 | Ga0501046_0018235 | Ga0501046_0018235_933_2078 | 371 |
| 305 | 3300049581 | Ga0501047_0019071 | Ga0501047_0019071_4694_5809 | 371 |
| 306 | 3300050493 | nmdc:mga0k408_92671_c1 | nmdc:mga0k408_92671_c1_469_1584 | 371 |
| 307 | 3300053146 | Ga0500588_0001545 | Ga0500588_0001545_782_1897 | 371 |
| 308 | iso_pu_bacteria | 2896317667 | 2896320805 | 371 |
| 309 | iso_pu_bacteria | 2898713307 | 2898713690 | 371 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gpl-assembly1.cif.gz_B | crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4k6d-man | 0.9713 | 2 | 355 |
| 6gpj-assembly1.cif.gz_A | crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4f-man | 0.9709 | 2 | 355 |
| 6q94-assembly3.cif.gz_H-2 | crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man | 0.9707 | 2 | 354 |
| 6gpk-assembly1.cif.gz_C | crystal structure of human gdp-d-mannose 4,6-dehydratase (e157q) in complex with gdp-man | 0.9677 | 2 | 355 |
| 6q94-assembly2.cif.gz_D | crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man | 0.9663 | 2 | 355 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AC88_3_270_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9833 | 3 | 269 | 3.40.50.720 |
| af_P0AC88_3_270_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9761 | 3 | 269 | 3.40.50.720 |
| af_Q4D941_50_182_3.90.25.10 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.9688 | 193 | 332 | 3.90.25.10 |
| af_Q4D941_50_182_3.90.25.10 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.9616 | 193 | 332 | 3.90.25.10 |
| af_Q4CM81_7_150_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9559 | 2 | 149 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-S9XC08-F1-model_v4 | deleted | 0.9894 | 94 | 190 |
|
| AF-A0A7Y3G4X4-F1-model_v4 | GDP-mannose 4,6-dehydratase (EC 4.2.1.47) | 0.9867 | 201 | 371 |
GO:0008446
GO:0042351 |
| AF-A0A625RB69-F1-model_v4 | GDP-mannose 4,6-dehydratase (EC 4.2.1.47) | 0.9857 | 60 | 192 |
GO:0008446
GO:0042351 |
| AF-A0A146LA67-F1-model_v4 | GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) | 0.9831 | 123 | 288 |
GO:0008446
GO:0042351 |
| AF-A0A3A4XPU5-F1-model_v4 | GDP-mannose 4,6-dehydratase (EC 4.2.1.47) | 0.9829 | 1 | 263 |
GO:0008446
GO:0042351 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar