F400341
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 309 | 207 | 619 | 224 |
Family's Representative Sequence
| Representative Sequence | 3300045049|Ga0466959_0000001|Ga0466959_0000001_272191_272871 |
| Length | 226 |
| Sequence | MSFNKTKTDPVLGQEIHKHLLSLGIETPTIDNGLTIKQKVSKIEKHFKSIMETLGLDLTDDSLSETPLRVAKMYCSEIFWGLDPENFPKCTTVDNKMLYNQMLVEEDITIKSFCEHHALPIIGVATVAYIPNQKVLGLSKLNRICEYFSRRPQIQERLTEQIFHALKHILGTDNVAVMIDGAHTCVSMRGVEDETSRTTTSKLGGDFKENPMVRAEFMQIATRIRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 57 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 85 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 86 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 87 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 88 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 89 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 90 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 91 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 92 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 93 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 94 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 95 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 96 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 97 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 98 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 99 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 100 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 101 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 102 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 103 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 104 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 105 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 106 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 107 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 108 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 109 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 110 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 111 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 128 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 129 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 130 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 131 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 132 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 133 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 134 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 135 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 136 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 137 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 138 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 140 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 143 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 144 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 145 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 146 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 147 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 148 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 149 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 150 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 151 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 152 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 153 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 154 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 155 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 157 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 158 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 159 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 160 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 161 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 162 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 163 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 165 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 166 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 167 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 168 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 169 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 170 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 171 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 172 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 173 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 174 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 175 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 176 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 177 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 178 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 179 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 180 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 181 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 182 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 183 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 184 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 185 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 186 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 187 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 188 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 189 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 190 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 191 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 192 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 193 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 194 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 195 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 196 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 197 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 198 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 199 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 200 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 201 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 202 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 203 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 204 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 205 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 206 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 207 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.14 |
| Metatranscriptomes | 1.94 |
| Isolates | 13.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.65 |
| Bulb | 0 |
| Endosphere | 7.44 |
| Nodule | 0.32 |
| Rhizoplane | 0.65 |
| Rhizosphere | 76.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466959_0000001 | 3300045049 | Bacteria | 523572 |
| 2 | SwRhRL2b_contig_1043338 | 2162886007 | Bacteria | 1768 |
| 3 | SwRhRL2b_contig_1218049 | 2162886007 | Bacteria | 1721 |
| 4 | SwRhRL2b_contig_493616 | 2162886007 | Bacteria | 15810 |
| 5 | JGI24741J21665_1002211 | 3300001915 | Bacteria | 5163 |
| 6 | JGI24741J21665_1017277 | 3300001915 | Bacteria | 1167 |
| 7 | JGI25162J39368_1000173 | 3300002737 | Bacteria | 69607 |
| 8 | JGI25162J39368_1000929 | 3300002737 | Bacteria | 18819 |
| 9 | JGI25164J39214_1001715 | 3300002772 | Bacteria | 4417 |
| 10 | JGI25165J46597_1002022 | 3300003214 | Bacteria | 7721 |
| 11 | rootH1_10008383 | 3300003316 | Bacteria | 4246 |
| 12 | rootH1_10008383 | 3300003323 | Bacteria | 2245 |
| 13 | rootH2_10016497 | 3300003320 | Bacteria | 15383 |
| 14 | rootH2_10039028 | 3300003320 | Bacteria | 3118 |
| 15 | rootH2_10078616 | 3300003320 | Bacteria | 1934 |
| 16 | rootL2_10039178 | 3300003322 | Bacteria | 4477 |
| 17 | rootL2_10282992 | 3300003322 | Bacteria | 1260 |
| 18 | rootH1_10018051 | 3300003323 | Bacteria | 8284 |
| 19 | rootH1_10032442 | 3300003323 | Bacteria | 6027 |
| 20 | rootH1_10037343 | 3300003323 | Bacteria | 2008 |
| 21 | rootH1_10067883 | 3300003323 | Bacteria | 2395 |
| 22 | rootH1_10067884 | 3300003323 | Bacteria | 1114 |
| 23 | rootH1_10143935 | 3300003323 | Bacteria | 1379 |
| 24 | Ga0055534_1026535 | 3300003784 | Bacteria | 920 |
| 25 | Ga0058863_10147782 | 3300004799 | Bacteria | 2081 |
| 26 | Ga0058862_10014128 | 3300004803 | Bacteria | 1444 |
| 27 | Ga0065165_1001338 | 3300005262 | Bacteria | 27345 |
| 28 | Ga0065714_10064455 | 3300005288 | Bacteria | 72722 |
| 29 | Ga0065714_10067323 | 3300005288 | Bacteria | 5655 |
| 30 | Ga0065714_10073029 | 3300005288 | Bacteria | 3256 |
| 31 | Ga0065704_10000193 | 3300005289 | Bacteria | 203271 |
| 32 | Ga0065704_10079841 | 3300005289 | Bacteria | 4051 |
| 33 | Ga0065704_10116621 | 3300005289 | Bacteria | 1850 |
| 34 | Ga0070658_10061151 | 3300005327 | Bacteria | 3068 |
| 35 | Ga0070658_10194722 | 3300005327 | Bacteria | 1709 |
| 36 | Ga0070658_10222987 | 3300005327 | Bacteria | 1595 |
| 37 | Ga0070683_100004016 | 3300005329 | Bacteria | 12045 |
| 38 | Ga0070680_100046359 | 3300005336 | Bacteria | 3536 |
| 39 | Ga0070682_100001276 | 3300005337 | Bacteria | 14283 |
| 40 | Ga0070660_100063853 | 3300005339 | Bacteria | 2863 |
| 41 | Ga0070668_100049616 | 3300005347 | Bacteria | 3229 |
| 42 | Ga0070668_100131167 | 3300005347 | Bacteria | 2012 |
| 43 | Ga0070669_100110056 | 3300005353 | Bacteria | 2089 |
| 44 | Ga0070673_100818798 | 3300005364 | Unclassified | 860 |
| 45 | Ga0070713_100030371 | 3300005436 | Bacteria | 4291 |
| 46 | Ga0070663_100019282 | 3300005455 | Bacteria | 4492 |
| 47 | Ga0070663_100264426 | 3300005455 | Bacteria | 1365 |
| 48 | Ga0070681_10038297 | 3300005458 | Bacteria | 4808 |
| 49 | Ga0070684_100004401 | 3300005535 | Bacteria | 10717 |
| 50 | Ga0068854_100247371 | 3300005578 | Unclassified | 1422 |
| 51 | Ga0068856_100004615 | 3300005614 | Bacteria | 13688 |
| 52 | Ga0068856_100007721 | 3300005614 | Bacteria | 10502 |
| 53 | Ga0068856_100044610 | 3300005614 | Bacteria | 4364 |
| 54 | Ga0068856_100045503 | 3300005614 | Bacteria | 4322 |
| 55 | Ga0068852_100223866 | 3300005616 | Unclassified | 1790 |
| 56 | Ga0068859_100025296 | 3300005617 | Bacteria | 5955 |
| 57 | Ga0068862_100010249 | 3300005844 | Bacteria | 7733 |
| 58 | Ga0070717_10272589 | 3300006028 | Bacteria | 1499 |
| 59 | Ga0075428_100035633 | 3300006844 | Bacteria | 5485 |
| 60 | Ga0097620_100025296 | 3300006931 | Bacteria | 5955 |
| 61 | Ga0105244_10000160 | 3300009036 | Bacteria | 69914 |
| 62 | Ga0105250_10041406 | 3300009092 | Bacteria | 1847 |
| 63 | Ga0105240_10000221 | 3300009093 | Bacteria | 114656 |
| 64 | Ga0105240_10080239 | 3300009093 | Bacteria | 4013 |
| 65 | Ga0105240_10376296 | 3300009093 | Bacteria | 1604 |
| 66 | Ga0111539_10029175 | 3300009094 | Bacteria | 6725 |
| 67 | Ga0111539_10242343 | 3300009094 | Bacteria | 2099 |
| 68 | Ga0105243_10000734 | 3300009148 | Bacteria | 31383 |
| 69 | Ga0105243_10106215 | 3300009148 | Bacteria | 2340 |
| 70 | Ga0105241_10007010 | 3300009174 | Bacteria | 8291 |
| 71 | Ga0105237_10000227 | 3300009545 | Bacteria | 79785 |
| 72 | Ga0105237_10002671 | 3300009545 | Bacteria | 21891 |
| 73 | Ga0105238_10082106 | 3300009551 | Unclassified | 3213 |
| 74 | Ga0105249_11473712 | 3300009553 | Bacteria | 753 |
| 75 | Ga0105239_10002046 | 3300010375 | Bacteria | 26161 |
| 76 | Ga0105239_10004316 | 3300010375 | Bacteria | 17046 |
| 77 | Ga0157373_10000006 | 3300013100 | Bacteria | 261768 |
| 78 | Ga0157373_10000136 | 3300013100 | Bacteria | 57912 |
| 79 | Ga0157373_10610257 | 3300013100 | Bacteria | 795 |
| 80 | Ga0157371_10001805 | 3300013102 | Bacteria | 21630 |
| 81 | Ga0157371_10010674 | 3300013102 | Bacteria | 7133 |
| 82 | Ga0157371_10078651 | 3300013102 | Bacteria | 2336 |
| 83 | Ga0157371_10100353 | 3300013102 | Bacteria | 2053 |
| 84 | Ga0157370_10002846 | 3300013104 | Bacteria | 20668 |
| 85 | Ga0157370_10009886 | 3300013104 | Bacteria | 10110 |
| 86 | Ga0157370_10012813 | 3300013104 | Bacteria | 8668 |
| 87 | Ga0157370_10033056 | 3300013104 | Bacteria | 5045 |
| 88 | Ga0157370_10050905 | 3300013104 | Bacteria | 3957 |
| 89 | Ga0157370_10085812 | 3300013104 | Bacteria | 2958 |
| 90 | Ga0157370_10093408 | 3300013104 | Bacteria | 2823 |
| 91 | Ga0157370_10119303 | 3300013104 | Bacteria | 2463 |
| 92 | Ga0157370_10607933 | 3300013104 | Bacteria | 1001 |
| 93 | Ga0157369_10000224 | 3300013105 | Bacteria | 78178 |
| 94 | Ga0157369_10002231 | 3300013105 | Bacteria | 23333 |
| 95 | Ga0157369_10036682 | 3300013105 | Bacteria | 5370 |
| 96 | Ga0163162_10000285 | 3300013306 | Bacteria | 46149 |
| 97 | Ga0163162_10602532 | 3300013306 | Bacteria | 1225 |
| 98 | Ga0157372_10000037 | 3300013307 | Bacteria | 172444 |
| 99 | Ga0157372_10000410 | 3300013307 | Bacteria | 47006 |
| 100 | Ga0157372_10132576 | 3300013307 | Bacteria | 2868 |
| 101 | Ga0157372_10219941 | 3300013307 | Bacteria | 2201 |
| 102 | Ga0157375_10000209 | 3300013308 | Bacteria | 54570 |
| 103 | Ga0163163_10846402 | 3300014325 | Unclassified | 978 |
| 104 | Ga0157380_10007778 | 3300014326 | Bacteria | 7628 |
| 105 | Ga0182008_10000003 | 3300014497 | Bacteria | 456880 |
| 106 | Ga0182008_10000018 | 3300014497 | Bacteria | 230609 |
| 107 | Ga0182006_1000001 | 3300015261 | Bacteria | 1091090 |
| 108 | Ga0182006_1009979 | 3300015261 | Bacteria | 4242 |
| 109 | Ga0163161_10008390 | 3300017792 | Bacteria | 7151 |
| 110 | Ga0207427_100043 | 3300025231 | Bacteria | 249595 |
| 111 | Ga0209437_100170 | 3300025233 | Bacteria | 142489 |
| 112 | Ga0209437_100299 | 3300025233 | Bacteria | 69659 |
| 113 | Ga0209026_1005989 | 3300025250 | Bacteria | 3106 |
| 114 | Ga0209233_1000349 | 3300025261 | Bacteria | 43702 |
| 115 | Ga0209455_1004533 | 3300025272 | Bacteria | 4514 |
| 116 | Ga0209455_1006724 | 3300025272 | Bacteria | 3356 |
| 117 | Ga0209675_1003045 | 3300025291 | Bacteria | 8225 |
| 118 | Ga0209676_1000495 | 3300025292 | Bacteria | 63184 |
| 119 | Ga0207696_1025593 | 3300025711 | Bacteria | 1837 |
| 120 | Ga0207655_1000016 | 3300025728 | Bacteria | 551476 |
| 121 | Ga0207705_10142773 | 3300025909 | Bacteria | 1789 |
| 122 | Ga0207705_10167965 | 3300025909 | Bacteria | 1651 |
| 123 | Ga0207707_10016063 | 3300025912 | Bacteria | 6529 |
| 124 | Ga0207695_10000189 | 3300025913 | Bacteria | 177142 |
| 125 | Ga0207695_10259556 | 3300025913 | Bacteria | 1635 |
| 126 | Ga0207671_10000515 | 3300025914 | Bacteria | 52421 |
| 127 | Ga0207671_10002083 | 3300025914 | Bacteria | 21886 |
| 128 | Ga0207660_10033747 | 3300025917 | Bacteria | 3543 |
| 129 | Ga0207652_10007595 | 3300025921 | Bacteria | 8730 |
| 130 | Ga0207700_10008148 | 3300025928 | Bacteria | 6471 |
| 131 | Ga0207709_10000355 | 3300025935 | Bacteria | 46675 |
| 132 | Ga0207709_10174324 | 3300025935 | Bacteria | 1512 |
| 133 | Ga0207661_10053096 | 3300025944 | Bacteria | 3241 |
| 134 | Ga0207667_10492967 | 3300025949 | Bacteria | 1243 |
| 135 | Ga0207712_10038133 | 3300025961 | Bacteria | 3284 |
| 136 | Ga0207668_10095824 | 3300025972 | Bacteria | 2191 |
| 137 | Ga0207668_10096611 | 3300025972 | Bacteria | 2184 |
| 138 | Ga0207678_10047465 | 3300026067 | Bacteria | 3714 |
| 139 | Ga0207678_10432893 | 3300026067 | Bacteria | 1142 |
| 140 | Ga0207702_10057375 | 3300026078 | Bacteria | 3309 |
| 141 | Ga0207698_10191560 | 3300026142 | Unclassified | 1822 |
| 142 | Ga0268265_10011287 | 3300028380 | Bacteria | 6039 |
| 143 | Ga0307515_10037470 | 3300028794 | Bacteria | 7798 |
| 144 | Ga0265338_10082101 | 3300028800 | Bacteria | 2700 |
| 145 | Ga0265324_10111918 | 3300029957 | Bacteria | 927 |
| 146 | Ga0265327_10001894 | 3300031251 | Bacteria | 24216 |
| 147 | Ga0265327_10019753 | 3300031251 | Bacteria | 4130 |
| 148 | Ga0307509_10143410 | 3300031507 | Unclassified | 2319 |
| 149 | Ga0316576_10181659 | 3300031727 | Bacteria | 1587 |
| 150 | Ga0307516_10251447 | 3300031730 | Bacteria | 1462 |
| 151 | Ga0307412_10000036 | 3300031911 | Bacteria | 192270 |
| 152 | Ga0307412_10000077 | 3300031911 | Bacteria | 96375 |
| 153 | Ga0307412_10009055 | 3300031911 | Bacteria | 5704 |
| 154 | Ga0307412_10197665 | 3300031911 | Bacteria | 1525 |
| 155 | Ga0307416_100000006 | 3300032002 | Bacteria | 466074 |
| 156 | Ga0307416_100364409 | 3300032002 | Bacteria | 1469 |
| 157 | Ga0307414_10000043 | 3300032004 | Bacteria | 137764 |
| 158 | Ga0307414_10009225 | 3300032004 | Bacteria | 5654 |
| 159 | Ga0307414_10037854 | 3300032004 | Bacteria | 3234 |
| 160 | Ga0307414_10098717 | 3300032004 | Bacteria | 2192 |
| 161 | Ga0307414_10124647 | 3300032004 | Bacteria | 1988 |
| 162 | Ga0307414_10160365 | 3300032004 | Bacteria | 1785 |
| 163 | Ga0307414_10797517 | 3300032004 | Bacteria | 861 |
| 164 | Ga0316585_10036182 | 3300032137 | Bacteria | 1565 |
| 165 | Ga0316574_0368167 | 3300035398 | Bacteria | 908 |
| 166 | Ga0316584_0021498 | 3300036712 | Bacteria | 4690 |
| 167 | Ga0316584_0187221 | 3300036712 | Bacteria | 1531 |
| 168 | Ga0316584_0306038 | 3300036712 | Unclassified | 1150 |
| 169 | Ga0395899_0000180 | 3300037312 | Bacteria | 92701 |
| 170 | Ga0395899_0052222 | 3300037312 | Bacteria | 3031 |
| 171 | Ga0395900_0000122 | 3300037418 | Bacteria | 133423 |
| 172 | Ga0395900_0008411 | 3300037418 | Bacteria | 10619 |
| 173 | Ga0395900_0721173 | 3300037418 | Bacteria | 929 |
| 174 | Ga0395898_0059552 | 3300037466 | Bacteria | 3714 |
| 175 | Ga0395905_0001611 | 3300037471 | Bacteria | 26826 |
| 176 | Ga0395905_0021935 | 3300037471 | Bacteria | 6040 |
| 177 | Ga0395901_0001566 | 3300038443 | Bacteria | 23712 |
| 178 | Ga0395901_0134334 | 3300038443 | Bacteria | 2600 |
| 179 | Ga0439466_0013706 | 3300041411 | Bacteria | 2964 |
| 180 | Ga0451797_0615602 | 3300041453 | Bacteria | 1041 |
| 181 | Ga0439445_0003202 | 3300042004 | Bacteria | 3670 |
| 182 | Ga0439445_0059475 | 3300042004 | Bacteria | 1043 |
| 183 | Ga0466982_0155050 | 3300044672 | Bacteria | 1399 |
| 184 | Ga0453683_0011789 | 3300044673 | Bacteria | 5756 |
| 185 | Ga0466966_0019426 | 3300044684 | Bacteria | 4469 |
| 186 | Ga0466961_0000001 | 3300044693 | Bacteria | 290322 |
| 187 | Ga0466961_0083334 | 3300044693 | Bacteria | 2022 |
| 188 | Ga0453684_0003191 | 3300044712 | Bacteria | 37570 |
| 189 | Ga0453684_0017716 | 3300044712 | Bacteria | 11003 |
| 190 | Ga0453684_0256283 | 3300044712 | Unclassified | 2006 |
| 191 | Ga0453684_0351065 | 3300044712 | Unclassified | 1663 |
| 192 | Ga0466959_0063611 | 3300045049 | Bacteria | 2679 |
| 193 | Ga0451576_0009056 | 3300045051 | Bacteria | 11591 |
| 194 | Ga0451576_0053481 | 3300045051 | Bacteria | 4230 |
| 195 | Ga0451576_0178596 | 3300045051 | Bacteria | 2216 |
| 196 | Ga0495627_000081 | 3300046453 | Bacteria | 116262 |
| 197 | Ga0495596_0002543 | 3300046500 | Bacteria | 9747 |
| 198 | Ga0495606_0003773 | 3300046507 | Bacteria | 15747 |
| 199 | Ga0495606_0050953 | 3300046507 | Bacteria | 2703 |
| 200 | Ga0495606_0115180 | 3300046507 | Bacteria | 1616 |
| 201 | Ga0495606_0337708 | 3300046507 | Bacteria | 804 |
| 202 | Ga0495610_0000005 | 3300046512 | Bacteria | 924111 |
| 203 | Ga0495610_0040907 | 3300046512 | Bacteria | 2331 |
| 204 | Ga0495631_0075174 | 3300046518 | Bacteria | 1458 |
| 205 | Ga0495632_0002129 | 3300046519 | Bacteria | 15416 |
| 206 | Ga0495643_0004112 | 3300046522 | Bacteria | 10346 |
| 207 | Ga0495644_0019481 | 3300046523 | Bacteria | 2591 |
| 208 | Ga0495663_0000680 | 3300046525 | Bacteria | 11726 |
| 209 | Ga0495663_0005383 | 3300046525 | Bacteria | 3552 |
| 210 | Ga0495654_0000003 | 3300046530 | Bacteria | 863485 |
| 211 | Ga0495609_0000311 | 3300046538 | Bacteria | 43792 |
| 212 | Ga0495633_0000114 | 3300046558 | Bacteria | 108708 |
| 213 | Ga0495633_0031288 | 3300046558 | Bacteria | 2582 |
| 214 | Ga0495625_0002476 | 3300046660 | Bacteria | 19910 |
| 215 | Ga0495661_0002083 | 3300046665 | Bacteria | 15695 |
| 216 | Ga0495661_0191485 | 3300046665 | Bacteria | 1077 |
| 217 | Ga0495677_0018237 | 3300047445 | Bacteria | 2544 |
| 218 | Ga0495686_0000133 | 3300047472 | Bacteria | 151597 |
| 219 | Ga0495686_0062493 | 3300047472 | Bacteria | 2310 |
| 220 | Ga0496102_0106409 | 3300048905 | Bacteria | 2610 |
| 221 | Ga0496116_0000029 | 3300048919 | Bacteria | 422187 |
| 222 | Ga0496117_0000007 | 3300048920 | Bacteria | 720505 |
| 223 | Ga0496118_0015187 | 3300048921 | Bacteria | 7150 |
| 224 | Ga0496119_0000007 | 3300048922 | Bacteria | 475920 |
| 225 | Ga0496121_0174253 | 3300048924 | Bacteria | 1559 |
| 226 | Ga0496122_0000946 | 3300048925 | Bacteria | 52631 |
| 227 | Ga0496122_0001893 | 3300048925 | Bacteria | 31687 |
| 228 | Ga0496122_0001900 | 3300048925 | Bacteria | 31591 |
| 229 | Ga0496122_0001976 | 3300048925 | Bacteria | 30631 |
| 230 | Ga0496122_0002061 | 3300048925 | Bacteria | 29808 |
| 231 | Ga0496123_0001726 | 3300048926 | Bacteria | 29009 |
| 232 | Ga0496123_0039399 | 3300048926 | Bacteria | 3306 |
| 233 | Ga0496124_0001116 | 3300048927 | Bacteria | 42242 |
| 234 | Ga0496124_0120543 | 3300048927 | Bacteria | 2096 |
| 235 | Ga0496125_0001777 | 3300048928 | Bacteria | 29790 |
| 236 | Ga0496125_0017671 | 3300048928 | Bacteria | 6790 |
| 237 | Ga0496125_0038759 | 3300048928 | Bacteria | 4116 |
| 238 | Ga0496126_0004748 | 3300048929 | Bacteria | 16022 |
| 239 | Ga0501305_008734 | 3300049161 | Bacteria | 1317 |
| 240 | Ga0501300_009399 | 3300049523 | Bacteria | 1426 |
| 241 | Ga0501315_003985 | 3300049531 | Bacteria | 1514 |
| 242 | Ga0501315_007848 | 3300049531 | Bacteria | 1226 |
| 243 | Ga0501034_0154333 | 3300049571 | Bacteria | 2270 |
| 244 | Ga0501202_022956 | 3300049652 | Bacteria | 1256 |
| 245 | Ga0501209_019465 | 3300049656 | Bacteria | 1585 |
| 246 | Ga0501217_030659 | 3300049661 | Bacteria | 1321 |
| 247 | Ga0501222_004839 | 3300049662 | Bacteria | 1830 |
| 248 | Ga0501223_000517 | 3300049663 | Bacteria | 9302 |
| 249 | Ga0501235_015576 | 3300049669 | Bacteria | 1677 |
| 250 | Ga0501239_007681 | 3300049672 | Bacteria | 1135 |
| 251 | Ga0501242_016748 | 3300049674 | Bacteria | 920 |
| 252 | Ga0501247_018774 | 3300049677 | Bacteria | 885 |
| 253 | Ga0501257_001930 | 3300049686 | Bacteria | 4317 |
| 254 | Ga0501225_0024089 | 3300049705 | Bacteria | 1676 |
| 255 | Ga0501241_005117 | 3300049758 | Bacteria | 2449 |
| 256 | nmdc:mga0k408_309871_c1 | 3300050493 | Unclassified | 942 |
| 257 | nmdc:mga0qj67_43513_c1 | 3300050509 | Bacteria | 3536 |
| 258 | Ga0500647_0042598 | 3300053091 | Bacteria | 2180 |
| 259 | Ga0500651_0000218 | 3300053093 | Bacteria | 35905 |
| 260 | Ga0500618_005975 | 3300053125 | Bacteria | 3630 |
| 261 | Ga0500568_0039819 | 3300053139 | Bacteria | 1895 |
| 262 | Ga0500604_0002020 | 3300053151 | Bacteria | 5607 |
| 263 | Ga0500622_0000003 | 3300053156 | Bacteria | 613483 |
| 264 | Ga0500622_0000062 | 3300053156 | Bacteria | 130392 |
| 265 | Ga0500645_097602 | 3300053730 | Bacteria | 830 |
| 266 | Ga0587062_007733 | 3300059639 | Bacteria | 1263 |
| 267 | Ga0466962_0284155 | 3300061719 | Bacteria | 817 |
| 268 | 2511231034 | 2511231000 | Bacteria | 4488346 |
| 269 | 2522551480 | 2522125168 | Bacteria | 7376607 |
| 270 | 2524005402 | 2523533629 | Bacteria | 2982326 |
| 271 | 2585143661 | 2582581278 | Bacteria | 5296881 |
| 272 | 2585156498 | 2582581281 | Bacteria | 4487904 |
| 273 | 2585160851 | 2582581282 | Bacteria | 4495830 |
| 274 | 2587680049 | 2585428045 | Bacteria | 5203023 |
| 275 | 2587748705 | 2585428060 | Bacteria | 5304711 |
| 276 | 2587945382 | 2585428115 | Bacteria | 4420269 |
| 277 | 2588211564 | 2585428182 | Bacteria | 5007281 |
| 278 | 2588215948 | 2585428183 | Bacteria | 5166119 |
| 279 | 2588219370 | 2585428184 | Bacteria | 4978681 |
| 280 | 2588224852 | 2585428185 | Bacteria | 4969476 |
| 281 | 2588234684 | 2585428187 | Bacteria | 4629388 |
| 282 | 2588447639 | 2588253712 | Bacteria | 5403181 |
| 283 | 2590603269 | 2588254255 | Bacteria | 5014294 |
| 284 | 2590610282 | 2588254257 | Bacteria | 5436094 |
| 285 | 2729200688 | 2728369107 | Bacteria | 5082720 |
| 286 | 2738761015 | 2738541284 | Bacteria | 5199923 |
| 287 | 2740031268 | 2739367866 | Bacteria | 4215900 |
| 288 | 2740060502 | 2739367874 | Bacteria | 4872888 |
| 289 | 2753674272 | 2751185877 | Bacteria | 4921427 |
| 290 | 2765575760 | 2765235839 | Bacteria | 5314748 |
| 291 | 2772606101 | 2772190705 | Bacteria | 4666226 |
| 292 | 2776613201 | 2775506987 | Bacteria | 5373360 |
| 293 | 2816875599 | 2816332188 | Bacteria | 5133218 |
| 294 | 2842086328 | 2842083920 | Bacteria | 4857652 |
| 295 | 2857628564 | 2857627736 | Bacteria | 5625397 |
| 296 | 2871723680 | 2871720351 | Bacteria | 4862476 |
| 297 | 2889293744 | 2889290771 | Bacteria | 5530962 |
| 298 | 2906001109 | 2905999023 | Bacteria | 4591259 |
| 299 | 2910246750 | 2910245624 | Bacteria | 6935613 |
| 300 | 2911141166 | 2911138879 | Bacteria | 5811561 |
| 301 | 2919403121 | 2919399522 | Bacteria | 5164947 |
| 302 | 2919687098 | 2919683626 | Bacteria | 5534354 |
| 303 | 2945924729 | 2945924605 | Bacteria | 4296724 |
| 304 | 2946024155 | 2946019816 | Bacteria | 4621265 |
| 305 | 2977247681 | 2977243572 | Bacteria | 4374394 |
| 306 | 2984574516 | 2984572630 | Bacteria | 4186940 |
| 307 | 2984607967 | 2984606641 | Bacteria | 4186971 |
| 308 | 2993375023 | 2993372514 | Bacteria | 4214139 |
| 309 | 2993481887 | 2993480792 | Bacteria | 4022225 |
| 310 | 8036738239 | 8036736890 | Bacteria | 2944828 |
| 311 | Ga0466959_0000001 | |||
| 312 | SwRhRL2b_contig_1043338 | |||
| 313 | SwRhRL2b_contig_1218049 | |||
| 314 | SwRhRL2b_contig_493616 | |||
| 315 | JGI24741J21665_1002211 | |||
| 316 | JGI24741J21665_1017277 | |||
| 317 | JGI25162J39368_1000173 | |||
| 318 | JGI25162J39368_1000929 | |||
| 319 | JGI25164J39214_1001715 | |||
| 320 | JGI25165J46597_1002022 | |||
| 321 | rootH1_10008383 | |||
| 322 | rootH2_10016497 | |||
| 323 | rootH2_10039028 | |||
| 324 | rootH2_10078616 | |||
| 325 | rootL2_10039178 | |||
| 326 | rootL2_10282992 | |||
| 327 | rootH1_10018051 | |||
| 328 | rootH1_10032442 | |||
| 329 | rootH1_10037343 | |||
| 330 | rootH1_10067883 | |||
| 331 | rootH1_10067884 | |||
| 332 | rootH1_10143935 | |||
| 333 | Ga0055534_1026535 | |||
| 334 | Ga0058863_10147782 | |||
| 335 | Ga0058862_10014128 | |||
| 336 | Ga0065165_1001338 | |||
| 337 | Ga0065714_10064455 | |||
| 338 | Ga0065714_10067323 | |||
| 339 | Ga0065714_10073029 | |||
| 340 | Ga0065704_10000193 | |||
| 341 | Ga0065704_10079841 | |||
| 342 | Ga0065704_10116621 | |||
| 343 | Ga0070658_10061151 | |||
| 344 | Ga0070658_10194722 | |||
| 345 | Ga0070658_10222987 | |||
| 346 | Ga0070683_100004016 | |||
| 347 | Ga0070680_100046359 | |||
| 348 | Ga0070682_100001276 | |||
| 349 | Ga0070660_100063853 | |||
| 350 | Ga0070668_100049616 | |||
| 351 | Ga0070668_100131167 | |||
| 352 | Ga0070669_100110056 | |||
| 353 | Ga0070673_100818798 | |||
| 354 | Ga0070713_100030371 | |||
| 355 | Ga0070663_100019282 | |||
| 356 | Ga0070663_100264426 | |||
| 357 | Ga0070681_10038297 | |||
| 358 | Ga0070684_100004401 | |||
| 359 | Ga0068854_100247371 | |||
| 360 | Ga0068856_100004615 | |||
| 361 | Ga0068856_100007721 | |||
| 362 | Ga0068856_100044610 | |||
| 363 | Ga0068856_100045503 | |||
| 364 | Ga0068852_100223866 | |||
| 365 | Ga0068859_100025296 | |||
| 366 | Ga0068862_100010249 | |||
| 367 | Ga0070717_10272589 | |||
| 368 | Ga0075428_100035633 | |||
| 369 | Ga0097620_100025296 | |||
| 370 | Ga0105244_10000160 | |||
| 371 | Ga0105250_10041406 | |||
| 372 | Ga0105240_10000221 | |||
| 373 | Ga0105240_10080239 | |||
| 374 | Ga0105240_10376296 | |||
| 375 | Ga0111539_10029175 | |||
| 376 | Ga0111539_10242343 | |||
| 377 | Ga0105243_10000734 | |||
| 378 | Ga0105243_10106215 | |||
| 379 | Ga0105241_10007010 | |||
| 380 | Ga0105237_10000227 | |||
| 381 | Ga0105237_10002671 | |||
| 382 | Ga0105238_10082106 | |||
| 383 | Ga0105249_11473712 | |||
| 384 | Ga0105239_10002046 | |||
| 385 | Ga0105239_10004316 | |||
| 386 | Ga0157373_10000006 | |||
| 387 | Ga0157373_10000136 | |||
| 388 | Ga0157373_10610257 | |||
| 389 | Ga0157371_10001805 | |||
| 390 | Ga0157371_10010674 | |||
| 391 | Ga0157371_10078651 | |||
| 392 | Ga0157371_10100353 | |||
| 393 | Ga0157370_10002846 | |||
| 394 | Ga0157370_10009886 | |||
| 395 | Ga0157370_10012813 | |||
| 396 | Ga0157370_10033056 | |||
| 397 | Ga0157370_10050905 | |||
| 398 | Ga0157370_10085812 | |||
| 399 | Ga0157370_10093408 | |||
| 400 | Ga0157370_10119303 | |||
| 401 | Ga0157370_10607933 | |||
| 402 | Ga0157369_10000224 | |||
| 403 | Ga0157369_10002231 | |||
| 404 | Ga0157369_10036682 | |||
| 405 | Ga0163162_10000285 | |||
| 406 | Ga0163162_10602532 | |||
| 407 | Ga0157372_10000037 | |||
| 408 | Ga0157372_10000410 | |||
| 409 | Ga0157372_10132576 | |||
| 410 | Ga0157372_10219941 | |||
| 411 | Ga0157375_10000209 | |||
| 412 | Ga0163163_10846402 | |||
| 413 | Ga0157380_10007778 | |||
| 414 | Ga0182008_10000003 | |||
| 415 | Ga0182008_10000018 | |||
| 416 | Ga0182006_1000001 | |||
| 417 | Ga0182006_1009979 | |||
| 418 | Ga0163161_10008390 | |||
| 419 | Ga0207427_100043 | |||
| 420 | Ga0209437_100170 | |||
| 421 | Ga0209437_100299 | |||
| 422 | Ga0209026_1005989 | |||
| 423 | Ga0209233_1000349 | |||
| 424 | Ga0209455_1004533 | |||
| 425 | Ga0209455_1006724 | |||
| 426 | Ga0209675_1003045 | |||
| 427 | Ga0209676_1000495 | |||
| 428 | Ga0207696_1025593 | |||
| 429 | Ga0207655_1000016 | |||
| 430 | Ga0207705_10142773 | |||
| 431 | Ga0207705_10167965 | |||
| 432 | Ga0207707_10016063 | |||
| 433 | Ga0207695_10000189 | |||
| 434 | Ga0207695_10259556 | |||
| 435 | Ga0207671_10000515 | |||
| 436 | Ga0207671_10002083 | |||
| 437 | Ga0207660_10033747 | |||
| 438 | Ga0207652_10007595 | |||
| 439 | Ga0207700_10008148 | |||
| 440 | Ga0207709_10000355 | |||
| 441 | Ga0207709_10174324 | |||
| 442 | Ga0207661_10053096 | |||
| 443 | Ga0207667_10492967 | |||
| 444 | Ga0207712_10038133 | |||
| 445 | Ga0207668_10095824 | |||
| 446 | Ga0207668_10096611 | |||
| 447 | Ga0207678_10047465 | |||
| 448 | Ga0207678_10432893 | |||
| 449 | Ga0207702_10057375 | |||
| 450 | Ga0207698_10191560 | |||
| 451 | Ga0268265_10011287 | |||
| 452 | Ga0307515_10037470 | |||
| 453 | Ga0265338_10082101 | |||
| 454 | Ga0265324_10111918 | |||
| 455 | Ga0265327_10001894 | |||
| 456 | Ga0265327_10019753 | |||
| 457 | Ga0307509_10143410 | |||
| 458 | Ga0316576_10181659 | |||
| 459 | Ga0307516_10251447 | |||
| 460 | Ga0307412_10000036 | |||
| 461 | Ga0307412_10000077 | |||
| 462 | Ga0307412_10009055 | |||
| 463 | Ga0307412_10197665 | |||
| 464 | Ga0307416_100000006 | |||
| 465 | Ga0307416_100364409 | |||
| 466 | Ga0307414_10000043 | |||
| 467 | Ga0307414_10009225 | |||
| 468 | Ga0307414_10037854 | |||
| 469 | Ga0307414_10098717 | |||
| 470 | Ga0307414_10124647 | |||
| 471 | Ga0307414_10160365 | |||
| 472 | Ga0307414_10797517 | |||
| 473 | Ga0316585_10036182 | |||
| 474 | Ga0316574_0368167 | |||
| 475 | Ga0316584_0021498 | |||
| 476 | Ga0316584_0187221 | |||
| 477 | Ga0316584_0306038 | |||
| 478 | Ga0395899_0000180 | |||
| 479 | Ga0395899_0052222 | |||
| 480 | Ga0395900_0000122 | |||
| 481 | Ga0395900_0008411 | |||
| 482 | Ga0395900_0721173 | |||
| 483 | Ga0395898_0059552 | |||
| 484 | Ga0395905_0001611 | |||
| 485 | Ga0395905_0021935 | |||
| 486 | Ga0395901_0001566 | |||
| 487 | Ga0395901_0134334 | |||
| 488 | Ga0439466_0013706 | |||
| 489 | Ga0451797_0615602 | |||
| 490 | Ga0439445_0003202 | |||
| 491 | Ga0439445_0059475 | |||
| 492 | Ga0466982_0155050 | |||
| 493 | Ga0453683_0011789 | |||
| 494 | Ga0466966_0019426 | |||
| 495 | Ga0466961_0000001 | |||
| 496 | Ga0466961_0083334 | |||
| 497 | Ga0453684_0003191 | |||
| 498 | Ga0453684_0017716 | |||
| 499 | Ga0453684_0256283 | |||
| 500 | Ga0453684_0351065 | |||
| 501 | Ga0466959_0063611 | |||
| 502 | Ga0451576_0009056 | |||
| 503 | Ga0451576_0053481 | |||
| 504 | Ga0451576_0178596 | |||
| 505 | Ga0495627_000081 | |||
| 506 | Ga0495596_0002543 | |||
| 507 | Ga0495606_0003773 | |||
| 508 | Ga0495606_0050953 | |||
| 509 | Ga0495606_0115180 | |||
| 510 | Ga0495606_0337708 | |||
| 511 | Ga0495610_0000005 | |||
| 512 | Ga0495610_0040907 | |||
| 513 | Ga0495631_0075174 | |||
| 514 | Ga0495632_0002129 | |||
| 515 | Ga0495643_0004112 | |||
| 516 | Ga0495644_0019481 | |||
| 517 | Ga0495663_0000680 | |||
| 518 | Ga0495663_0005383 | |||
| 519 | Ga0495654_0000003 | |||
| 520 | Ga0495609_0000311 | |||
| 521 | Ga0495633_0000114 | |||
| 522 | Ga0495633_0031288 | |||
| 523 | Ga0495625_0002476 | |||
| 524 | Ga0495661_0002083 | |||
| 525 | Ga0495661_0191485 | |||
| 526 | Ga0495677_0018237 | |||
| 527 | Ga0495686_0000133 | |||
| 528 | Ga0495686_0062493 | |||
| 529 | Ga0496102_0106409 | |||
| 530 | Ga0496116_0000029 | |||
| 531 | Ga0496117_0000007 | |||
| 532 | Ga0496118_0015187 | |||
| 533 | Ga0496119_0000007 | |||
| 534 | Ga0496121_0174253 | |||
| 535 | Ga0496122_0000946 | |||
| 536 | Ga0496122_0001893 | |||
| 537 | Ga0496122_0001900 | |||
| 538 | Ga0496122_0001976 | |||
| 539 | Ga0496122_0002061 | |||
| 540 | Ga0496123_0001726 | |||
| 541 | Ga0496123_0039399 | |||
| 542 | Ga0496124_0001116 | |||
| 543 | Ga0496124_0120543 | |||
| 544 | Ga0496125_0001777 | |||
| 545 | Ga0496125_0017671 | |||
| 546 | Ga0496125_0038759 | |||
| 547 | Ga0496126_0004748 | |||
| 548 | Ga0501305_008734 | |||
| 549 | Ga0501300_009399 | |||
| 550 | Ga0501315_003985 | |||
| 551 | Ga0501315_007848 | |||
| 552 | Ga0501034_0154333 | |||
| 553 | Ga0501202_022956 | |||
| 554 | Ga0501209_019465 | |||
| 555 | Ga0501217_030659 | |||
| 556 | Ga0501222_004839 | |||
| 557 | Ga0501223_000517 | |||
| 558 | Ga0501235_015576 | |||
| 559 | Ga0501239_007681 | |||
| 560 | Ga0501242_016748 | |||
| 561 | Ga0501247_018774 | |||
| 562 | Ga0501257_001930 | |||
| 563 | Ga0501225_0024089 | |||
| 564 | Ga0501241_005117 | |||
| 565 | nmdc:mga0k408_309871_c1 | |||
| 566 | nmdc:mga0qj67_43513_c1 | |||
| 567 | Ga0500647_0042598 | |||
| 568 | Ga0500651_0000218 | |||
| 569 | Ga0500618_005975 | |||
| 570 | Ga0500568_0039819 | |||
| 571 | Ga0500604_0002020 | |||
| 572 | Ga0500622_0000003 | |||
| 573 | Ga0500622_0000062 | |||
| 574 | Ga0500645_097602 | |||
| 575 | Ga0587062_007733 | |||
| 576 | Ga0466962_0284155 | |||
| 577 | 2511231034 | |||
| 578 | 2522551480 | |||
| 579 | 2524005402 | |||
| 580 | 2585143661 | |||
| 581 | 2585156498 | |||
| 582 | 2585160851 | |||
| 583 | 2587680049 | |||
| 584 | 2587748705 | |||
| 585 | 2587945382 | |||
| 586 | 2588211564 | |||
| 587 | 2588215948 | |||
| 588 | 2588219370 | |||
| 589 | 2588224852 | |||
| 590 | 2588234684 | |||
| 591 | 2588447639 | |||
| 592 | 2590603269 | |||
| 593 | 2590610282 | |||
| 594 | 2729200688 | |||
| 595 | 2738761015 | |||
| 596 | 2740031268 | |||
| 597 | 2740060502 | |||
| 598 | 2753674272 | |||
| 599 | 2765575760 | |||
| 600 | 2772606101 | |||
| 601 | 2776613201 | |||
| 602 | 2816875599 | |||
| 603 | 2842086328 | |||
| 604 | 2857628564 | |||
| 605 | 2871723680 | |||
| 606 | 2889293744 | |||
| 607 | 2906001109 | |||
| 608 | 2910246750 | |||
| 609 | 2911141166 | |||
| 610 | 2919403121 | |||
| 611 | 2919687098 | |||
| 612 | 2945924729 | |||
| 613 | 2946024155 | |||
| 614 | 2977247681 | |||
| 615 | 2984574516 | |||
| 616 | 2984607967 | |||
| 617 | 2993375023 | |||
| 618 | 2993481887 | |||
| 619 | 8036738239 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z89-assembly1.cif.gz_C-2 | human gtp cyclohydrolase i in complex with allosteric inhibitor | 0.9496 | 101 | 231 |
| 6z85-assembly1.cif.gz_A | inhibitory human gtp cyclohydrolase i - gfrp complex | 0.942 | 50 | 231 |
| 6z89-assembly1.cif.gz_C-2 | human gtp cyclohydrolase i in complex with allosteric inhibitor | 0.942 | 101 | 231 |
| 6z89-assembly1.cif.gz_B-2 | human gtp cyclohydrolase i in complex with allosteric inhibitor | 0.9385 | 46 | 231 |
| 6z88-assembly1.cif.gz_J | human gtp cyclohydrolase i in complex with allosteric inhibitor | 0.9366 | 46 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1a8rA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9704 | 100 | 232 | 3.30.1130.10 |
| 4uqfA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9583 | 108 | 232 | 3.30.1130.10 |
| 1a8rA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9427 | 100 | 232 | 3.30.1130.10 |
| af_A0A1D6DUT0_342_468_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9258 | 112 | 230 | 3.30.1130.10 |
| af_Q8I5H7_254_381_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9242 | 101 | 221 | 3.30.1130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0L8VDE2-F1-model_v4 | GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) | 0.988 | 37 | 230 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654 |
| AF-A0A3D1E5D5-F1-model_v4 | GTP cyclohydrolase I (EC 3.5.4.16) | 0.9806 | 30 | 180 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654 |
| AF-A0A382L1Q8-F1-model_v4 | GTP cyclohydrolase I (EC 3.5.4.16) | 0.9803 | 58 | 185 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0008270 GO:0046654 |
| AF-A0A4V1ZVP6-F1-model_v4 | GTP cyclohydrolase I (EC 3.5.4.16) | 0.9798 | 65 | 232 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654 |
| AF-A0A090R0V7-F1-model_v4 | deleted | 0.9793 | 113 | 227 |
|