F400341

General Info

Members Datasets Scaffolds Average Seq Length
309 207 619 224

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0000001|Ga0466959_0000001_272191_272871
Length 226
Sequence MSFNKTKTDPVLGQEIHKHLLSLGIETPTIDNGLTIKQKVSKIEKHFKSIMETLGLDLTDDSLSETPLRVAKMYCSEIFWGLDPENFPKCTTVDNKMLYNQMLVEEDITIKSFCEHHALPIIGVATVAYIPNQKVLGLSKLNRICEYFSRRPQIQERLTEQIFHALKHILGTDNVAVMIDGAHTCVSMRGVEDETSRTTTSKLGGDFKENPMVRAEFMQIATRIRK

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
103 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
104 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
105 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
140 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
143 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
144 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
145 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
146 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
147 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
148 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
149 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
150 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
151 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
152 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
153 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
157 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
158 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
161 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
162 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
163 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
166 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
167 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
168 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
169 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
170 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
171 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
172 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
173 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
174 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
175 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
176 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
177 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
178 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
179 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
180 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
181 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
182 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
183 2738541284 Pedobacter sp. YR016 Isolate Unclassified
184 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
185 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
186 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
187 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
188 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
189 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
190 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
191 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
192 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
193 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
194 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
195 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
196 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
197 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
198 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
199 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
200 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
201 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
202 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
203 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
204 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
205 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
206 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
207 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.14
Metatranscriptomes 1.94
Isolates 13.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.65
Bulb 0
Endosphere 7.44
Nodule 0.32
Rhizoplane 0.65
Rhizosphere 76.05
Stem 0
Stem Tuber 0
Unclassified 3.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0000001 3300045049 Bacteria 523572
2 SwRhRL2b_contig_1043338 2162886007 Bacteria 1768
3 SwRhRL2b_contig_1218049 2162886007 Bacteria 1721
4 SwRhRL2b_contig_493616 2162886007 Bacteria 15810
5 JGI24741J21665_1002211 3300001915 Bacteria 5163
6 JGI24741J21665_1017277 3300001915 Bacteria 1167
7 JGI25162J39368_1000173 3300002737 Bacteria 69607
8 JGI25162J39368_1000929 3300002737 Bacteria 18819
9 JGI25164J39214_1001715 3300002772 Bacteria 4417
10 JGI25165J46597_1002022 3300003214 Bacteria 7721
11 rootH1_10008383 3300003316 Bacteria 4246
12 rootH1_10008383 3300003323 Bacteria 2245
13 rootH2_10016497 3300003320 Bacteria 15383
14 rootH2_10039028 3300003320 Bacteria 3118
15 rootH2_10078616 3300003320 Bacteria 1934
16 rootL2_10039178 3300003322 Bacteria 4477
17 rootL2_10282992 3300003322 Bacteria 1260
18 rootH1_10018051 3300003323 Bacteria 8284
19 rootH1_10032442 3300003323 Bacteria 6027
20 rootH1_10037343 3300003323 Bacteria 2008
21 rootH1_10067883 3300003323 Bacteria 2395
22 rootH1_10067884 3300003323 Bacteria 1114
23 rootH1_10143935 3300003323 Bacteria 1379
24 Ga0055534_1026535 3300003784 Bacteria 920
25 Ga0058863_10147782 3300004799 Bacteria 2081
26 Ga0058862_10014128 3300004803 Bacteria 1444
27 Ga0065165_1001338 3300005262 Bacteria 27345
28 Ga0065714_10064455 3300005288 Bacteria 72722
29 Ga0065714_10067323 3300005288 Bacteria 5655
30 Ga0065714_10073029 3300005288 Bacteria 3256
31 Ga0065704_10000193 3300005289 Bacteria 203271
32 Ga0065704_10079841 3300005289 Bacteria 4051
33 Ga0065704_10116621 3300005289 Bacteria 1850
34 Ga0070658_10061151 3300005327 Bacteria 3068
35 Ga0070658_10194722 3300005327 Bacteria 1709
36 Ga0070658_10222987 3300005327 Bacteria 1595
37 Ga0070683_100004016 3300005329 Bacteria 12045
38 Ga0070680_100046359 3300005336 Bacteria 3536
39 Ga0070682_100001276 3300005337 Bacteria 14283
40 Ga0070660_100063853 3300005339 Bacteria 2863
41 Ga0070668_100049616 3300005347 Bacteria 3229
42 Ga0070668_100131167 3300005347 Bacteria 2012
43 Ga0070669_100110056 3300005353 Bacteria 2089
44 Ga0070673_100818798 3300005364 Unclassified 860
45 Ga0070713_100030371 3300005436 Bacteria 4291
46 Ga0070663_100019282 3300005455 Bacteria 4492
47 Ga0070663_100264426 3300005455 Bacteria 1365
48 Ga0070681_10038297 3300005458 Bacteria 4808
49 Ga0070684_100004401 3300005535 Bacteria 10717
50 Ga0068854_100247371 3300005578 Unclassified 1422
51 Ga0068856_100004615 3300005614 Bacteria 13688
52 Ga0068856_100007721 3300005614 Bacteria 10502
53 Ga0068856_100044610 3300005614 Bacteria 4364
54 Ga0068856_100045503 3300005614 Bacteria 4322
55 Ga0068852_100223866 3300005616 Unclassified 1790
56 Ga0068859_100025296 3300005617 Bacteria 5955
57 Ga0068862_100010249 3300005844 Bacteria 7733
58 Ga0070717_10272589 3300006028 Bacteria 1499
59 Ga0075428_100035633 3300006844 Bacteria 5485
60 Ga0097620_100025296 3300006931 Bacteria 5955
61 Ga0105244_10000160 3300009036 Bacteria 69914
62 Ga0105250_10041406 3300009092 Bacteria 1847
63 Ga0105240_10000221 3300009093 Bacteria 114656
64 Ga0105240_10080239 3300009093 Bacteria 4013
65 Ga0105240_10376296 3300009093 Bacteria 1604
66 Ga0111539_10029175 3300009094 Bacteria 6725
67 Ga0111539_10242343 3300009094 Bacteria 2099
68 Ga0105243_10000734 3300009148 Bacteria 31383
69 Ga0105243_10106215 3300009148 Bacteria 2340
70 Ga0105241_10007010 3300009174 Bacteria 8291
71 Ga0105237_10000227 3300009545 Bacteria 79785
72 Ga0105237_10002671 3300009545 Bacteria 21891
73 Ga0105238_10082106 3300009551 Unclassified 3213
74 Ga0105249_11473712 3300009553 Bacteria 753
75 Ga0105239_10002046 3300010375 Bacteria 26161
76 Ga0105239_10004316 3300010375 Bacteria 17046
77 Ga0157373_10000006 3300013100 Bacteria 261768
78 Ga0157373_10000136 3300013100 Bacteria 57912
79 Ga0157373_10610257 3300013100 Bacteria 795
80 Ga0157371_10001805 3300013102 Bacteria 21630
81 Ga0157371_10010674 3300013102 Bacteria 7133
82 Ga0157371_10078651 3300013102 Bacteria 2336
83 Ga0157371_10100353 3300013102 Bacteria 2053
84 Ga0157370_10002846 3300013104 Bacteria 20668
85 Ga0157370_10009886 3300013104 Bacteria 10110
86 Ga0157370_10012813 3300013104 Bacteria 8668
87 Ga0157370_10033056 3300013104 Bacteria 5045
88 Ga0157370_10050905 3300013104 Bacteria 3957
89 Ga0157370_10085812 3300013104 Bacteria 2958
90 Ga0157370_10093408 3300013104 Bacteria 2823
91 Ga0157370_10119303 3300013104 Bacteria 2463
92 Ga0157370_10607933 3300013104 Bacteria 1001
93 Ga0157369_10000224 3300013105 Bacteria 78178
94 Ga0157369_10002231 3300013105 Bacteria 23333
95 Ga0157369_10036682 3300013105 Bacteria 5370
96 Ga0163162_10000285 3300013306 Bacteria 46149
97 Ga0163162_10602532 3300013306 Bacteria 1225
98 Ga0157372_10000037 3300013307 Bacteria 172444
99 Ga0157372_10000410 3300013307 Bacteria 47006
100 Ga0157372_10132576 3300013307 Bacteria 2868
101 Ga0157372_10219941 3300013307 Bacteria 2201
102 Ga0157375_10000209 3300013308 Bacteria 54570
103 Ga0163163_10846402 3300014325 Unclassified 978
104 Ga0157380_10007778 3300014326 Bacteria 7628
105 Ga0182008_10000003 3300014497 Bacteria 456880
106 Ga0182008_10000018 3300014497 Bacteria 230609
107 Ga0182006_1000001 3300015261 Bacteria 1091090
108 Ga0182006_1009979 3300015261 Bacteria 4242
109 Ga0163161_10008390 3300017792 Bacteria 7151
110 Ga0207427_100043 3300025231 Bacteria 249595
111 Ga0209437_100170 3300025233 Bacteria 142489
112 Ga0209437_100299 3300025233 Bacteria 69659
113 Ga0209026_1005989 3300025250 Bacteria 3106
114 Ga0209233_1000349 3300025261 Bacteria 43702
115 Ga0209455_1004533 3300025272 Bacteria 4514
116 Ga0209455_1006724 3300025272 Bacteria 3356
117 Ga0209675_1003045 3300025291 Bacteria 8225
118 Ga0209676_1000495 3300025292 Bacteria 63184
119 Ga0207696_1025593 3300025711 Bacteria 1837
120 Ga0207655_1000016 3300025728 Bacteria 551476
121 Ga0207705_10142773 3300025909 Bacteria 1789
122 Ga0207705_10167965 3300025909 Bacteria 1651
123 Ga0207707_10016063 3300025912 Bacteria 6529
124 Ga0207695_10000189 3300025913 Bacteria 177142
125 Ga0207695_10259556 3300025913 Bacteria 1635
126 Ga0207671_10000515 3300025914 Bacteria 52421
127 Ga0207671_10002083 3300025914 Bacteria 21886
128 Ga0207660_10033747 3300025917 Bacteria 3543
129 Ga0207652_10007595 3300025921 Bacteria 8730
130 Ga0207700_10008148 3300025928 Bacteria 6471
131 Ga0207709_10000355 3300025935 Bacteria 46675
132 Ga0207709_10174324 3300025935 Bacteria 1512
133 Ga0207661_10053096 3300025944 Bacteria 3241
134 Ga0207667_10492967 3300025949 Bacteria 1243
135 Ga0207712_10038133 3300025961 Bacteria 3284
136 Ga0207668_10095824 3300025972 Bacteria 2191
137 Ga0207668_10096611 3300025972 Bacteria 2184
138 Ga0207678_10047465 3300026067 Bacteria 3714
139 Ga0207678_10432893 3300026067 Bacteria 1142
140 Ga0207702_10057375 3300026078 Bacteria 3309
141 Ga0207698_10191560 3300026142 Unclassified 1822
142 Ga0268265_10011287 3300028380 Bacteria 6039
143 Ga0307515_10037470 3300028794 Bacteria 7798
144 Ga0265338_10082101 3300028800 Bacteria 2700
145 Ga0265324_10111918 3300029957 Bacteria 927
146 Ga0265327_10001894 3300031251 Bacteria 24216
147 Ga0265327_10019753 3300031251 Bacteria 4130
148 Ga0307509_10143410 3300031507 Unclassified 2319
149 Ga0316576_10181659 3300031727 Bacteria 1587
150 Ga0307516_10251447 3300031730 Bacteria 1462
151 Ga0307412_10000036 3300031911 Bacteria 192270
152 Ga0307412_10000077 3300031911 Bacteria 96375
153 Ga0307412_10009055 3300031911 Bacteria 5704
154 Ga0307412_10197665 3300031911 Bacteria 1525
155 Ga0307416_100000006 3300032002 Bacteria 466074
156 Ga0307416_100364409 3300032002 Bacteria 1469
157 Ga0307414_10000043 3300032004 Bacteria 137764
158 Ga0307414_10009225 3300032004 Bacteria 5654
159 Ga0307414_10037854 3300032004 Bacteria 3234
160 Ga0307414_10098717 3300032004 Bacteria 2192
161 Ga0307414_10124647 3300032004 Bacteria 1988
162 Ga0307414_10160365 3300032004 Bacteria 1785
163 Ga0307414_10797517 3300032004 Bacteria 861
164 Ga0316585_10036182 3300032137 Bacteria 1565
165 Ga0316574_0368167 3300035398 Bacteria 908
166 Ga0316584_0021498 3300036712 Bacteria 4690
167 Ga0316584_0187221 3300036712 Bacteria 1531
168 Ga0316584_0306038 3300036712 Unclassified 1150
169 Ga0395899_0000180 3300037312 Bacteria 92701
170 Ga0395899_0052222 3300037312 Bacteria 3031
171 Ga0395900_0000122 3300037418 Bacteria 133423
172 Ga0395900_0008411 3300037418 Bacteria 10619
173 Ga0395900_0721173 3300037418 Bacteria 929
174 Ga0395898_0059552 3300037466 Bacteria 3714
175 Ga0395905_0001611 3300037471 Bacteria 26826
176 Ga0395905_0021935 3300037471 Bacteria 6040
177 Ga0395901_0001566 3300038443 Bacteria 23712
178 Ga0395901_0134334 3300038443 Bacteria 2600
179 Ga0439466_0013706 3300041411 Bacteria 2964
180 Ga0451797_0615602 3300041453 Bacteria 1041
181 Ga0439445_0003202 3300042004 Bacteria 3670
182 Ga0439445_0059475 3300042004 Bacteria 1043
183 Ga0466982_0155050 3300044672 Bacteria 1399
184 Ga0453683_0011789 3300044673 Bacteria 5756
185 Ga0466966_0019426 3300044684 Bacteria 4469
186 Ga0466961_0000001 3300044693 Bacteria 290322
187 Ga0466961_0083334 3300044693 Bacteria 2022
188 Ga0453684_0003191 3300044712 Bacteria 37570
189 Ga0453684_0017716 3300044712 Bacteria 11003
190 Ga0453684_0256283 3300044712 Unclassified 2006
191 Ga0453684_0351065 3300044712 Unclassified 1663
192 Ga0466959_0063611 3300045049 Bacteria 2679
193 Ga0451576_0009056 3300045051 Bacteria 11591
194 Ga0451576_0053481 3300045051 Bacteria 4230
195 Ga0451576_0178596 3300045051 Bacteria 2216
196 Ga0495627_000081 3300046453 Bacteria 116262
197 Ga0495596_0002543 3300046500 Bacteria 9747
198 Ga0495606_0003773 3300046507 Bacteria 15747
199 Ga0495606_0050953 3300046507 Bacteria 2703
200 Ga0495606_0115180 3300046507 Bacteria 1616
201 Ga0495606_0337708 3300046507 Bacteria 804
202 Ga0495610_0000005 3300046512 Bacteria 924111
203 Ga0495610_0040907 3300046512 Bacteria 2331
204 Ga0495631_0075174 3300046518 Bacteria 1458
205 Ga0495632_0002129 3300046519 Bacteria 15416
206 Ga0495643_0004112 3300046522 Bacteria 10346
207 Ga0495644_0019481 3300046523 Bacteria 2591
208 Ga0495663_0000680 3300046525 Bacteria 11726
209 Ga0495663_0005383 3300046525 Bacteria 3552
210 Ga0495654_0000003 3300046530 Bacteria 863485
211 Ga0495609_0000311 3300046538 Bacteria 43792
212 Ga0495633_0000114 3300046558 Bacteria 108708
213 Ga0495633_0031288 3300046558 Bacteria 2582
214 Ga0495625_0002476 3300046660 Bacteria 19910
215 Ga0495661_0002083 3300046665 Bacteria 15695
216 Ga0495661_0191485 3300046665 Bacteria 1077
217 Ga0495677_0018237 3300047445 Bacteria 2544
218 Ga0495686_0000133 3300047472 Bacteria 151597
219 Ga0495686_0062493 3300047472 Bacteria 2310
220 Ga0496102_0106409 3300048905 Bacteria 2610
221 Ga0496116_0000029 3300048919 Bacteria 422187
222 Ga0496117_0000007 3300048920 Bacteria 720505
223 Ga0496118_0015187 3300048921 Bacteria 7150
224 Ga0496119_0000007 3300048922 Bacteria 475920
225 Ga0496121_0174253 3300048924 Bacteria 1559
226 Ga0496122_0000946 3300048925 Bacteria 52631
227 Ga0496122_0001893 3300048925 Bacteria 31687
228 Ga0496122_0001900 3300048925 Bacteria 31591
229 Ga0496122_0001976 3300048925 Bacteria 30631
230 Ga0496122_0002061 3300048925 Bacteria 29808
231 Ga0496123_0001726 3300048926 Bacteria 29009
232 Ga0496123_0039399 3300048926 Bacteria 3306
233 Ga0496124_0001116 3300048927 Bacteria 42242
234 Ga0496124_0120543 3300048927 Bacteria 2096
235 Ga0496125_0001777 3300048928 Bacteria 29790
236 Ga0496125_0017671 3300048928 Bacteria 6790
237 Ga0496125_0038759 3300048928 Bacteria 4116
238 Ga0496126_0004748 3300048929 Bacteria 16022
239 Ga0501305_008734 3300049161 Bacteria 1317
240 Ga0501300_009399 3300049523 Bacteria 1426
241 Ga0501315_003985 3300049531 Bacteria 1514
242 Ga0501315_007848 3300049531 Bacteria 1226
243 Ga0501034_0154333 3300049571 Bacteria 2270
244 Ga0501202_022956 3300049652 Bacteria 1256
245 Ga0501209_019465 3300049656 Bacteria 1585
246 Ga0501217_030659 3300049661 Bacteria 1321
247 Ga0501222_004839 3300049662 Bacteria 1830
248 Ga0501223_000517 3300049663 Bacteria 9302
249 Ga0501235_015576 3300049669 Bacteria 1677
250 Ga0501239_007681 3300049672 Bacteria 1135
251 Ga0501242_016748 3300049674 Bacteria 920
252 Ga0501247_018774 3300049677 Bacteria 885
253 Ga0501257_001930 3300049686 Bacteria 4317
254 Ga0501225_0024089 3300049705 Bacteria 1676
255 Ga0501241_005117 3300049758 Bacteria 2449
256 nmdc:mga0k408_309871_c1 3300050493 Unclassified 942
257 nmdc:mga0qj67_43513_c1 3300050509 Bacteria 3536
258 Ga0500647_0042598 3300053091 Bacteria 2180
259 Ga0500651_0000218 3300053093 Bacteria 35905
260 Ga0500618_005975 3300053125 Bacteria 3630
261 Ga0500568_0039819 3300053139 Bacteria 1895
262 Ga0500604_0002020 3300053151 Bacteria 5607
263 Ga0500622_0000003 3300053156 Bacteria 613483
264 Ga0500622_0000062 3300053156 Bacteria 130392
265 Ga0500645_097602 3300053730 Bacteria 830
266 Ga0587062_007733 3300059639 Bacteria 1263
267 Ga0466962_0284155 3300061719 Bacteria 817
268 2511231034 2511231000 Bacteria 4488346
269 2522551480 2522125168 Bacteria 7376607
270 2524005402 2523533629 Bacteria 2982326
271 2585143661 2582581278 Bacteria 5296881
272 2585156498 2582581281 Bacteria 4487904
273 2585160851 2582581282 Bacteria 4495830
274 2587680049 2585428045 Bacteria 5203023
275 2587748705 2585428060 Bacteria 5304711
276 2587945382 2585428115 Bacteria 4420269
277 2588211564 2585428182 Bacteria 5007281
278 2588215948 2585428183 Bacteria 5166119
279 2588219370 2585428184 Bacteria 4978681
280 2588224852 2585428185 Bacteria 4969476
281 2588234684 2585428187 Bacteria 4629388
282 2588447639 2588253712 Bacteria 5403181
283 2590603269 2588254255 Bacteria 5014294
284 2590610282 2588254257 Bacteria 5436094
285 2729200688 2728369107 Bacteria 5082720
286 2738761015 2738541284 Bacteria 5199923
287 2740031268 2739367866 Bacteria 4215900
288 2740060502 2739367874 Bacteria 4872888
289 2753674272 2751185877 Bacteria 4921427
290 2765575760 2765235839 Bacteria 5314748
291 2772606101 2772190705 Bacteria 4666226
292 2776613201 2775506987 Bacteria 5373360
293 2816875599 2816332188 Bacteria 5133218
294 2842086328 2842083920 Bacteria 4857652
295 2857628564 2857627736 Bacteria 5625397
296 2871723680 2871720351 Bacteria 4862476
297 2889293744 2889290771 Bacteria 5530962
298 2906001109 2905999023 Bacteria 4591259
299 2910246750 2910245624 Bacteria 6935613
300 2911141166 2911138879 Bacteria 5811561
301 2919403121 2919399522 Bacteria 5164947
302 2919687098 2919683626 Bacteria 5534354
303 2945924729 2945924605 Bacteria 4296724
304 2946024155 2946019816 Bacteria 4621265
305 2977247681 2977243572 Bacteria 4374394
306 2984574516 2984572630 Bacteria 4186940
307 2984607967 2984606641 Bacteria 4186971
308 2993375023 2993372514 Bacteria 4214139
309 2993481887 2993480792 Bacteria 4022225
310 8036738239 8036736890 Bacteria 2944828
311 Ga0466959_0000001
312 SwRhRL2b_contig_1043338
313 SwRhRL2b_contig_1218049
314 SwRhRL2b_contig_493616
315 JGI24741J21665_1002211
316 JGI24741J21665_1017277
317 JGI25162J39368_1000173
318 JGI25162J39368_1000929
319 JGI25164J39214_1001715
320 JGI25165J46597_1002022
321 rootH1_10008383
322 rootH2_10016497
323 rootH2_10039028
324 rootH2_10078616
325 rootL2_10039178
326 rootL2_10282992
327 rootH1_10018051
328 rootH1_10032442
329 rootH1_10037343
330 rootH1_10067883
331 rootH1_10067884
332 rootH1_10143935
333 Ga0055534_1026535
334 Ga0058863_10147782
335 Ga0058862_10014128
336 Ga0065165_1001338
337 Ga0065714_10064455
338 Ga0065714_10067323
339 Ga0065714_10073029
340 Ga0065704_10000193
341 Ga0065704_10079841
342 Ga0065704_10116621
343 Ga0070658_10061151
344 Ga0070658_10194722
345 Ga0070658_10222987
346 Ga0070683_100004016
347 Ga0070680_100046359
348 Ga0070682_100001276
349 Ga0070660_100063853
350 Ga0070668_100049616
351 Ga0070668_100131167
352 Ga0070669_100110056
353 Ga0070673_100818798
354 Ga0070713_100030371
355 Ga0070663_100019282
356 Ga0070663_100264426
357 Ga0070681_10038297
358 Ga0070684_100004401
359 Ga0068854_100247371
360 Ga0068856_100004615
361 Ga0068856_100007721
362 Ga0068856_100044610
363 Ga0068856_100045503
364 Ga0068852_100223866
365 Ga0068859_100025296
366 Ga0068862_100010249
367 Ga0070717_10272589
368 Ga0075428_100035633
369 Ga0097620_100025296
370 Ga0105244_10000160
371 Ga0105250_10041406
372 Ga0105240_10000221
373 Ga0105240_10080239
374 Ga0105240_10376296
375 Ga0111539_10029175
376 Ga0111539_10242343
377 Ga0105243_10000734
378 Ga0105243_10106215
379 Ga0105241_10007010
380 Ga0105237_10000227
381 Ga0105237_10002671
382 Ga0105238_10082106
383 Ga0105249_11473712
384 Ga0105239_10002046
385 Ga0105239_10004316
386 Ga0157373_10000006
387 Ga0157373_10000136
388 Ga0157373_10610257
389 Ga0157371_10001805
390 Ga0157371_10010674
391 Ga0157371_10078651
392 Ga0157371_10100353
393 Ga0157370_10002846
394 Ga0157370_10009886
395 Ga0157370_10012813
396 Ga0157370_10033056
397 Ga0157370_10050905
398 Ga0157370_10085812
399 Ga0157370_10093408
400 Ga0157370_10119303
401 Ga0157370_10607933
402 Ga0157369_10000224
403 Ga0157369_10002231
404 Ga0157369_10036682
405 Ga0163162_10000285
406 Ga0163162_10602532
407 Ga0157372_10000037
408 Ga0157372_10000410
409 Ga0157372_10132576
410 Ga0157372_10219941
411 Ga0157375_10000209
412 Ga0163163_10846402
413 Ga0157380_10007778
414 Ga0182008_10000003
415 Ga0182008_10000018
416 Ga0182006_1000001
417 Ga0182006_1009979
418 Ga0163161_10008390
419 Ga0207427_100043
420 Ga0209437_100170
421 Ga0209437_100299
422 Ga0209026_1005989
423 Ga0209233_1000349
424 Ga0209455_1004533
425 Ga0209455_1006724
426 Ga0209675_1003045
427 Ga0209676_1000495
428 Ga0207696_1025593
429 Ga0207655_1000016
430 Ga0207705_10142773
431 Ga0207705_10167965
432 Ga0207707_10016063
433 Ga0207695_10000189
434 Ga0207695_10259556
435 Ga0207671_10000515
436 Ga0207671_10002083
437 Ga0207660_10033747
438 Ga0207652_10007595
439 Ga0207700_10008148
440 Ga0207709_10000355
441 Ga0207709_10174324
442 Ga0207661_10053096
443 Ga0207667_10492967
444 Ga0207712_10038133
445 Ga0207668_10095824
446 Ga0207668_10096611
447 Ga0207678_10047465
448 Ga0207678_10432893
449 Ga0207702_10057375
450 Ga0207698_10191560
451 Ga0268265_10011287
452 Ga0307515_10037470
453 Ga0265338_10082101
454 Ga0265324_10111918
455 Ga0265327_10001894
456 Ga0265327_10019753
457 Ga0307509_10143410
458 Ga0316576_10181659
459 Ga0307516_10251447
460 Ga0307412_10000036
461 Ga0307412_10000077
462 Ga0307412_10009055
463 Ga0307412_10197665
464 Ga0307416_100000006
465 Ga0307416_100364409
466 Ga0307414_10000043
467 Ga0307414_10009225
468 Ga0307414_10037854
469 Ga0307414_10098717
470 Ga0307414_10124647
471 Ga0307414_10160365
472 Ga0307414_10797517
473 Ga0316585_10036182
474 Ga0316574_0368167
475 Ga0316584_0021498
476 Ga0316584_0187221
477 Ga0316584_0306038
478 Ga0395899_0000180
479 Ga0395899_0052222
480 Ga0395900_0000122
481 Ga0395900_0008411
482 Ga0395900_0721173
483 Ga0395898_0059552
484 Ga0395905_0001611
485 Ga0395905_0021935
486 Ga0395901_0001566
487 Ga0395901_0134334
488 Ga0439466_0013706
489 Ga0451797_0615602
490 Ga0439445_0003202
491 Ga0439445_0059475
492 Ga0466982_0155050
493 Ga0453683_0011789
494 Ga0466966_0019426
495 Ga0466961_0000001
496 Ga0466961_0083334
497 Ga0453684_0003191
498 Ga0453684_0017716
499 Ga0453684_0256283
500 Ga0453684_0351065
501 Ga0466959_0063611
502 Ga0451576_0009056
503 Ga0451576_0053481
504 Ga0451576_0178596
505 Ga0495627_000081
506 Ga0495596_0002543
507 Ga0495606_0003773
508 Ga0495606_0050953
509 Ga0495606_0115180
510 Ga0495606_0337708
511 Ga0495610_0000005
512 Ga0495610_0040907
513 Ga0495631_0075174
514 Ga0495632_0002129
515 Ga0495643_0004112
516 Ga0495644_0019481
517 Ga0495663_0000680
518 Ga0495663_0005383
519 Ga0495654_0000003
520 Ga0495609_0000311
521 Ga0495633_0000114
522 Ga0495633_0031288
523 Ga0495625_0002476
524 Ga0495661_0002083
525 Ga0495661_0191485
526 Ga0495677_0018237
527 Ga0495686_0000133
528 Ga0495686_0062493
529 Ga0496102_0106409
530 Ga0496116_0000029
531 Ga0496117_0000007
532 Ga0496118_0015187
533 Ga0496119_0000007
534 Ga0496121_0174253
535 Ga0496122_0000946
536 Ga0496122_0001893
537 Ga0496122_0001900
538 Ga0496122_0001976
539 Ga0496122_0002061
540 Ga0496123_0001726
541 Ga0496123_0039399
542 Ga0496124_0001116
543 Ga0496124_0120543
544 Ga0496125_0001777
545 Ga0496125_0017671
546 Ga0496125_0038759
547 Ga0496126_0004748
548 Ga0501305_008734
549 Ga0501300_009399
550 Ga0501315_003985
551 Ga0501315_007848
552 Ga0501034_0154333
553 Ga0501202_022956
554 Ga0501209_019465
555 Ga0501217_030659
556 Ga0501222_004839
557 Ga0501223_000517
558 Ga0501235_015576
559 Ga0501239_007681
560 Ga0501242_016748
561 Ga0501247_018774
562 Ga0501257_001930
563 Ga0501225_0024089
564 Ga0501241_005117
565 nmdc:mga0k408_309871_c1
566 nmdc:mga0qj67_43513_c1
567 Ga0500647_0042598
568 Ga0500651_0000218
569 Ga0500618_005975
570 Ga0500568_0039819
571 Ga0500604_0002020
572 Ga0500622_0000003
573 Ga0500622_0000062
574 Ga0500645_097602
575 Ga0587062_007733
576 Ga0466962_0284155
577 2511231034
578 2522551480
579 2524005402
580 2585143661
581 2585156498
582 2585160851
583 2587680049
584 2587748705
585 2587945382
586 2588211564
587 2588215948
588 2588219370
589 2588224852
590 2588234684
591 2588447639
592 2590603269
593 2590610282
594 2729200688
595 2738761015
596 2740031268
597 2740060502
598 2753674272
599 2765575760
600 2772606101
601 2776613201
602 2816875599
603 2842086328
604 2857628564
605 2871723680
606 2889293744
607 2906001109
608 2910246750
609 2911141166
610 2919403121
611 2919687098
612 2945924729
613 2946024155
614 2977247681
615 2984574516
616 2984607967
617 2993375023
618 2993481887
619 8036738239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

43

222

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z89-assembly1.cif.gz_C-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9496 101 231
6z85-assembly1.cif.gz_A inhibitory human gtp cyclohydrolase i - gfrp complex 0.942 50 231
6z89-assembly1.cif.gz_C-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.942 101 231
6z89-assembly1.cif.gz_B-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9385 46 231
6z88-assembly1.cif.gz_J human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9366 46 231
ID Description Score Start End Superfamily
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9704 100 232 3.30.1130.10
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9583 108 232 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9427 100 232 3.30.1130.10
af_A0A1D6DUT0_342_468_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9258 112 230 3.30.1130.10
af_Q8I5H7_254_381_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9242 101 221 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A0L8VDE2-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) 0.988 37 230 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A3D1E5D5-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9806 30 180 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A382L1Q8-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9803 58 185 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654
AF-A0A4V1ZVP6-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9798 65 232 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A090R0V7-F1-model_v4 deleted 0.9793 113 227

Map