F400446

General Info

Members Datasets Scaffolds Average Seq Length
309 190 268 185

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0016426|Ga0500559_0016426_446_1090
Length 214
Sequence MVANFAEWRPDGATHGTAGEFEPKCAPDKLIAVTAKDELIEYIKADAVFHGDFTLTSGKKATYYVDMRRVSLDHRVAPLIGQVMVDLIADVDDVAAVGGLTMGADPIAAAVLHQGVALGKSYDAFVVRKEPKDHGRGRQVEGPDLAGKRVIVLEDTSTTGGSPLAAIEALLKVGAIIAGVAVVVDRNTGAKERIEAAGYPYFSAIGLSDLGLDA

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221572 Leifsonia sp. Root60 Isolate Unclassified
3 2643221649 Leifsonia sp. Root4 Isolate Unclassified
4 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
5 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
6 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
7 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
8 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
9 2808606372 Agromyces sp. 23-23 Isolate Unclassified
10 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
11 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
12 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
13 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
14 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
15 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
16 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
17 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
18 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
19 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
20 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
21 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
22 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
23 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
24 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
25 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
26 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
27 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
28 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
29 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
30 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
31 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
32 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
33 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
34 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
35 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
36 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
37 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
38 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
39 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
116 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
175 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
176 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
177 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
178 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
179 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
180 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
183 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
185 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
186 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
190 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.73
Metatranscriptomes 0
Isolates 13.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 13.92
Nodule 0
Rhizoplane 3.88
Rhizosphere 65.05
Stem 0
Stem Tuber 0
Unclassified 16.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10115138 3300005288 Bacteria 1420
2 Ga0070658_10000129 3300005327 Bacteria 67266
3 Ga0070683_100270602 3300005329 Bacteria 1616
4 Ga0070690_100188088 3300005330 Bacteria 1430
5 Ga0070670_100347664 3300005331 Bacteria 1302
6 Ga0068868_100264624 3300005338 Bacteria 1451
7 Ga0070668_100255511 3300005347 Bacteria 1456
8 Ga0070671_100156275 3300005355 Bacteria 1926
9 Ga0070659_100013452 3300005366 Bacteria 6092
10 Ga0070713_100669717 3300005436 Bacteria 989
11 Ga0070710_10072227 3300005437 Bacteria 1992
12 Ga0070663_100085007 3300005455 Bacteria 2334
13 Ga0070672_100297212 3300005543 Bacteria 1368
14 Ga0070672_100482996 3300005543 Bacteria 1070
15 Ga0070665_100248900 3300005548 Bacteria 1778
16 Ga0068855_100008064 3300005563 Bacteria 12727
17 Ga0068855_100971904 3300005563 Bacteria 893
18 Ga0068870_10028508 3300005840 Bacteria 2804
19 Ga0068863_100116670 3300005841 Bacteria 2544
20 Ga0068863_100228061 3300005841 Bacteria 1796
21 Ga0075365_10083160 3300006038 Bacteria 2171
22 Ga0075365_10170938 3300006038 Bacteria 1517
23 Ga0075364_10015546 3300006051 Bacteria 4721
24 Ga0075364_10314347 3300006051 Bacteria 1066
25 Ga0075364_10333685 3300006051 Bacteria 1033
26 Ga0075432_10111208 3300006058 Bacteria 1021
27 Ga0075369_10135897 3300006186 Bacteria 1119
28 Ga0075370_10142621 3300006353 Bacteria 1401
29 Ga0075370_10536904 3300006353 Bacteria 707
30 Ga0105244_10080801 3300009036 Bacteria 1609
31 Ga0105240_10781571 3300009093 Bacteria 1036
32 Ga0105247_10373801 3300009101 Bacteria 1009
33 Ga0105243_11479981 3300009148 Bacteria 702
34 Ga0105248_10000905 3300009177 Bacteria 33139
35 Ga0105237_10026877 3300009545 Bacteria 5881
36 Ga0105249_10155654 3300009553 Bacteria 2204
37 Ga0105239_10513645 3300010375 Bacteria 1363
38 Ga0105246_10259965 3300011119 Bacteria 1383
39 Ga0105246_10516185 3300011119 Bacteria 1017
40 Ga0105246_11203410 3300011119 Bacteria 697
41 Ga0157371_10002269 3300013102 Bacteria 18540
42 Ga0157369_10000554 3300013105 Bacteria 49088
43 Ga0157374_10142462 3300013296 Bacteria 2327
44 Ga0163163_10071759 3300014325 Bacteria 3451
45 Ga0163163_10793311 3300014325 Bacteria 1010
46 Ga0163163_12048718 3300014325 Bacteria 632
47 Ga0157380_10021201 3300014326 Bacteria 4870
48 Ga0157380_11349448 3300014326 Bacteria 762
49 Ga0163161_10172902 3300017792 Bacteria 1653
50 Ga0207692_10012145 3300025898 Bacteria 3691
51 Ga0207692_10047678 3300025898 Bacteria 2152
52 Ga0207710_10066990 3300025900 Bacteria 1639
53 Ga0207643_10015926 3300025908 Bacteria 4096
54 Ga0207705_10000001 3300025909 Bacteria 2061880
55 Ga0207671_10018853 3300025914 Bacteria 5287
56 Ga0207657_10098208 3300025919 Bacteria 2434
57 Ga0207650_10448082 3300025925 Bacteria 1074
58 Ga0207659_10450179 3300025926 Bacteria 1084
59 Ga0207644_10109540 3300025931 Bacteria 2087
60 Ga0207690_10194112 3300025932 Bacteria 1538
61 Ga0207709_11042971 3300025935 Bacteria 670
62 Ga0207691_10322805 3300025940 Bacteria 1324
63 Ga0207711_10033098 3300025941 Bacteria 4372
64 Ga0207689_10387573 3300025942 Bacteria 1164
65 Ga0207661_10415771 3300025944 Bacteria 1221
66 Ga0207667_10116337 3300025949 Bacteria 2755
67 Ga0207712_10869665 3300025961 Bacteria 795
68 Ga0207668_10166661 3300025972 Bacteria 1723
69 Ga0207677_10298076 3300026023 Bacteria 1331
70 Ga0207639_10099765 3300026041 Bacteria 2344
71 Ga0207678_10147378 3300026067 Bacteria 2009
72 Ga0207678_10421677 3300026067 Bacteria 1157
73 Ga0207678_10826308 3300026067 Bacteria 818
74 Ga0207641_10200486 3300026088 Bacteria 1839
75 Ga0207674_10141936 3300026116 Bacteria 2361
76 Ga0207674_10380012 3300026116 Bacteria 1365
77 Ga0207675_100041619 3300026118 Bacteria 4290
78 Ga0268266_10598730 3300028379 Bacteria 1059
79 Ga0307515_10049865 3300028794 Bacteria 6283
80 Ga0307515_10220198 3300028794 Bacteria 1718
81 Ga0307515_10366213 3300028794 Bacteria 1080
82 Ga0307513_10093989 3300031456 Bacteria 3045
83 Ga0307513_10337451 3300031456 Bacteria 1259
84 Ga0307513_10527761 3300031456 Bacteria 895
85 Ga0307408_100279106 3300031548 Bacteria 1391
86 Ga0307408_100595090 3300031548 Bacteria 982
87 Ga0307514_10006647 3300031649 Bacteria 10030
88 Ga0307413_10078182 3300031824 Bacteria 2110
89 Ga0307410_10083437 3300031852 Bacteria 2250
90 Ga0307406_10307484 3300031901 Bacteria 1221
91 Ga0307406_10902157 3300031901 Bacteria 752
92 Ga0307407_10205463 3300031903 Bacteria 1323
93 Ga0307407_10567802 3300031903 Bacteria 841
94 Ga0307412_10167956 3300031911 Bacteria 1638
95 Ga0307409_100124929 3300031995 Bacteria 2187
96 Ga0307409_100133786 3300031995 Bacteria 2124
97 Ga0307409_100160300 3300031995 Bacteria 1966
98 Ga0307409_100310221 3300031995 Bacteria 1472
99 Ga0307409_101492528 3300031995 Bacteria 703
100 Ga0307416_100387882 3300032002 Bacteria 1430
101 Ga0307416_100606930 3300032002 Bacteria 1175
102 Ga0307416_100608961 3300032002 Bacteria 1173
103 Ga0307416_100870677 3300032002 Bacteria 1000
104 Ga0307411_10724180 3300032005 Bacteria 869
105 Ga0307415_100218268 3300032126 Bacteria 1527
106 Ga0451793_1469148 3300041452 Bacteria 894
107 Ga0451802_0976675 3300041460 Bacteria 896
108 Ga0451807_1312983 3300041486 Bacteria 1039
109 Ga0451853_0699505 3300041512 Bacteria 1311
110 Ga0466969_0134017 3300044656 Bacteria 1148
111 Ga0466972_0180332 3300044658 Bacteria 990
112 Ga0466965_0000004 3300044683 Bacteria 229348
113 Ga0466970_0005136 3300044765 Bacteria 6471
114 Ga0466970_0033873 3300044765 Bacteria 2701
115 Ga0466970_0511057 3300044765 Bacteria 692
116 Ga0495590_0000115 3300046457 Bacteria 48176
117 Ga0495650_0000897 3300046471 Bacteria 35099
118 Ga0495650_0150120 3300046471 Bacteria 837
119 Ga0495650_0196072 3300046471 Bacteria 704
120 Ga0495631_0167457 3300046518 Bacteria 943
121 Ga0495609_0058424 3300046538 Bacteria 1706
122 Ga0495656_0104822 3300046615 Bacteria 1313
123 Ga0495656_0267551 3300046615 Bacteria 868
124 Ga0496100_0375216 3300048903 Bacteria 1079
125 Ga0496101_0279231 3300048904 Bacteria 1305
126 Ga0496102_0221365 3300048905 Bacteria 1784
127 Ga0496102_1332656 3300048905 Bacteria 637
128 Ga0496104_0229648 3300048907 Bacteria 1768
129 Ga0496105_0295103 3300048908 Bacteria 1304
130 Ga0496113_0086788 3300048916 Bacteria 2405
131 Ga0496115_0012578 3300048918 Bacteria 6376
132 Ga0496115_0356145 3300048918 Bacteria 1193
133 Ga0496116_0245467 3300048919 Bacteria 896
134 Ga0496117_0000174 3300048920 Bacteria 132648
135 Ga0496117_0001641 3300048920 Bacteria 31427
136 Ga0496117_0003930 3300048920 Bacteria 16829
137 Ga0496118_0000201 3300048921 Bacteria 104874
138 Ga0496118_0010431 3300048921 Bacteria 9203
139 Ga0496119_0001959 3300048922 Bacteria 23406
140 Ga0496120_0054956 3300048923 Bacteria 2253
141 Ga0496120_0149153 3300048923 Bacteria 1177
142 Ga0496120_0195626 3300048923 Bacteria 982
143 Ga0496121_0000046 3300048924 Bacteria 335942
144 Ga0496121_0436208 3300048924 Bacteria 848
145 Ga0496122_0000235 3300048925 Bacteria 124769
146 Ga0496122_0004477 3300048925 Bacteria 17284
147 Ga0496122_0015424 3300048925 Bacteria 7305
148 Ga0496122_0105595 3300048925 Bacteria 1867
149 Ga0496123_0000036 3300048926 Bacteria 265722
150 Ga0496123_0003089 3300048926 Bacteria 19123
151 Ga0496123_0168817 3300048926 Bacteria 1157
152 Ga0496124_0000194 3300048927 Bacteria 120672
153 Ga0496124_0002889 3300048927 Bacteria 21677
154 Ga0496125_0005792 3300048928 Bacteria 13574
155 Ga0496126_0001500 3300048929 Bacteria 36136
156 Ga0496126_0032637 3300048929 Bacteria 4903
157 Ga0496126_0093683 3300048929 Bacteria 2637
158 Ga0496126_0379661 3300048929 Bacteria 1151
159 Ga0496126_0741560 3300048929 Bacteria 759
160 Ga0501031_0023283 3300049568 Bacteria 4038
161 Ga0501031_0064361 3300049568 Bacteria 2388
162 Ga0501031_0575551 3300049568 Bacteria 725
163 Ga0501032_0010530 3300049569 Bacteria 6669
164 Ga0501032_0140327 3300049569 Bacteria 1591
165 Ga0501032_0182309 3300049569 Bacteria 1374
166 Ga0501033_0019550 3300049570 Bacteria 5121
167 Ga0501033_0024936 3300049570 Bacteria 4506
168 Ga0501033_0025454 3300049570 Bacteria 4459
169 Ga0501033_0076428 3300049570 Bacteria 2458
170 Ga0501034_0079741 3300049571 Bacteria 3277
171 Ga0501034_0083622 3300049571 Bacteria 3193
172 Ga0501034_0117397 3300049571 Bacteria 2648
173 Ga0501034_0183816 3300049571 Bacteria 2054
174 Ga0501034_0291432 3300049571 Bacteria 1570
175 Ga0501034_0321416 3300049571 Bacteria 1480
176 Ga0501034_0325570 3300049571 Bacteria 1469
177 Ga0501034_0328704 3300049571 Bacteria 1461
178 Ga0501034_0469424 3300049571 Bacteria 1174
179 Ga0501034_0833189 3300049571 Bacteria 813
180 Ga0501036_0024599 3300049572 Bacteria 5078
181 Ga0501037_0024996 3300049573 Bacteria 4414
182 Ga0501037_0104035 3300049573 Bacteria 2047
183 Ga0501037_0357132 3300049573 Bacteria 1007
184 Ga0501038_0018400 3300049574 Bacteria 6306
185 Ga0501038_0047428 3300049574 Bacteria 3721
186 Ga0501038_0068123 3300049574 Bacteria 3026
187 Ga0501039_0155239 3300049575 Bacteria 1798
188 Ga0501040_0055882 3300049576 Bacteria 2708
189 Ga0501042_0000537 3300049578 Bacteria 19861
190 Ga0501043_0015227 3300049579 Bacteria 6022
191 Ga0501043_0016686 3300049579 Bacteria 5754
192 Ga0501046_0036327 3300049580 Bacteria 3965
193 Ga0501047_0024395 3300049581 Bacteria 5805
194 Ga0501047_0047612 3300049581 Bacteria 4141
195 Ga0501047_0050134 3300049581 Bacteria 4031
196 Ga0501047_0473774 3300049581 Bacteria 1080
197 Ga0501048_0035602 3300049582 Bacteria 3583
198 Ga0501067_0189443 3300049583 Bacteria 1146
199 Ga0501067_0264223 3300049583 Bacteria 958
200 Ga0501068_0316149 3300049584 Bacteria 1001
201 Ga0501070_0000367 3300049586 Bacteria 41059
202 Ga0501070_0017767 3300049586 Bacteria 5972
203 Ga0501070_0068378 3300049586 Bacteria 2940
204 Ga0501073_0000046 3300049589 Bacteria 78180
205 Ga0501073_0012557 3300049589 Bacteria 6182
206 Ga0501073_0023672 3300049589 Bacteria 4408
207 Ga0501073_0159750 3300049589 Bacteria 1562
208 Ga0501074_0040793 3300049590 Bacteria 3361
209 Ga0501074_0098419 3300049590 Bacteria 2093
210 Ga0501077_0684159 3300049593 Bacteria 659
211 Ga0501079_0345812 3300049741 Bacteria 1165
212 Ga0501080_0000085 3300049742 Bacteria 62675
213 Ga0501080_0073137 3300049742 Bacteria 3189
214 Ga0501080_0185440 3300049742 Bacteria 1913
215 Ga0501080_0657395 3300049742 Bacteria 927
216 Ga0501083_0000028 3300049744 Bacteria 115481
217 Ga0501083_0003278 3300049744 Bacteria 11305
218 Ga0501083_0132756 3300049744 Bacteria 1632
219 Ga0501035_0024097 3300049822 Bacteria 5583
220 Ga0501035_0177494 3300049822 Bacteria 1836
221 Ga0501035_0178583 3300049822 Bacteria 1830
222 Ga0501035_0356118 3300049822 Bacteria 1224
223 Ga0501035_0401678 3300049822 Bacteria 1140
224 Ga0501035_0643960 3300049822 Bacteria 860
225 Ga0501044_0024460 3300049823 Bacteria 6409
226 Ga0501044_0057159 3300049823 Bacteria 4004
227 Ga0501044_0151665 3300049823 Bacteria 2299
228 Ga0501044_0283740 3300049823 Bacteria 1588
229 Ga0501044_0505695 3300049823 Bacteria 1109
230 Ga0501044_1104298 3300049823 Bacteria 662
231 nmdc:mga00v17_27249_c1 3300050491 Bacteria 3335
232 nmdc:mga00v17_282699_c1 3300050491 Bacteria 1077
233 nmdc:mga00v17_411338_c1 3300050491 Bacteria 879
234 nmdc:mga0yw44_41347_c1 3300050492 Bacteria 2744
235 nmdc:mga0sz30_59374_c1 3300050516 Bacteria 1632
236 Ga0500650_0079348 3300053098 Bacteria 1534
237 Ga0500554_030699 3300053102 Bacteria 1581
238 Ga0500556_0001137 3300053104 Bacteria 13017
239 Ga0500562_000646 3300053108 Bacteria 8425
240 Ga0500593_000381 3300053117 Bacteria 17618
241 Ga0500655_001381 3300053133 Bacteria 4602
242 Ga0500559_0000202 3300053136 Bacteria 47695
243 Ga0500559_0000474 3300053136 Bacteria 28589
244 Ga0500559_0016426 3300053136 Bacteria 3125
245 Ga0500559_0077623 3300053136 Bacteria 1505
246 Ga0500568_0000051 3300053139 Bacteria 112462
247 Ga0500568_0002585 3300053139 Bacteria 10527
248 Ga0500568_0003104 3300053139 Bacteria 9471
249 Ga0500573_0000005 3300053140 Bacteria 315762
250 Ga0500573_0000437 3300053140 Bacteria 17885
251 Ga0500573_0003292 3300053140 Bacteria 8333
252 Ga0500573_0035538 3300053140 Bacteria 2875
253 Ga0500573_0075516 3300053140 Bacteria 1918
254 Ga0500573_0082491 3300053140 Bacteria 1826
255 Ga0500573_0084151 3300053140 Bacteria 1805
256 Ga0500573_0295582 3300053140 Bacteria 812
257 Ga0500573_0438443 3300053140 Bacteria 607
258 Ga0500577_0003399 3300053142 Bacteria 4132
259 Ga0500577_0008772 3300053142 Bacteria 2900
260 Ga0500577_0024618 3300053142 Bacteria 2026
261 Ga0500616_0000010 3300053153 Bacteria 761410
262 Ga0500616_0005840 3300053153 Bacteria 8245
263 Ga0500620_000054 3300053155 Bacteria 21041
264 Ga0500620_095514 3300053155 Bacteria 1038
265 Ga0500645_005986 3300053730 Bacteria 4396
266 Ga0501084_0286592 3300054114 Bacteria 1391
267 Ga0501084_0671449 3300054114 Bacteria 874
268 Ga0501082_0637405 3300060353 Bacteria 932

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_11349448 Ga0157380_113494482 168
2 3300054114 Ga0501084_0286592 Ga0501084_0286592_789_1358 172
3 3300048924 Ga0496121_0000046 Ga0496121_0000046_108227_108787 174
4 iso_pu_bacteria 2585428094 2587861658 175
5 iso_pu_bacteria 2643221649 2644278246 175
6 iso_pu_bacteria 2643221694 2644524838 178
7 iso_pu_bacteria 2643221722 2644668923 178
8 iso_pu_bacteria 2751185788 2753300707 178
9 iso_pu_bacteria 2844852863 2844853507 178
10 iso_pu_bacteria 2852643534 2852644109 178
11 iso_pu_bacteria 2852677369 2852678053 178
12 iso_pu_bacteria 2857729791 2857733095 178
13 iso_pu_bacteria 2857733635 2857734943 178
14 iso_pu_bacteria 2857737099 2857739033 178
15 iso_pu_bacteria 2870622029 2870625455 178
16 iso_pu_bacteria 2895660088 2895662276 178
17 iso_pu_bacteria 2897561785 2897562143 178
18 iso_pu_bacteria 2904430863 2904431375 178
19 iso_pu_bacteria 2904501621 2904502538 178
20 iso_pu_bacteria 2908674828 2908678007 178
21 iso_pu_bacteria 2909074476 2909075877 178
22 iso_pu_bacteria 2919039151 2919041318 178
23 iso_pu_bacteria 2919042368 2919044050 178
24 iso_pu_bacteria 2928104781 2928107076 178
25 iso_pu_bacteria 2928121344 2928121800 178
26 iso_pu_bacteria 2928500415 2928501769 178
27 iso_pu_bacteria 2939657138 2939660562 178
28 iso_pu_bacteria 2939660829 2939661587 178
29 iso_pu_bacteria 2966921586 2966923791 178
30 iso_pu_bacteria 2984551494 2984552784 178
31 iso_pu_bacteria 8056037122 8056040310 178
32 iso_pu_bacteria 8057345674 8057346472 178
33 3300031824 Ga0307413_10078182 Ga0307413_100781822 179
34 3300031852 Ga0307410_10083437 Ga0307410_100834373 179
35 3300031995 Ga0307409_100160300 Ga0307409_1001603001 179
36 3300049571 Ga0501034_0117397 Ga0501034_0117397_836_1402 179
37 iso_pu_bacteria 2887443736 2887447237 179
38 3300044765 Ga0466970_0511057 Ga0466970_0511057_60_611 180
39 iso_pu_bacteria 2643221572 2643876944 180
40 iso_pu_bacteria 2643221669 2644383999 180
41 iso_pu_bacteria 2721755702 2723643748 180
42 iso_pu_bacteria 2919443155 2919444978 180
43 iso_pu_bacteria 2935409751 2935413412 180
44 iso_pu_bacteria 2946024296 2946024505 180
45 3300005288 Ga0065714_10115138 Ga0065714_101151381 181
46 3300005327 Ga0070658_10000129 Ga0070658_1000012917 181
47 3300005329 Ga0070683_100270602 Ga0070683_1002706022 181
48 3300005330 Ga0070690_100188088 Ga0070690_1001880882 181
49 3300005331 Ga0070670_100347664 Ga0070670_1003476642 181
50 3300005338 Ga0068868_100264624 Ga0068868_1002646242 181
51 3300005347 Ga0070668_100255511 Ga0070668_1002555111 181
52 3300005355 Ga0070671_100156275 Ga0070671_1001562752 181
53 3300005366 Ga0070659_100013452 Ga0070659_1000134522 181
54 3300005436 Ga0070713_100669717 Ga0070713_1006697172 181
55 3300005437 Ga0070710_10072227 Ga0070710_100722271 181
56 3300005455 Ga0070663_100085007 Ga0070663_1000850072 181
57 3300005543 Ga0070672_100297212 Ga0070672_1002972122 181
58 3300005543 Ga0070672_100482996 Ga0070672_1004829962 181
59 3300005548 Ga0070665_100248900 Ga0070665_1002489002 181
60 3300005563 Ga0068855_100008064 Ga0068855_1000080645 181
61 3300005563 Ga0068855_100971904 Ga0068855_1009719041 181
62 3300005840 Ga0068870_10028508 Ga0068870_100285082 181
63 3300005841 Ga0068863_100116670 Ga0068863_1001166701 181
64 3300005841 Ga0068863_100228061 Ga0068863_1002280612 181
65 3300006038 Ga0075365_10083160 Ga0075365_100831604 181
66 3300006038 Ga0075365_10170938 Ga0075365_101709381 181
67 3300006051 Ga0075364_10015546 Ga0075364_100155467 181
68 3300006051 Ga0075364_10314347 Ga0075364_103143472 181
69 3300006051 Ga0075364_10333685 Ga0075364_103336852 181
70 3300006058 Ga0075432_10111208 Ga0075432_101112082 181
71 3300006186 Ga0075369_10135897 Ga0075369_101358972 181
72 3300006353 Ga0075370_10142621 Ga0075370_101426212 181
73 3300006353 Ga0075370_10536904 Ga0075370_105369041 181
74 3300009036 Ga0105244_10080801 Ga0105244_100808012 181
75 3300009093 Ga0105240_10781571 Ga0105240_107815712 181
76 3300009101 Ga0105247_10373801 Ga0105247_103738012 181
77 3300009148 Ga0105243_11479981 Ga0105243_114799812 181
78 3300009177 Ga0105248_10000905 Ga0105248_1000090514 181
79 3300009545 Ga0105237_10026877 Ga0105237_100268773 181
80 3300009553 Ga0105249_10155654 Ga0105249_101556543 181
81 3300010375 Ga0105239_10513645 Ga0105239_105136451 181
82 3300011119 Ga0105246_10259965 Ga0105246_102599653 181
83 3300011119 Ga0105246_10516185 Ga0105246_105161852 181
84 3300011119 Ga0105246_11203410 Ga0105246_112034101 181
85 3300013102 Ga0157371_10002269 Ga0157371_1000226910 181
86 3300013105 Ga0157369_10000554 Ga0157369_1000055431 181
87 3300013296 Ga0157374_10142462 Ga0157374_101424624 181
88 3300014325 Ga0163163_10071759 Ga0163163_100717593 181
89 3300014325 Ga0163163_10793311 Ga0163163_107933112 181
90 3300014325 Ga0163163_12048718 Ga0163163_120487181 181
91 3300014326 Ga0157380_10021201 Ga0157380_100212013 181
92 3300017792 Ga0163161_10172902 Ga0163161_101729022 181
93 3300025898 Ga0207692_10012145 Ga0207692_100121453 181
94 3300025898 Ga0207692_10047678 Ga0207692_100476782 181
95 3300025900 Ga0207710_10066990 Ga0207710_100669901 181
96 3300025908 Ga0207643_10015926 Ga0207643_100159262 181
97 3300025909 Ga0207705_10000001 Ga0207705_10000001897 181
98 3300025914 Ga0207671_10018853 Ga0207671_100188533 181
99 3300025919 Ga0207657_10098208 Ga0207657_100982082 181
100 3300025925 Ga0207650_10448082 Ga0207650_104480822 181
101 3300025926 Ga0207659_10450179 Ga0207659_104501791 181
102 3300025931 Ga0207644_10109540 Ga0207644_101095402 181
103 3300025932 Ga0207690_10194112 Ga0207690_101941122 181
104 3300025935 Ga0207709_11042971 Ga0207709_110429711 181
105 3300025940 Ga0207691_10322805 Ga0207691_103228052 181
106 3300025941 Ga0207711_10033098 Ga0207711_100330986 181
107 3300025942 Ga0207689_10387573 Ga0207689_103875732 181
108 3300025944 Ga0207661_10415771 Ga0207661_104157711 181
109 3300025949 Ga0207667_10116337 Ga0207667_101163373 181
110 3300025961 Ga0207712_10869665 Ga0207712_108696652 181
111 3300025972 Ga0207668_10166661 Ga0207668_101666612 181
112 3300026023 Ga0207677_10298076 Ga0207677_102980762 181
113 3300026041 Ga0207639_10099765 Ga0207639_100997653 181
114 3300026067 Ga0207678_10147378 Ga0207678_101473783 181
115 3300026067 Ga0207678_10421677 Ga0207678_104216771 181
116 3300026067 Ga0207678_10826308 Ga0207678_108263082 181
117 3300026088 Ga0207641_10200486 Ga0207641_102004863 181
118 3300026116 Ga0207674_10141936 Ga0207674_101419365 181
119 3300026116 Ga0207674_10380012 Ga0207674_103800121 181
120 3300026118 Ga0207675_100041619 Ga0207675_1000416192 181
121 3300028379 Ga0268266_10598730 Ga0268266_105987302 181
122 3300028794 Ga0307515_10049865 Ga0307515_100498654 181
123 3300028794 Ga0307515_10220198 Ga0307515_102201982 181
124 3300028794 Ga0307515_10366213 Ga0307515_103662132 181
125 3300031456 Ga0307513_10093989 Ga0307513_100939894 181
126 3300031456 Ga0307513_10337451 Ga0307513_103374512 181
127 3300031456 Ga0307513_10527761 Ga0307513_105277611 181
128 3300031548 Ga0307408_100279106 Ga0307408_1002791062 181
129 3300031548 Ga0307408_100595090 Ga0307408_1005950902 181
130 3300031649 Ga0307514_10006647 Ga0307514_100066477 181
131 3300031901 Ga0307406_10307484 Ga0307406_103074842 181
132 3300031901 Ga0307406_10902157 Ga0307406_109021571 181
133 3300031903 Ga0307407_10205463 Ga0307407_102054632 181
134 3300031903 Ga0307407_10567802 Ga0307407_105678021 181
135 3300031911 Ga0307412_10167956 Ga0307412_101679563 181
136 3300031995 Ga0307409_100124929 Ga0307409_1001249292 181
137 3300031995 Ga0307409_100133786 Ga0307409_1001337862 181
138 3300031995 Ga0307409_100310221 Ga0307409_1003102212 181
139 3300031995 Ga0307409_101492528 Ga0307409_1014925281 181
140 3300032002 Ga0307416_100387882 Ga0307416_1003878822 181
141 3300032002 Ga0307416_100606930 Ga0307416_1006069303 181
142 3300032002 Ga0307416_100608961 Ga0307416_1006089612 181
143 3300032002 Ga0307416_100870677 Ga0307416_1008706772 181
144 3300032005 Ga0307411_10724180 Ga0307411_107241802 181
145 3300032126 Ga0307415_100218268 Ga0307415_1002182682 181
146 3300041452 Ga0451793_1469148 Ga0451793_1469148_251_805 181
147 3300041460 Ga0451802_0976675 Ga0451802_0976675_155_703 181
148 3300041486 Ga0451807_1312983 Ga0451807_1312983_375_926 181
149 3300041512 Ga0451853_0699505 Ga0451853_0699505_31_624 181
150 3300044656 Ga0466969_0134017 Ga0466969_0134017_84_635 181
151 3300044658 Ga0466972_0180332 Ga0466972_0180332_288_848 181
152 3300044683 Ga0466965_0000004 Ga0466965_0000004_18939_19493 181
153 3300044765 Ga0466970_0005136 Ga0466970_0005136_1743_2294 181
154 3300044765 Ga0466970_0033873 Ga0466970_0033873_1092_1643 181
155 3300046457 Ga0495590_0000115 Ga0495590_0000115_30828_31382 181
156 3300046471 Ga0495650_0000897 Ga0495650_0000897_18389_18955 181
157 3300046471 Ga0495650_0150120 Ga0495650_0150120_115_666 181
158 3300046471 Ga0495650_0196072 Ga0495650_0196072_13_561 181
159 3300046518 Ga0495631_0167457 Ga0495631_0167457_298_870 181
160 3300046538 Ga0495609_0058424 Ga0495609_0058424_74_625 181
161 3300046615 Ga0495656_0104822 Ga0495656_0104822_650_1204 181
162 3300046615 Ga0495656_0267551 Ga0495656_0267551_88_660 181
163 3300048903 Ga0496100_0375216 Ga0496100_0375216_317_871 181
164 3300048904 Ga0496101_0279231 Ga0496101_0279231_367_918 181
165 3300048905 Ga0496102_0221365 Ga0496102_0221365_297_848 181
166 3300048905 Ga0496102_1332656 Ga0496102_1332656_16_570 181
167 3300048907 Ga0496104_0229648 Ga0496104_0229648_962_1510 181
168 3300048908 Ga0496105_0295103 Ga0496105_0295103_536_1084 181
169 3300048916 Ga0496113_0086788 Ga0496113_0086788_289_861 181
170 3300048918 Ga0496115_0012578 Ga0496115_0012578_2066_2620 181
171 3300048918 Ga0496115_0356145 Ga0496115_0356145_484_1038 181
172 3300048919 Ga0496116_0245467 Ga0496116_0245467_208_756 181
173 3300048920 Ga0496117_0000174 Ga0496117_0000174_35314_35862 181
174 3300048920 Ga0496117_0001641 Ga0496117_0001641_7153_7704 181
175 3300048920 Ga0496117_0003930 Ga0496117_0003930_6883_7458 181
176 3300048921 Ga0496118_0000201 Ga0496118_0000201_17307_17858 181
177 3300048921 Ga0496118_0010431 Ga0496118_0010431_617_1192 181
178 3300048922 Ga0496119_0001959 Ga0496119_0001959_1800_2375 181
179 3300048923 Ga0496120_0054956 Ga0496120_0054956_344_919 181
180 3300048923 Ga0496120_0149153 Ga0496120_0149153_619_1164 181
181 3300048923 Ga0496120_0195626 Ga0496120_0195626_259_810 181
182 3300048924 Ga0496121_0436208 Ga0496121_0436208_225_791 181
183 3300048925 Ga0496122_0000235 Ga0496122_0000235_94861_95436 181
184 3300048925 Ga0496122_0004477 Ga0496122_0004477_101_649 181
185 3300048925 Ga0496122_0015424 Ga0496122_0015424_3529_4077 181
186 3300048925 Ga0496122_0105595 Ga0496122_0105595_267_818 181
187 3300048926 Ga0496123_0000036 Ga0496123_0000036_29338_29913 181
188 3300048926 Ga0496123_0003089 Ga0496123_0003089_2277_2825 181
189 3300048926 Ga0496123_0168817 Ga0496123_0168817_139_687 181
190 3300048927 Ga0496124_0000194 Ga0496124_0000194_31856_32407 181
191 3300048927 Ga0496124_0002889 Ga0496124_0002889_19617_20192 181
192 3300048928 Ga0496125_0005792 Ga0496125_0005792_11609_12184 181
193 3300048929 Ga0496126_0001500 Ga0496126_0001500_35191_35739 181
194 3300048929 Ga0496126_0032637 Ga0496126_0032637_1911_2486 181
195 3300048929 Ga0496126_0093683 Ga0496126_0093683_660_1211 181
196 3300048929 Ga0496126_0379661 Ga0496126_0379661_339_893 181
197 3300048929 Ga0496126_0741560 Ga0496126_0741560_76_627 181
198 3300049568 Ga0501031_0023283 Ga0501031_0023283_2013_2561 181
199 3300049568 Ga0501031_0064361 Ga0501031_0064361_978_1532 181
200 3300049568 Ga0501031_0575551 Ga0501031_0575551_111_671 181
201 3300049569 Ga0501032_0010530 Ga0501032_0010530_900_1448 181
202 3300049569 Ga0501032_0140327 Ga0501032_0140327_46_600 181
203 3300049569 Ga0501032_0182309 Ga0501032_0182309_165_719 181
204 3300049570 Ga0501033_0019550 Ga0501033_0019550_1924_2472 181
205 3300049570 Ga0501033_0024936 Ga0501033_0024936_3940_4488 181
206 3300049570 Ga0501033_0025454 Ga0501033_0025454_555_1127 181
207 3300049570 Ga0501033_0076428 Ga0501033_0076428_1432_1986 181
208 3300049571 Ga0501034_0079741 Ga0501034_0079741_2293_2844 181
209 3300049571 Ga0501034_0083622 Ga0501034_0083622_1930_2484 181
210 3300049571 Ga0501034_0183816 Ga0501034_0183816_906_1454 181
211 3300049571 Ga0501034_0291432 Ga0501034_0291432_61_615 181
212 3300049571 Ga0501034_0321416 Ga0501034_0321416_821_1375 181
213 3300049571 Ga0501034_0325570 Ga0501034_0325570_732_1310 181
214 3300049571 Ga0501034_0328704 Ga0501034_0328704_625_1179 181
215 3300049571 Ga0501034_0469424 Ga0501034_0469424_88_642 181
216 3300049571 Ga0501034_0833189 Ga0501034_0833189_163_717 181
217 3300049572 Ga0501036_0024599 Ga0501036_0024599_3056_3604 181
218 3300049573 Ga0501037_0024996 Ga0501037_0024996_748_1302 181
219 3300049573 Ga0501037_0104035 Ga0501037_0104035_907_1455 181
220 3300049573 Ga0501037_0357132 Ga0501037_0357132_112_666 181
221 3300049574 Ga0501038_0018400 Ga0501038_0018400_2900_3454 181
222 3300049574 Ga0501038_0047428 Ga0501038_0047428_1664_2218 181
223 3300049574 Ga0501038_0068123 Ga0501038_0068123_1533_2081 181
224 3300049575 Ga0501039_0155239 Ga0501039_0155239_1094_1648 181
225 3300049576 Ga0501040_0055882 Ga0501040_0055882_1290_1874 181
226 3300049578 Ga0501042_0000537 Ga0501042_0000537_15451_15999 181
227 3300049579 Ga0501043_0015227 Ga0501043_0015227_2292_2840 181
228 3300049579 Ga0501043_0016686 Ga0501043_0016686_4909_5463 181
229 3300049580 Ga0501046_0036327 Ga0501046_0036327_2511_3059 181
230 3300049581 Ga0501047_0024395 Ga0501047_0024395_4980_5534 181
231 3300049581 Ga0501047_0047612 Ga0501047_0047612_2548_3096 181
232 3300049581 Ga0501047_0050134 Ga0501047_0050134_3024_3578 181
233 3300049581 Ga0501047_0473774 Ga0501047_0473774_186_758 181
234 3300049582 Ga0501048_0035602 Ga0501048_0035602_741_1289 181
235 3300049583 Ga0501067_0189443 Ga0501067_0189443_360_914 181
236 3300049583 Ga0501067_0264223 Ga0501067_0264223_82_636 181
237 3300049584 Ga0501068_0316149 Ga0501068_0316149_277_831 181
238 3300049586 Ga0501070_0000367 Ga0501070_0000367_1420_1974 181
239 3300049586 Ga0501070_0017767 Ga0501070_0017767_4674_5228 181
240 3300049586 Ga0501070_0068378 Ga0501070_0068378_2075_2623 181
241 3300049589 Ga0501073_0000046 Ga0501073_0000046_12023_12577 181
242 3300049589 Ga0501073_0012557 Ga0501073_0012557_1217_1765 181
243 3300049589 Ga0501073_0023672 Ga0501073_0023672_1966_2520 181
244 3300049589 Ga0501073_0159750 Ga0501073_0159750_540_1094 181
245 3300049590 Ga0501074_0040793 Ga0501074_0040793_1817_2371 181
246 3300049590 Ga0501074_0098419 Ga0501074_0098419_1246_1794 181
247 3300049593 Ga0501077_0684159 Ga0501077_0684159_47_601 181
248 3300049741 Ga0501079_0345812 Ga0501079_0345812_55_603 181
249 3300049742 Ga0501080_0000085 Ga0501080_0000085_47342_47896 181
250 3300049742 Ga0501080_0073137 Ga0501080_0073137_1771_2325 181
251 3300049742 Ga0501080_0185440 Ga0501080_0185440_559_1107 181
252 3300049742 Ga0501080_0657395 Ga0501080_0657395_39_593 181
253 3300049744 Ga0501083_0000028 Ga0501083_0000028_10736_11284 181
254 3300049744 Ga0501083_0003278 Ga0501083_0003278_6768_7322 181
255 3300049744 Ga0501083_0132756 Ga0501083_0132756_280_852 181
256 3300049822 Ga0501035_0024097 Ga0501035_0024097_3934_4482 181
257 3300049822 Ga0501035_0177494 Ga0501035_0177494_680_1228 181
258 3300049822 Ga0501035_0178583 Ga0501035_0178583_1118_1666 181
259 3300049822 Ga0501035_0356118 Ga0501035_0356118_462_1010 181
260 3300049822 Ga0501035_0401678 Ga0501035_0401678_555_1127 181
261 3300049822 Ga0501035_0643960 Ga0501035_0643960_77_631 181
262 3300049823 Ga0501044_0024460 Ga0501044_0024460_4918_5466 181
263 3300049823 Ga0501044_0057159 Ga0501044_0057159_459_1013 181
264 3300049823 Ga0501044_0151665 Ga0501044_0151665_1348_1896 181
265 3300049823 Ga0501044_0283740 Ga0501044_0283740_134_682 181
266 3300049823 Ga0501044_0505695 Ga0501044_0505695_181_753 181
267 3300049823 Ga0501044_1104298 Ga0501044_1104298_80_628 181
268 3300050491 nmdc:mga00v17_27249_c1 nmdc:mga00v17_27249_c1_137_691 181
269 3300050491 nmdc:mga00v17_282699_c1 nmdc:mga00v17_282699_c1_106_654 181
270 3300050491 nmdc:mga00v17_411338_c1 nmdc:mga00v17_411338_c1_170_721 181
271 3300050492 nmdc:mga0yw44_41347_c1 nmdc:mga0yw44_41347_c1_63_617 181
272 3300050516 nmdc:mga0sz30_59374_c1 nmdc:mga0sz30_59374_c1_78_632 181
273 3300053098 Ga0500650_0079348 Ga0500650_0079348_214_762 181
274 3300053102 Ga0500554_030699 Ga0500554_030699_686_1270 181
275 3300053104 Ga0500556_0001137 Ga0500556_0001137_6613_7167 181
276 3300053108 Ga0500562_000646 Ga0500562_000646_1612_2166 181
277 3300053117 Ga0500593_000381 Ga0500593_000381_12987_13541 181
278 3300053133 Ga0500655_001381 Ga0500655_001381_3237_3791 181
279 3300053136 Ga0500559_0000202 Ga0500559_0000202_46314_46862 181
280 3300053136 Ga0500559_0000474 Ga0500559_0000474_19827_20381 181
281 3300053136 Ga0500559_0016426 Ga0500559_0016426_446_1090 181
282 3300053136 Ga0500559_0077623 Ga0500559_0077623_910_1455 181
283 3300053139 Ga0500568_0000051 Ga0500568_0000051_89136_89690 181
284 3300053139 Ga0500568_0002585 Ga0500568_0002585_5781_6335 181
285 3300053139 Ga0500568_0003104 Ga0500568_0003104_7372_7926 181
286 3300053140 Ga0500573_0000005 Ga0500573_0000005_203671_204228 181
287 3300053140 Ga0500573_0000437 Ga0500573_0000437_5946_6509 181
288 3300053140 Ga0500573_0003292 Ga0500573_0003292_4285_4833 181
289 3300053140 Ga0500573_0035538 Ga0500573_0035538_1947_2495 181
290 3300053140 Ga0500573_0075516 Ga0500573_0075516_674_1225 181
291 3300053140 Ga0500573_0082491 Ga0500573_0082491_228_785 181
292 3300053140 Ga0500573_0084151 Ga0500573_0084151_688_1236 181
293 3300053140 Ga0500573_0295582 Ga0500573_0295582_132_707 181
294 3300053140 Ga0500573_0438443 Ga0500573_0438443_18_566 181
295 3300053142 Ga0500577_0003399 Ga0500577_0003399_1146_1694 181
296 3300053142 Ga0500577_0008772 Ga0500577_0008772_2046_2594 181
297 3300053142 Ga0500577_0024618 Ga0500577_0024618_939_1487 181
298 3300053153 Ga0500616_0000010 Ga0500616_0000010_433450_433998 181
299 3300053153 Ga0500616_0005840 Ga0500616_0005840_4521_5135 181
300 3300053155 Ga0500620_000054 Ga0500620_000054_13381_13935 181
301 3300053155 Ga0500620_095514 Ga0500620_095514_246_794 181
302 3300053730 Ga0500645_005986 Ga0500645_005986_1409_1957 181
303 3300054114 Ga0501084_0671449 Ga0501084_0671449_181_735 181
304 3300060353 Ga0501082_0637405 Ga0501082_0637405_297_851 181
305 iso_pu_bacteria 2808606372 2808900355 181
306 iso_pu_bacteria 2857479173 2857480240 181
307 iso_pu_bacteria 2857632687 2857632901 181
308 iso_pu_bacteria 2870801768 2870803612 181
309 iso_pu_bacteria 2870804320 2870805568 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

78

199

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hkf-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) 0.9664 1 179
5hkl-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with inorganic phosphate 0.9634 1 180
5hkf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) 0.9478 3 180
5hki-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with fe(iii) dicitrate 0.9377 3 180
5hkf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) 0.9366 3 180
ID Description Score Start End Superfamily
5hkiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9377 3 180 3.40.50.2020
5hkiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9271 3 180 3.40.50.2020
af_G5EDZ2_3_216_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8953 3 178 3.40.50.2020
af_Q58509_1_175_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.895 1 181 3.40.50.2020
af_Q58509_1_175_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8903 1 181 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A653SFQ7-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9869 1 181 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A1I2XPT4-F1-model_v4 deleted 0.985 2 181
AF-A0A6L6E196-F1-model_v4 Orotate phosphoribosyltransferase 0.9831 107 181 GO:0004588
GO:0006222
GO:0019856
AF-A0A653SFQ7-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9815 1 181 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A1I2XPT4-F1-model_v4 deleted 0.9742 2 181

Feature Viewer

pLDDT pTM Quality
93.45 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map