F400446
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 309 | 190 | 268 | 185 |
Family's Representative Sequence
| Representative Sequence | 3300053136|Ga0500559_0016426|Ga0500559_0016426_446_1090 |
| Length | 214 |
| Sequence | MVANFAEWRPDGATHGTAGEFEPKCAPDKLIAVTAKDELIEYIKADAVFHGDFTLTSGKKATYYVDMRRVSLDHRVAPLIGQVMVDLIADVDDVAAVGGLTMGADPIAAAVLHQGVALGKSYDAFVVRKEPKDHGRGRQVEGPDLAGKRVIVLEDTSTTGGSPLAAIEALLKVGAIIAGVAVVVDRNTGAKERIEAAGYPYFSAIGLSDLGLDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 2 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 3 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 4 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 5 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 6 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 7 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 8 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 9 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 10 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 11 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 12 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 13 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 14 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 15 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 16 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 17 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 18 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 19 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 20 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 21 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 22 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 23 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 24 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 25 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 26 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 27 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 28 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 29 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 30 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 31 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 32 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 33 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 34 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 35 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 36 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 37 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 38 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 39 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 40 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 60 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 103 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 104 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 105 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 106 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 107 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 108 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 109 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 110 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 111 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 112 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 113 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 114 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 115 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 117 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 118 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 119 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 120 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 121 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 122 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 123 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 131 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 132 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 133 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 134 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 135 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 136 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 137 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 138 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 139 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 140 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 141 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 142 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 143 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 144 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 145 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 146 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 172 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 173 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 174 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 175 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 176 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 177 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 178 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 179 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 180 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 181 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 182 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 183 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 184 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 185 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 186 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 187 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 190 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.73 |
| Metatranscriptomes | 0 |
| Isolates | 13.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.32 |
| Bulb | 0 |
| Endosphere | 13.92 |
| Nodule | 0 |
| Rhizoplane | 3.88 |
| Rhizosphere | 65.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065714_10115138 | 3300005288 | Bacteria | 1420 |
| 2 | Ga0070658_10000129 | 3300005327 | Bacteria | 67266 |
| 3 | Ga0070683_100270602 | 3300005329 | Bacteria | 1616 |
| 4 | Ga0070690_100188088 | 3300005330 | Bacteria | 1430 |
| 5 | Ga0070670_100347664 | 3300005331 | Bacteria | 1302 |
| 6 | Ga0068868_100264624 | 3300005338 | Bacteria | 1451 |
| 7 | Ga0070668_100255511 | 3300005347 | Bacteria | 1456 |
| 8 | Ga0070671_100156275 | 3300005355 | Bacteria | 1926 |
| 9 | Ga0070659_100013452 | 3300005366 | Bacteria | 6092 |
| 10 | Ga0070713_100669717 | 3300005436 | Bacteria | 989 |
| 11 | Ga0070710_10072227 | 3300005437 | Bacteria | 1992 |
| 12 | Ga0070663_100085007 | 3300005455 | Bacteria | 2334 |
| 13 | Ga0070672_100297212 | 3300005543 | Bacteria | 1368 |
| 14 | Ga0070672_100482996 | 3300005543 | Bacteria | 1070 |
| 15 | Ga0070665_100248900 | 3300005548 | Bacteria | 1778 |
| 16 | Ga0068855_100008064 | 3300005563 | Bacteria | 12727 |
| 17 | Ga0068855_100971904 | 3300005563 | Bacteria | 893 |
| 18 | Ga0068870_10028508 | 3300005840 | Bacteria | 2804 |
| 19 | Ga0068863_100116670 | 3300005841 | Bacteria | 2544 |
| 20 | Ga0068863_100228061 | 3300005841 | Bacteria | 1796 |
| 21 | Ga0075365_10083160 | 3300006038 | Bacteria | 2171 |
| 22 | Ga0075365_10170938 | 3300006038 | Bacteria | 1517 |
| 23 | Ga0075364_10015546 | 3300006051 | Bacteria | 4721 |
| 24 | Ga0075364_10314347 | 3300006051 | Bacteria | 1066 |
| 25 | Ga0075364_10333685 | 3300006051 | Bacteria | 1033 |
| 26 | Ga0075432_10111208 | 3300006058 | Bacteria | 1021 |
| 27 | Ga0075369_10135897 | 3300006186 | Bacteria | 1119 |
| 28 | Ga0075370_10142621 | 3300006353 | Bacteria | 1401 |
| 29 | Ga0075370_10536904 | 3300006353 | Bacteria | 707 |
| 30 | Ga0105244_10080801 | 3300009036 | Bacteria | 1609 |
| 31 | Ga0105240_10781571 | 3300009093 | Bacteria | 1036 |
| 32 | Ga0105247_10373801 | 3300009101 | Bacteria | 1009 |
| 33 | Ga0105243_11479981 | 3300009148 | Bacteria | 702 |
| 34 | Ga0105248_10000905 | 3300009177 | Bacteria | 33139 |
| 35 | Ga0105237_10026877 | 3300009545 | Bacteria | 5881 |
| 36 | Ga0105249_10155654 | 3300009553 | Bacteria | 2204 |
| 37 | Ga0105239_10513645 | 3300010375 | Bacteria | 1363 |
| 38 | Ga0105246_10259965 | 3300011119 | Bacteria | 1383 |
| 39 | Ga0105246_10516185 | 3300011119 | Bacteria | 1017 |
| 40 | Ga0105246_11203410 | 3300011119 | Bacteria | 697 |
| 41 | Ga0157371_10002269 | 3300013102 | Bacteria | 18540 |
| 42 | Ga0157369_10000554 | 3300013105 | Bacteria | 49088 |
| 43 | Ga0157374_10142462 | 3300013296 | Bacteria | 2327 |
| 44 | Ga0163163_10071759 | 3300014325 | Bacteria | 3451 |
| 45 | Ga0163163_10793311 | 3300014325 | Bacteria | 1010 |
| 46 | Ga0163163_12048718 | 3300014325 | Bacteria | 632 |
| 47 | Ga0157380_10021201 | 3300014326 | Bacteria | 4870 |
| 48 | Ga0157380_11349448 | 3300014326 | Bacteria | 762 |
| 49 | Ga0163161_10172902 | 3300017792 | Bacteria | 1653 |
| 50 | Ga0207692_10012145 | 3300025898 | Bacteria | 3691 |
| 51 | Ga0207692_10047678 | 3300025898 | Bacteria | 2152 |
| 52 | Ga0207710_10066990 | 3300025900 | Bacteria | 1639 |
| 53 | Ga0207643_10015926 | 3300025908 | Bacteria | 4096 |
| 54 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 55 | Ga0207671_10018853 | 3300025914 | Bacteria | 5287 |
| 56 | Ga0207657_10098208 | 3300025919 | Bacteria | 2434 |
| 57 | Ga0207650_10448082 | 3300025925 | Bacteria | 1074 |
| 58 | Ga0207659_10450179 | 3300025926 | Bacteria | 1084 |
| 59 | Ga0207644_10109540 | 3300025931 | Bacteria | 2087 |
| 60 | Ga0207690_10194112 | 3300025932 | Bacteria | 1538 |
| 61 | Ga0207709_11042971 | 3300025935 | Bacteria | 670 |
| 62 | Ga0207691_10322805 | 3300025940 | Bacteria | 1324 |
| 63 | Ga0207711_10033098 | 3300025941 | Bacteria | 4372 |
| 64 | Ga0207689_10387573 | 3300025942 | Bacteria | 1164 |
| 65 | Ga0207661_10415771 | 3300025944 | Bacteria | 1221 |
| 66 | Ga0207667_10116337 | 3300025949 | Bacteria | 2755 |
| 67 | Ga0207712_10869665 | 3300025961 | Bacteria | 795 |
| 68 | Ga0207668_10166661 | 3300025972 | Bacteria | 1723 |
| 69 | Ga0207677_10298076 | 3300026023 | Bacteria | 1331 |
| 70 | Ga0207639_10099765 | 3300026041 | Bacteria | 2344 |
| 71 | Ga0207678_10147378 | 3300026067 | Bacteria | 2009 |
| 72 | Ga0207678_10421677 | 3300026067 | Bacteria | 1157 |
| 73 | Ga0207678_10826308 | 3300026067 | Bacteria | 818 |
| 74 | Ga0207641_10200486 | 3300026088 | Bacteria | 1839 |
| 75 | Ga0207674_10141936 | 3300026116 | Bacteria | 2361 |
| 76 | Ga0207674_10380012 | 3300026116 | Bacteria | 1365 |
| 77 | Ga0207675_100041619 | 3300026118 | Bacteria | 4290 |
| 78 | Ga0268266_10598730 | 3300028379 | Bacteria | 1059 |
| 79 | Ga0307515_10049865 | 3300028794 | Bacteria | 6283 |
| 80 | Ga0307515_10220198 | 3300028794 | Bacteria | 1718 |
| 81 | Ga0307515_10366213 | 3300028794 | Bacteria | 1080 |
| 82 | Ga0307513_10093989 | 3300031456 | Bacteria | 3045 |
| 83 | Ga0307513_10337451 | 3300031456 | Bacteria | 1259 |
| 84 | Ga0307513_10527761 | 3300031456 | Bacteria | 895 |
| 85 | Ga0307408_100279106 | 3300031548 | Bacteria | 1391 |
| 86 | Ga0307408_100595090 | 3300031548 | Bacteria | 982 |
| 87 | Ga0307514_10006647 | 3300031649 | Bacteria | 10030 |
| 88 | Ga0307413_10078182 | 3300031824 | Bacteria | 2110 |
| 89 | Ga0307410_10083437 | 3300031852 | Bacteria | 2250 |
| 90 | Ga0307406_10307484 | 3300031901 | Bacteria | 1221 |
| 91 | Ga0307406_10902157 | 3300031901 | Bacteria | 752 |
| 92 | Ga0307407_10205463 | 3300031903 | Bacteria | 1323 |
| 93 | Ga0307407_10567802 | 3300031903 | Bacteria | 841 |
| 94 | Ga0307412_10167956 | 3300031911 | Bacteria | 1638 |
| 95 | Ga0307409_100124929 | 3300031995 | Bacteria | 2187 |
| 96 | Ga0307409_100133786 | 3300031995 | Bacteria | 2124 |
| 97 | Ga0307409_100160300 | 3300031995 | Bacteria | 1966 |
| 98 | Ga0307409_100310221 | 3300031995 | Bacteria | 1472 |
| 99 | Ga0307409_101492528 | 3300031995 | Bacteria | 703 |
| 100 | Ga0307416_100387882 | 3300032002 | Bacteria | 1430 |
| 101 | Ga0307416_100606930 | 3300032002 | Bacteria | 1175 |
| 102 | Ga0307416_100608961 | 3300032002 | Bacteria | 1173 |
| 103 | Ga0307416_100870677 | 3300032002 | Bacteria | 1000 |
| 104 | Ga0307411_10724180 | 3300032005 | Bacteria | 869 |
| 105 | Ga0307415_100218268 | 3300032126 | Bacteria | 1527 |
| 106 | Ga0451793_1469148 | 3300041452 | Bacteria | 894 |
| 107 | Ga0451802_0976675 | 3300041460 | Bacteria | 896 |
| 108 | Ga0451807_1312983 | 3300041486 | Bacteria | 1039 |
| 109 | Ga0451853_0699505 | 3300041512 | Bacteria | 1311 |
| 110 | Ga0466969_0134017 | 3300044656 | Bacteria | 1148 |
| 111 | Ga0466972_0180332 | 3300044658 | Bacteria | 990 |
| 112 | Ga0466965_0000004 | 3300044683 | Bacteria | 229348 |
| 113 | Ga0466970_0005136 | 3300044765 | Bacteria | 6471 |
| 114 | Ga0466970_0033873 | 3300044765 | Bacteria | 2701 |
| 115 | Ga0466970_0511057 | 3300044765 | Bacteria | 692 |
| 116 | Ga0495590_0000115 | 3300046457 | Bacteria | 48176 |
| 117 | Ga0495650_0000897 | 3300046471 | Bacteria | 35099 |
| 118 | Ga0495650_0150120 | 3300046471 | Bacteria | 837 |
| 119 | Ga0495650_0196072 | 3300046471 | Bacteria | 704 |
| 120 | Ga0495631_0167457 | 3300046518 | Bacteria | 943 |
| 121 | Ga0495609_0058424 | 3300046538 | Bacteria | 1706 |
| 122 | Ga0495656_0104822 | 3300046615 | Bacteria | 1313 |
| 123 | Ga0495656_0267551 | 3300046615 | Bacteria | 868 |
| 124 | Ga0496100_0375216 | 3300048903 | Bacteria | 1079 |
| 125 | Ga0496101_0279231 | 3300048904 | Bacteria | 1305 |
| 126 | Ga0496102_0221365 | 3300048905 | Bacteria | 1784 |
| 127 | Ga0496102_1332656 | 3300048905 | Bacteria | 637 |
| 128 | Ga0496104_0229648 | 3300048907 | Bacteria | 1768 |
| 129 | Ga0496105_0295103 | 3300048908 | Bacteria | 1304 |
| 130 | Ga0496113_0086788 | 3300048916 | Bacteria | 2405 |
| 131 | Ga0496115_0012578 | 3300048918 | Bacteria | 6376 |
| 132 | Ga0496115_0356145 | 3300048918 | Bacteria | 1193 |
| 133 | Ga0496116_0245467 | 3300048919 | Bacteria | 896 |
| 134 | Ga0496117_0000174 | 3300048920 | Bacteria | 132648 |
| 135 | Ga0496117_0001641 | 3300048920 | Bacteria | 31427 |
| 136 | Ga0496117_0003930 | 3300048920 | Bacteria | 16829 |
| 137 | Ga0496118_0000201 | 3300048921 | Bacteria | 104874 |
| 138 | Ga0496118_0010431 | 3300048921 | Bacteria | 9203 |
| 139 | Ga0496119_0001959 | 3300048922 | Bacteria | 23406 |
| 140 | Ga0496120_0054956 | 3300048923 | Bacteria | 2253 |
| 141 | Ga0496120_0149153 | 3300048923 | Bacteria | 1177 |
| 142 | Ga0496120_0195626 | 3300048923 | Bacteria | 982 |
| 143 | Ga0496121_0000046 | 3300048924 | Bacteria | 335942 |
| 144 | Ga0496121_0436208 | 3300048924 | Bacteria | 848 |
| 145 | Ga0496122_0000235 | 3300048925 | Bacteria | 124769 |
| 146 | Ga0496122_0004477 | 3300048925 | Bacteria | 17284 |
| 147 | Ga0496122_0015424 | 3300048925 | Bacteria | 7305 |
| 148 | Ga0496122_0105595 | 3300048925 | Bacteria | 1867 |
| 149 | Ga0496123_0000036 | 3300048926 | Bacteria | 265722 |
| 150 | Ga0496123_0003089 | 3300048926 | Bacteria | 19123 |
| 151 | Ga0496123_0168817 | 3300048926 | Bacteria | 1157 |
| 152 | Ga0496124_0000194 | 3300048927 | Bacteria | 120672 |
| 153 | Ga0496124_0002889 | 3300048927 | Bacteria | 21677 |
| 154 | Ga0496125_0005792 | 3300048928 | Bacteria | 13574 |
| 155 | Ga0496126_0001500 | 3300048929 | Bacteria | 36136 |
| 156 | Ga0496126_0032637 | 3300048929 | Bacteria | 4903 |
| 157 | Ga0496126_0093683 | 3300048929 | Bacteria | 2637 |
| 158 | Ga0496126_0379661 | 3300048929 | Bacteria | 1151 |
| 159 | Ga0496126_0741560 | 3300048929 | Bacteria | 759 |
| 160 | Ga0501031_0023283 | 3300049568 | Bacteria | 4038 |
| 161 | Ga0501031_0064361 | 3300049568 | Bacteria | 2388 |
| 162 | Ga0501031_0575551 | 3300049568 | Bacteria | 725 |
| 163 | Ga0501032_0010530 | 3300049569 | Bacteria | 6669 |
| 164 | Ga0501032_0140327 | 3300049569 | Bacteria | 1591 |
| 165 | Ga0501032_0182309 | 3300049569 | Bacteria | 1374 |
| 166 | Ga0501033_0019550 | 3300049570 | Bacteria | 5121 |
| 167 | Ga0501033_0024936 | 3300049570 | Bacteria | 4506 |
| 168 | Ga0501033_0025454 | 3300049570 | Bacteria | 4459 |
| 169 | Ga0501033_0076428 | 3300049570 | Bacteria | 2458 |
| 170 | Ga0501034_0079741 | 3300049571 | Bacteria | 3277 |
| 171 | Ga0501034_0083622 | 3300049571 | Bacteria | 3193 |
| 172 | Ga0501034_0117397 | 3300049571 | Bacteria | 2648 |
| 173 | Ga0501034_0183816 | 3300049571 | Bacteria | 2054 |
| 174 | Ga0501034_0291432 | 3300049571 | Bacteria | 1570 |
| 175 | Ga0501034_0321416 | 3300049571 | Bacteria | 1480 |
| 176 | Ga0501034_0325570 | 3300049571 | Bacteria | 1469 |
| 177 | Ga0501034_0328704 | 3300049571 | Bacteria | 1461 |
| 178 | Ga0501034_0469424 | 3300049571 | Bacteria | 1174 |
| 179 | Ga0501034_0833189 | 3300049571 | Bacteria | 813 |
| 180 | Ga0501036_0024599 | 3300049572 | Bacteria | 5078 |
| 181 | Ga0501037_0024996 | 3300049573 | Bacteria | 4414 |
| 182 | Ga0501037_0104035 | 3300049573 | Bacteria | 2047 |
| 183 | Ga0501037_0357132 | 3300049573 | Bacteria | 1007 |
| 184 | Ga0501038_0018400 | 3300049574 | Bacteria | 6306 |
| 185 | Ga0501038_0047428 | 3300049574 | Bacteria | 3721 |
| 186 | Ga0501038_0068123 | 3300049574 | Bacteria | 3026 |
| 187 | Ga0501039_0155239 | 3300049575 | Bacteria | 1798 |
| 188 | Ga0501040_0055882 | 3300049576 | Bacteria | 2708 |
| 189 | Ga0501042_0000537 | 3300049578 | Bacteria | 19861 |
| 190 | Ga0501043_0015227 | 3300049579 | Bacteria | 6022 |
| 191 | Ga0501043_0016686 | 3300049579 | Bacteria | 5754 |
| 192 | Ga0501046_0036327 | 3300049580 | Bacteria | 3965 |
| 193 | Ga0501047_0024395 | 3300049581 | Bacteria | 5805 |
| 194 | Ga0501047_0047612 | 3300049581 | Bacteria | 4141 |
| 195 | Ga0501047_0050134 | 3300049581 | Bacteria | 4031 |
| 196 | Ga0501047_0473774 | 3300049581 | Bacteria | 1080 |
| 197 | Ga0501048_0035602 | 3300049582 | Bacteria | 3583 |
| 198 | Ga0501067_0189443 | 3300049583 | Bacteria | 1146 |
| 199 | Ga0501067_0264223 | 3300049583 | Bacteria | 958 |
| 200 | Ga0501068_0316149 | 3300049584 | Bacteria | 1001 |
| 201 | Ga0501070_0000367 | 3300049586 | Bacteria | 41059 |
| 202 | Ga0501070_0017767 | 3300049586 | Bacteria | 5972 |
| 203 | Ga0501070_0068378 | 3300049586 | Bacteria | 2940 |
| 204 | Ga0501073_0000046 | 3300049589 | Bacteria | 78180 |
| 205 | Ga0501073_0012557 | 3300049589 | Bacteria | 6182 |
| 206 | Ga0501073_0023672 | 3300049589 | Bacteria | 4408 |
| 207 | Ga0501073_0159750 | 3300049589 | Bacteria | 1562 |
| 208 | Ga0501074_0040793 | 3300049590 | Bacteria | 3361 |
| 209 | Ga0501074_0098419 | 3300049590 | Bacteria | 2093 |
| 210 | Ga0501077_0684159 | 3300049593 | Bacteria | 659 |
| 211 | Ga0501079_0345812 | 3300049741 | Bacteria | 1165 |
| 212 | Ga0501080_0000085 | 3300049742 | Bacteria | 62675 |
| 213 | Ga0501080_0073137 | 3300049742 | Bacteria | 3189 |
| 214 | Ga0501080_0185440 | 3300049742 | Bacteria | 1913 |
| 215 | Ga0501080_0657395 | 3300049742 | Bacteria | 927 |
| 216 | Ga0501083_0000028 | 3300049744 | Bacteria | 115481 |
| 217 | Ga0501083_0003278 | 3300049744 | Bacteria | 11305 |
| 218 | Ga0501083_0132756 | 3300049744 | Bacteria | 1632 |
| 219 | Ga0501035_0024097 | 3300049822 | Bacteria | 5583 |
| 220 | Ga0501035_0177494 | 3300049822 | Bacteria | 1836 |
| 221 | Ga0501035_0178583 | 3300049822 | Bacteria | 1830 |
| 222 | Ga0501035_0356118 | 3300049822 | Bacteria | 1224 |
| 223 | Ga0501035_0401678 | 3300049822 | Bacteria | 1140 |
| 224 | Ga0501035_0643960 | 3300049822 | Bacteria | 860 |
| 225 | Ga0501044_0024460 | 3300049823 | Bacteria | 6409 |
| 226 | Ga0501044_0057159 | 3300049823 | Bacteria | 4004 |
| 227 | Ga0501044_0151665 | 3300049823 | Bacteria | 2299 |
| 228 | Ga0501044_0283740 | 3300049823 | Bacteria | 1588 |
| 229 | Ga0501044_0505695 | 3300049823 | Bacteria | 1109 |
| 230 | Ga0501044_1104298 | 3300049823 | Bacteria | 662 |
| 231 | nmdc:mga00v17_27249_c1 | 3300050491 | Bacteria | 3335 |
| 232 | nmdc:mga00v17_282699_c1 | 3300050491 | Bacteria | 1077 |
| 233 | nmdc:mga00v17_411338_c1 | 3300050491 | Bacteria | 879 |
| 234 | nmdc:mga0yw44_41347_c1 | 3300050492 | Bacteria | 2744 |
| 235 | nmdc:mga0sz30_59374_c1 | 3300050516 | Bacteria | 1632 |
| 236 | Ga0500650_0079348 | 3300053098 | Bacteria | 1534 |
| 237 | Ga0500554_030699 | 3300053102 | Bacteria | 1581 |
| 238 | Ga0500556_0001137 | 3300053104 | Bacteria | 13017 |
| 239 | Ga0500562_000646 | 3300053108 | Bacteria | 8425 |
| 240 | Ga0500593_000381 | 3300053117 | Bacteria | 17618 |
| 241 | Ga0500655_001381 | 3300053133 | Bacteria | 4602 |
| 242 | Ga0500559_0000202 | 3300053136 | Bacteria | 47695 |
| 243 | Ga0500559_0000474 | 3300053136 | Bacteria | 28589 |
| 244 | Ga0500559_0016426 | 3300053136 | Bacteria | 3125 |
| 245 | Ga0500559_0077623 | 3300053136 | Bacteria | 1505 |
| 246 | Ga0500568_0000051 | 3300053139 | Bacteria | 112462 |
| 247 | Ga0500568_0002585 | 3300053139 | Bacteria | 10527 |
| 248 | Ga0500568_0003104 | 3300053139 | Bacteria | 9471 |
| 249 | Ga0500573_0000005 | 3300053140 | Bacteria | 315762 |
| 250 | Ga0500573_0000437 | 3300053140 | Bacteria | 17885 |
| 251 | Ga0500573_0003292 | 3300053140 | Bacteria | 8333 |
| 252 | Ga0500573_0035538 | 3300053140 | Bacteria | 2875 |
| 253 | Ga0500573_0075516 | 3300053140 | Bacteria | 1918 |
| 254 | Ga0500573_0082491 | 3300053140 | Bacteria | 1826 |
| 255 | Ga0500573_0084151 | 3300053140 | Bacteria | 1805 |
| 256 | Ga0500573_0295582 | 3300053140 | Bacteria | 812 |
| 257 | Ga0500573_0438443 | 3300053140 | Bacteria | 607 |
| 258 | Ga0500577_0003399 | 3300053142 | Bacteria | 4132 |
| 259 | Ga0500577_0008772 | 3300053142 | Bacteria | 2900 |
| 260 | Ga0500577_0024618 | 3300053142 | Bacteria | 2026 |
| 261 | Ga0500616_0000010 | 3300053153 | Bacteria | 761410 |
| 262 | Ga0500616_0005840 | 3300053153 | Bacteria | 8245 |
| 263 | Ga0500620_000054 | 3300053155 | Bacteria | 21041 |
| 264 | Ga0500620_095514 | 3300053155 | Bacteria | 1038 |
| 265 | Ga0500645_005986 | 3300053730 | Bacteria | 4396 |
| 266 | Ga0501084_0286592 | 3300054114 | Bacteria | 1391 |
| 267 | Ga0501084_0671449 | 3300054114 | Bacteria | 874 |
| 268 | Ga0501082_0637405 | 3300060353 | Bacteria | 932 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014326 | Ga0157380_11349448 | Ga0157380_113494482 | 168 |
| 2 | 3300054114 | Ga0501084_0286592 | Ga0501084_0286592_789_1358 | 172 |
| 3 | 3300048924 | Ga0496121_0000046 | Ga0496121_0000046_108227_108787 | 174 |
| 4 | iso_pu_bacteria | 2585428094 | 2587861658 | 175 |
| 5 | iso_pu_bacteria | 2643221649 | 2644278246 | 175 |
| 6 | iso_pu_bacteria | 2643221694 | 2644524838 | 178 |
| 7 | iso_pu_bacteria | 2643221722 | 2644668923 | 178 |
| 8 | iso_pu_bacteria | 2751185788 | 2753300707 | 178 |
| 9 | iso_pu_bacteria | 2844852863 | 2844853507 | 178 |
| 10 | iso_pu_bacteria | 2852643534 | 2852644109 | 178 |
| 11 | iso_pu_bacteria | 2852677369 | 2852678053 | 178 |
| 12 | iso_pu_bacteria | 2857729791 | 2857733095 | 178 |
| 13 | iso_pu_bacteria | 2857733635 | 2857734943 | 178 |
| 14 | iso_pu_bacteria | 2857737099 | 2857739033 | 178 |
| 15 | iso_pu_bacteria | 2870622029 | 2870625455 | 178 |
| 16 | iso_pu_bacteria | 2895660088 | 2895662276 | 178 |
| 17 | iso_pu_bacteria | 2897561785 | 2897562143 | 178 |
| 18 | iso_pu_bacteria | 2904430863 | 2904431375 | 178 |
| 19 | iso_pu_bacteria | 2904501621 | 2904502538 | 178 |
| 20 | iso_pu_bacteria | 2908674828 | 2908678007 | 178 |
| 21 | iso_pu_bacteria | 2909074476 | 2909075877 | 178 |
| 22 | iso_pu_bacteria | 2919039151 | 2919041318 | 178 |
| 23 | iso_pu_bacteria | 2919042368 | 2919044050 | 178 |
| 24 | iso_pu_bacteria | 2928104781 | 2928107076 | 178 |
| 25 | iso_pu_bacteria | 2928121344 | 2928121800 | 178 |
| 26 | iso_pu_bacteria | 2928500415 | 2928501769 | 178 |
| 27 | iso_pu_bacteria | 2939657138 | 2939660562 | 178 |
| 28 | iso_pu_bacteria | 2939660829 | 2939661587 | 178 |
| 29 | iso_pu_bacteria | 2966921586 | 2966923791 | 178 |
| 30 | iso_pu_bacteria | 2984551494 | 2984552784 | 178 |
| 31 | iso_pu_bacteria | 8056037122 | 8056040310 | 178 |
| 32 | iso_pu_bacteria | 8057345674 | 8057346472 | 178 |
| 33 | 3300031824 | Ga0307413_10078182 | Ga0307413_100781822 | 179 |
| 34 | 3300031852 | Ga0307410_10083437 | Ga0307410_100834373 | 179 |
| 35 | 3300031995 | Ga0307409_100160300 | Ga0307409_1001603001 | 179 |
| 36 | 3300049571 | Ga0501034_0117397 | Ga0501034_0117397_836_1402 | 179 |
| 37 | iso_pu_bacteria | 2887443736 | 2887447237 | 179 |
| 38 | 3300044765 | Ga0466970_0511057 | Ga0466970_0511057_60_611 | 180 |
| 39 | iso_pu_bacteria | 2643221572 | 2643876944 | 180 |
| 40 | iso_pu_bacteria | 2643221669 | 2644383999 | 180 |
| 41 | iso_pu_bacteria | 2721755702 | 2723643748 | 180 |
| 42 | iso_pu_bacteria | 2919443155 | 2919444978 | 180 |
| 43 | iso_pu_bacteria | 2935409751 | 2935413412 | 180 |
| 44 | iso_pu_bacteria | 2946024296 | 2946024505 | 180 |
| 45 | 3300005288 | Ga0065714_10115138 | Ga0065714_101151381 | 181 |
| 46 | 3300005327 | Ga0070658_10000129 | Ga0070658_1000012917 | 181 |
| 47 | 3300005329 | Ga0070683_100270602 | Ga0070683_1002706022 | 181 |
| 48 | 3300005330 | Ga0070690_100188088 | Ga0070690_1001880882 | 181 |
| 49 | 3300005331 | Ga0070670_100347664 | Ga0070670_1003476642 | 181 |
| 50 | 3300005338 | Ga0068868_100264624 | Ga0068868_1002646242 | 181 |
| 51 | 3300005347 | Ga0070668_100255511 | Ga0070668_1002555111 | 181 |
| 52 | 3300005355 | Ga0070671_100156275 | Ga0070671_1001562752 | 181 |
| 53 | 3300005366 | Ga0070659_100013452 | Ga0070659_1000134522 | 181 |
| 54 | 3300005436 | Ga0070713_100669717 | Ga0070713_1006697172 | 181 |
| 55 | 3300005437 | Ga0070710_10072227 | Ga0070710_100722271 | 181 |
| 56 | 3300005455 | Ga0070663_100085007 | Ga0070663_1000850072 | 181 |
| 57 | 3300005543 | Ga0070672_100297212 | Ga0070672_1002972122 | 181 |
| 58 | 3300005543 | Ga0070672_100482996 | Ga0070672_1004829962 | 181 |
| 59 | 3300005548 | Ga0070665_100248900 | Ga0070665_1002489002 | 181 |
| 60 | 3300005563 | Ga0068855_100008064 | Ga0068855_1000080645 | 181 |
| 61 | 3300005563 | Ga0068855_100971904 | Ga0068855_1009719041 | 181 |
| 62 | 3300005840 | Ga0068870_10028508 | Ga0068870_100285082 | 181 |
| 63 | 3300005841 | Ga0068863_100116670 | Ga0068863_1001166701 | 181 |
| 64 | 3300005841 | Ga0068863_100228061 | Ga0068863_1002280612 | 181 |
| 65 | 3300006038 | Ga0075365_10083160 | Ga0075365_100831604 | 181 |
| 66 | 3300006038 | Ga0075365_10170938 | Ga0075365_101709381 | 181 |
| 67 | 3300006051 | Ga0075364_10015546 | Ga0075364_100155467 | 181 |
| 68 | 3300006051 | Ga0075364_10314347 | Ga0075364_103143472 | 181 |
| 69 | 3300006051 | Ga0075364_10333685 | Ga0075364_103336852 | 181 |
| 70 | 3300006058 | Ga0075432_10111208 | Ga0075432_101112082 | 181 |
| 71 | 3300006186 | Ga0075369_10135897 | Ga0075369_101358972 | 181 |
| 72 | 3300006353 | Ga0075370_10142621 | Ga0075370_101426212 | 181 |
| 73 | 3300006353 | Ga0075370_10536904 | Ga0075370_105369041 | 181 |
| 74 | 3300009036 | Ga0105244_10080801 | Ga0105244_100808012 | 181 |
| 75 | 3300009093 | Ga0105240_10781571 | Ga0105240_107815712 | 181 |
| 76 | 3300009101 | Ga0105247_10373801 | Ga0105247_103738012 | 181 |
| 77 | 3300009148 | Ga0105243_11479981 | Ga0105243_114799812 | 181 |
| 78 | 3300009177 | Ga0105248_10000905 | Ga0105248_1000090514 | 181 |
| 79 | 3300009545 | Ga0105237_10026877 | Ga0105237_100268773 | 181 |
| 80 | 3300009553 | Ga0105249_10155654 | Ga0105249_101556543 | 181 |
| 81 | 3300010375 | Ga0105239_10513645 | Ga0105239_105136451 | 181 |
| 82 | 3300011119 | Ga0105246_10259965 | Ga0105246_102599653 | 181 |
| 83 | 3300011119 | Ga0105246_10516185 | Ga0105246_105161852 | 181 |
| 84 | 3300011119 | Ga0105246_11203410 | Ga0105246_112034101 | 181 |
| 85 | 3300013102 | Ga0157371_10002269 | Ga0157371_1000226910 | 181 |
| 86 | 3300013105 | Ga0157369_10000554 | Ga0157369_1000055431 | 181 |
| 87 | 3300013296 | Ga0157374_10142462 | Ga0157374_101424624 | 181 |
| 88 | 3300014325 | Ga0163163_10071759 | Ga0163163_100717593 | 181 |
| 89 | 3300014325 | Ga0163163_10793311 | Ga0163163_107933112 | 181 |
| 90 | 3300014325 | Ga0163163_12048718 | Ga0163163_120487181 | 181 |
| 91 | 3300014326 | Ga0157380_10021201 | Ga0157380_100212013 | 181 |
| 92 | 3300017792 | Ga0163161_10172902 | Ga0163161_101729022 | 181 |
| 93 | 3300025898 | Ga0207692_10012145 | Ga0207692_100121453 | 181 |
| 94 | 3300025898 | Ga0207692_10047678 | Ga0207692_100476782 | 181 |
| 95 | 3300025900 | Ga0207710_10066990 | Ga0207710_100669901 | 181 |
| 96 | 3300025908 | Ga0207643_10015926 | Ga0207643_100159262 | 181 |
| 97 | 3300025909 | Ga0207705_10000001 | Ga0207705_10000001897 | 181 |
| 98 | 3300025914 | Ga0207671_10018853 | Ga0207671_100188533 | 181 |
| 99 | 3300025919 | Ga0207657_10098208 | Ga0207657_100982082 | 181 |
| 100 | 3300025925 | Ga0207650_10448082 | Ga0207650_104480822 | 181 |
| 101 | 3300025926 | Ga0207659_10450179 | Ga0207659_104501791 | 181 |
| 102 | 3300025931 | Ga0207644_10109540 | Ga0207644_101095402 | 181 |
| 103 | 3300025932 | Ga0207690_10194112 | Ga0207690_101941122 | 181 |
| 104 | 3300025935 | Ga0207709_11042971 | Ga0207709_110429711 | 181 |
| 105 | 3300025940 | Ga0207691_10322805 | Ga0207691_103228052 | 181 |
| 106 | 3300025941 | Ga0207711_10033098 | Ga0207711_100330986 | 181 |
| 107 | 3300025942 | Ga0207689_10387573 | Ga0207689_103875732 | 181 |
| 108 | 3300025944 | Ga0207661_10415771 | Ga0207661_104157711 | 181 |
| 109 | 3300025949 | Ga0207667_10116337 | Ga0207667_101163373 | 181 |
| 110 | 3300025961 | Ga0207712_10869665 | Ga0207712_108696652 | 181 |
| 111 | 3300025972 | Ga0207668_10166661 | Ga0207668_101666612 | 181 |
| 112 | 3300026023 | Ga0207677_10298076 | Ga0207677_102980762 | 181 |
| 113 | 3300026041 | Ga0207639_10099765 | Ga0207639_100997653 | 181 |
| 114 | 3300026067 | Ga0207678_10147378 | Ga0207678_101473783 | 181 |
| 115 | 3300026067 | Ga0207678_10421677 | Ga0207678_104216771 | 181 |
| 116 | 3300026067 | Ga0207678_10826308 | Ga0207678_108263082 | 181 |
| 117 | 3300026088 | Ga0207641_10200486 | Ga0207641_102004863 | 181 |
| 118 | 3300026116 | Ga0207674_10141936 | Ga0207674_101419365 | 181 |
| 119 | 3300026116 | Ga0207674_10380012 | Ga0207674_103800121 | 181 |
| 120 | 3300026118 | Ga0207675_100041619 | Ga0207675_1000416192 | 181 |
| 121 | 3300028379 | Ga0268266_10598730 | Ga0268266_105987302 | 181 |
| 122 | 3300028794 | Ga0307515_10049865 | Ga0307515_100498654 | 181 |
| 123 | 3300028794 | Ga0307515_10220198 | Ga0307515_102201982 | 181 |
| 124 | 3300028794 | Ga0307515_10366213 | Ga0307515_103662132 | 181 |
| 125 | 3300031456 | Ga0307513_10093989 | Ga0307513_100939894 | 181 |
| 126 | 3300031456 | Ga0307513_10337451 | Ga0307513_103374512 | 181 |
| 127 | 3300031456 | Ga0307513_10527761 | Ga0307513_105277611 | 181 |
| 128 | 3300031548 | Ga0307408_100279106 | Ga0307408_1002791062 | 181 |
| 129 | 3300031548 | Ga0307408_100595090 | Ga0307408_1005950902 | 181 |
| 130 | 3300031649 | Ga0307514_10006647 | Ga0307514_100066477 | 181 |
| 131 | 3300031901 | Ga0307406_10307484 | Ga0307406_103074842 | 181 |
| 132 | 3300031901 | Ga0307406_10902157 | Ga0307406_109021571 | 181 |
| 133 | 3300031903 | Ga0307407_10205463 | Ga0307407_102054632 | 181 |
| 134 | 3300031903 | Ga0307407_10567802 | Ga0307407_105678021 | 181 |
| 135 | 3300031911 | Ga0307412_10167956 | Ga0307412_101679563 | 181 |
| 136 | 3300031995 | Ga0307409_100124929 | Ga0307409_1001249292 | 181 |
| 137 | 3300031995 | Ga0307409_100133786 | Ga0307409_1001337862 | 181 |
| 138 | 3300031995 | Ga0307409_100310221 | Ga0307409_1003102212 | 181 |
| 139 | 3300031995 | Ga0307409_101492528 | Ga0307409_1014925281 | 181 |
| 140 | 3300032002 | Ga0307416_100387882 | Ga0307416_1003878822 | 181 |
| 141 | 3300032002 | Ga0307416_100606930 | Ga0307416_1006069303 | 181 |
| 142 | 3300032002 | Ga0307416_100608961 | Ga0307416_1006089612 | 181 |
| 143 | 3300032002 | Ga0307416_100870677 | Ga0307416_1008706772 | 181 |
| 144 | 3300032005 | Ga0307411_10724180 | Ga0307411_107241802 | 181 |
| 145 | 3300032126 | Ga0307415_100218268 | Ga0307415_1002182682 | 181 |
| 146 | 3300041452 | Ga0451793_1469148 | Ga0451793_1469148_251_805 | 181 |
| 147 | 3300041460 | Ga0451802_0976675 | Ga0451802_0976675_155_703 | 181 |
| 148 | 3300041486 | Ga0451807_1312983 | Ga0451807_1312983_375_926 | 181 |
| 149 | 3300041512 | Ga0451853_0699505 | Ga0451853_0699505_31_624 | 181 |
| 150 | 3300044656 | Ga0466969_0134017 | Ga0466969_0134017_84_635 | 181 |
| 151 | 3300044658 | Ga0466972_0180332 | Ga0466972_0180332_288_848 | 181 |
| 152 | 3300044683 | Ga0466965_0000004 | Ga0466965_0000004_18939_19493 | 181 |
| 153 | 3300044765 | Ga0466970_0005136 | Ga0466970_0005136_1743_2294 | 181 |
| 154 | 3300044765 | Ga0466970_0033873 | Ga0466970_0033873_1092_1643 | 181 |
| 155 | 3300046457 | Ga0495590_0000115 | Ga0495590_0000115_30828_31382 | 181 |
| 156 | 3300046471 | Ga0495650_0000897 | Ga0495650_0000897_18389_18955 | 181 |
| 157 | 3300046471 | Ga0495650_0150120 | Ga0495650_0150120_115_666 | 181 |
| 158 | 3300046471 | Ga0495650_0196072 | Ga0495650_0196072_13_561 | 181 |
| 159 | 3300046518 | Ga0495631_0167457 | Ga0495631_0167457_298_870 | 181 |
| 160 | 3300046538 | Ga0495609_0058424 | Ga0495609_0058424_74_625 | 181 |
| 161 | 3300046615 | Ga0495656_0104822 | Ga0495656_0104822_650_1204 | 181 |
| 162 | 3300046615 | Ga0495656_0267551 | Ga0495656_0267551_88_660 | 181 |
| 163 | 3300048903 | Ga0496100_0375216 | Ga0496100_0375216_317_871 | 181 |
| 164 | 3300048904 | Ga0496101_0279231 | Ga0496101_0279231_367_918 | 181 |
| 165 | 3300048905 | Ga0496102_0221365 | Ga0496102_0221365_297_848 | 181 |
| 166 | 3300048905 | Ga0496102_1332656 | Ga0496102_1332656_16_570 | 181 |
| 167 | 3300048907 | Ga0496104_0229648 | Ga0496104_0229648_962_1510 | 181 |
| 168 | 3300048908 | Ga0496105_0295103 | Ga0496105_0295103_536_1084 | 181 |
| 169 | 3300048916 | Ga0496113_0086788 | Ga0496113_0086788_289_861 | 181 |
| 170 | 3300048918 | Ga0496115_0012578 | Ga0496115_0012578_2066_2620 | 181 |
| 171 | 3300048918 | Ga0496115_0356145 | Ga0496115_0356145_484_1038 | 181 |
| 172 | 3300048919 | Ga0496116_0245467 | Ga0496116_0245467_208_756 | 181 |
| 173 | 3300048920 | Ga0496117_0000174 | Ga0496117_0000174_35314_35862 | 181 |
| 174 | 3300048920 | Ga0496117_0001641 | Ga0496117_0001641_7153_7704 | 181 |
| 175 | 3300048920 | Ga0496117_0003930 | Ga0496117_0003930_6883_7458 | 181 |
| 176 | 3300048921 | Ga0496118_0000201 | Ga0496118_0000201_17307_17858 | 181 |
| 177 | 3300048921 | Ga0496118_0010431 | Ga0496118_0010431_617_1192 | 181 |
| 178 | 3300048922 | Ga0496119_0001959 | Ga0496119_0001959_1800_2375 | 181 |
| 179 | 3300048923 | Ga0496120_0054956 | Ga0496120_0054956_344_919 | 181 |
| 180 | 3300048923 | Ga0496120_0149153 | Ga0496120_0149153_619_1164 | 181 |
| 181 | 3300048923 | Ga0496120_0195626 | Ga0496120_0195626_259_810 | 181 |
| 182 | 3300048924 | Ga0496121_0436208 | Ga0496121_0436208_225_791 | 181 |
| 183 | 3300048925 | Ga0496122_0000235 | Ga0496122_0000235_94861_95436 | 181 |
| 184 | 3300048925 | Ga0496122_0004477 | Ga0496122_0004477_101_649 | 181 |
| 185 | 3300048925 | Ga0496122_0015424 | Ga0496122_0015424_3529_4077 | 181 |
| 186 | 3300048925 | Ga0496122_0105595 | Ga0496122_0105595_267_818 | 181 |
| 187 | 3300048926 | Ga0496123_0000036 | Ga0496123_0000036_29338_29913 | 181 |
| 188 | 3300048926 | Ga0496123_0003089 | Ga0496123_0003089_2277_2825 | 181 |
| 189 | 3300048926 | Ga0496123_0168817 | Ga0496123_0168817_139_687 | 181 |
| 190 | 3300048927 | Ga0496124_0000194 | Ga0496124_0000194_31856_32407 | 181 |
| 191 | 3300048927 | Ga0496124_0002889 | Ga0496124_0002889_19617_20192 | 181 |
| 192 | 3300048928 | Ga0496125_0005792 | Ga0496125_0005792_11609_12184 | 181 |
| 193 | 3300048929 | Ga0496126_0001500 | Ga0496126_0001500_35191_35739 | 181 |
| 194 | 3300048929 | Ga0496126_0032637 | Ga0496126_0032637_1911_2486 | 181 |
| 195 | 3300048929 | Ga0496126_0093683 | Ga0496126_0093683_660_1211 | 181 |
| 196 | 3300048929 | Ga0496126_0379661 | Ga0496126_0379661_339_893 | 181 |
| 197 | 3300048929 | Ga0496126_0741560 | Ga0496126_0741560_76_627 | 181 |
| 198 | 3300049568 | Ga0501031_0023283 | Ga0501031_0023283_2013_2561 | 181 |
| 199 | 3300049568 | Ga0501031_0064361 | Ga0501031_0064361_978_1532 | 181 |
| 200 | 3300049568 | Ga0501031_0575551 | Ga0501031_0575551_111_671 | 181 |
| 201 | 3300049569 | Ga0501032_0010530 | Ga0501032_0010530_900_1448 | 181 |
| 202 | 3300049569 | Ga0501032_0140327 | Ga0501032_0140327_46_600 | 181 |
| 203 | 3300049569 | Ga0501032_0182309 | Ga0501032_0182309_165_719 | 181 |
| 204 | 3300049570 | Ga0501033_0019550 | Ga0501033_0019550_1924_2472 | 181 |
| 205 | 3300049570 | Ga0501033_0024936 | Ga0501033_0024936_3940_4488 | 181 |
| 206 | 3300049570 | Ga0501033_0025454 | Ga0501033_0025454_555_1127 | 181 |
| 207 | 3300049570 | Ga0501033_0076428 | Ga0501033_0076428_1432_1986 | 181 |
| 208 | 3300049571 | Ga0501034_0079741 | Ga0501034_0079741_2293_2844 | 181 |
| 209 | 3300049571 | Ga0501034_0083622 | Ga0501034_0083622_1930_2484 | 181 |
| 210 | 3300049571 | Ga0501034_0183816 | Ga0501034_0183816_906_1454 | 181 |
| 211 | 3300049571 | Ga0501034_0291432 | Ga0501034_0291432_61_615 | 181 |
| 212 | 3300049571 | Ga0501034_0321416 | Ga0501034_0321416_821_1375 | 181 |
| 213 | 3300049571 | Ga0501034_0325570 | Ga0501034_0325570_732_1310 | 181 |
| 214 | 3300049571 | Ga0501034_0328704 | Ga0501034_0328704_625_1179 | 181 |
| 215 | 3300049571 | Ga0501034_0469424 | Ga0501034_0469424_88_642 | 181 |
| 216 | 3300049571 | Ga0501034_0833189 | Ga0501034_0833189_163_717 | 181 |
| 217 | 3300049572 | Ga0501036_0024599 | Ga0501036_0024599_3056_3604 | 181 |
| 218 | 3300049573 | Ga0501037_0024996 | Ga0501037_0024996_748_1302 | 181 |
| 219 | 3300049573 | Ga0501037_0104035 | Ga0501037_0104035_907_1455 | 181 |
| 220 | 3300049573 | Ga0501037_0357132 | Ga0501037_0357132_112_666 | 181 |
| 221 | 3300049574 | Ga0501038_0018400 | Ga0501038_0018400_2900_3454 | 181 |
| 222 | 3300049574 | Ga0501038_0047428 | Ga0501038_0047428_1664_2218 | 181 |
| 223 | 3300049574 | Ga0501038_0068123 | Ga0501038_0068123_1533_2081 | 181 |
| 224 | 3300049575 | Ga0501039_0155239 | Ga0501039_0155239_1094_1648 | 181 |
| 225 | 3300049576 | Ga0501040_0055882 | Ga0501040_0055882_1290_1874 | 181 |
| 226 | 3300049578 | Ga0501042_0000537 | Ga0501042_0000537_15451_15999 | 181 |
| 227 | 3300049579 | Ga0501043_0015227 | Ga0501043_0015227_2292_2840 | 181 |
| 228 | 3300049579 | Ga0501043_0016686 | Ga0501043_0016686_4909_5463 | 181 |
| 229 | 3300049580 | Ga0501046_0036327 | Ga0501046_0036327_2511_3059 | 181 |
| 230 | 3300049581 | Ga0501047_0024395 | Ga0501047_0024395_4980_5534 | 181 |
| 231 | 3300049581 | Ga0501047_0047612 | Ga0501047_0047612_2548_3096 | 181 |
| 232 | 3300049581 | Ga0501047_0050134 | Ga0501047_0050134_3024_3578 | 181 |
| 233 | 3300049581 | Ga0501047_0473774 | Ga0501047_0473774_186_758 | 181 |
| 234 | 3300049582 | Ga0501048_0035602 | Ga0501048_0035602_741_1289 | 181 |
| 235 | 3300049583 | Ga0501067_0189443 | Ga0501067_0189443_360_914 | 181 |
| 236 | 3300049583 | Ga0501067_0264223 | Ga0501067_0264223_82_636 | 181 |
| 237 | 3300049584 | Ga0501068_0316149 | Ga0501068_0316149_277_831 | 181 |
| 238 | 3300049586 | Ga0501070_0000367 | Ga0501070_0000367_1420_1974 | 181 |
| 239 | 3300049586 | Ga0501070_0017767 | Ga0501070_0017767_4674_5228 | 181 |
| 240 | 3300049586 | Ga0501070_0068378 | Ga0501070_0068378_2075_2623 | 181 |
| 241 | 3300049589 | Ga0501073_0000046 | Ga0501073_0000046_12023_12577 | 181 |
| 242 | 3300049589 | Ga0501073_0012557 | Ga0501073_0012557_1217_1765 | 181 |
| 243 | 3300049589 | Ga0501073_0023672 | Ga0501073_0023672_1966_2520 | 181 |
| 244 | 3300049589 | Ga0501073_0159750 | Ga0501073_0159750_540_1094 | 181 |
| 245 | 3300049590 | Ga0501074_0040793 | Ga0501074_0040793_1817_2371 | 181 |
| 246 | 3300049590 | Ga0501074_0098419 | Ga0501074_0098419_1246_1794 | 181 |
| 247 | 3300049593 | Ga0501077_0684159 | Ga0501077_0684159_47_601 | 181 |
| 248 | 3300049741 | Ga0501079_0345812 | Ga0501079_0345812_55_603 | 181 |
| 249 | 3300049742 | Ga0501080_0000085 | Ga0501080_0000085_47342_47896 | 181 |
| 250 | 3300049742 | Ga0501080_0073137 | Ga0501080_0073137_1771_2325 | 181 |
| 251 | 3300049742 | Ga0501080_0185440 | Ga0501080_0185440_559_1107 | 181 |
| 252 | 3300049742 | Ga0501080_0657395 | Ga0501080_0657395_39_593 | 181 |
| 253 | 3300049744 | Ga0501083_0000028 | Ga0501083_0000028_10736_11284 | 181 |
| 254 | 3300049744 | Ga0501083_0003278 | Ga0501083_0003278_6768_7322 | 181 |
| 255 | 3300049744 | Ga0501083_0132756 | Ga0501083_0132756_280_852 | 181 |
| 256 | 3300049822 | Ga0501035_0024097 | Ga0501035_0024097_3934_4482 | 181 |
| 257 | 3300049822 | Ga0501035_0177494 | Ga0501035_0177494_680_1228 | 181 |
| 258 | 3300049822 | Ga0501035_0178583 | Ga0501035_0178583_1118_1666 | 181 |
| 259 | 3300049822 | Ga0501035_0356118 | Ga0501035_0356118_462_1010 | 181 |
| 260 | 3300049822 | Ga0501035_0401678 | Ga0501035_0401678_555_1127 | 181 |
| 261 | 3300049822 | Ga0501035_0643960 | Ga0501035_0643960_77_631 | 181 |
| 262 | 3300049823 | Ga0501044_0024460 | Ga0501044_0024460_4918_5466 | 181 |
| 263 | 3300049823 | Ga0501044_0057159 | Ga0501044_0057159_459_1013 | 181 |
| 264 | 3300049823 | Ga0501044_0151665 | Ga0501044_0151665_1348_1896 | 181 |
| 265 | 3300049823 | Ga0501044_0283740 | Ga0501044_0283740_134_682 | 181 |
| 266 | 3300049823 | Ga0501044_0505695 | Ga0501044_0505695_181_753 | 181 |
| 267 | 3300049823 | Ga0501044_1104298 | Ga0501044_1104298_80_628 | 181 |
| 268 | 3300050491 | nmdc:mga00v17_27249_c1 | nmdc:mga00v17_27249_c1_137_691 | 181 |
| 269 | 3300050491 | nmdc:mga00v17_282699_c1 | nmdc:mga00v17_282699_c1_106_654 | 181 |
| 270 | 3300050491 | nmdc:mga00v17_411338_c1 | nmdc:mga00v17_411338_c1_170_721 | 181 |
| 271 | 3300050492 | nmdc:mga0yw44_41347_c1 | nmdc:mga0yw44_41347_c1_63_617 | 181 |
| 272 | 3300050516 | nmdc:mga0sz30_59374_c1 | nmdc:mga0sz30_59374_c1_78_632 | 181 |
| 273 | 3300053098 | Ga0500650_0079348 | Ga0500650_0079348_214_762 | 181 |
| 274 | 3300053102 | Ga0500554_030699 | Ga0500554_030699_686_1270 | 181 |
| 275 | 3300053104 | Ga0500556_0001137 | Ga0500556_0001137_6613_7167 | 181 |
| 276 | 3300053108 | Ga0500562_000646 | Ga0500562_000646_1612_2166 | 181 |
| 277 | 3300053117 | Ga0500593_000381 | Ga0500593_000381_12987_13541 | 181 |
| 278 | 3300053133 | Ga0500655_001381 | Ga0500655_001381_3237_3791 | 181 |
| 279 | 3300053136 | Ga0500559_0000202 | Ga0500559_0000202_46314_46862 | 181 |
| 280 | 3300053136 | Ga0500559_0000474 | Ga0500559_0000474_19827_20381 | 181 |
| 281 | 3300053136 | Ga0500559_0016426 | Ga0500559_0016426_446_1090 | 181 |
| 282 | 3300053136 | Ga0500559_0077623 | Ga0500559_0077623_910_1455 | 181 |
| 283 | 3300053139 | Ga0500568_0000051 | Ga0500568_0000051_89136_89690 | 181 |
| 284 | 3300053139 | Ga0500568_0002585 | Ga0500568_0002585_5781_6335 | 181 |
| 285 | 3300053139 | Ga0500568_0003104 | Ga0500568_0003104_7372_7926 | 181 |
| 286 | 3300053140 | Ga0500573_0000005 | Ga0500573_0000005_203671_204228 | 181 |
| 287 | 3300053140 | Ga0500573_0000437 | Ga0500573_0000437_5946_6509 | 181 |
| 288 | 3300053140 | Ga0500573_0003292 | Ga0500573_0003292_4285_4833 | 181 |
| 289 | 3300053140 | Ga0500573_0035538 | Ga0500573_0035538_1947_2495 | 181 |
| 290 | 3300053140 | Ga0500573_0075516 | Ga0500573_0075516_674_1225 | 181 |
| 291 | 3300053140 | Ga0500573_0082491 | Ga0500573_0082491_228_785 | 181 |
| 292 | 3300053140 | Ga0500573_0084151 | Ga0500573_0084151_688_1236 | 181 |
| 293 | 3300053140 | Ga0500573_0295582 | Ga0500573_0295582_132_707 | 181 |
| 294 | 3300053140 | Ga0500573_0438443 | Ga0500573_0438443_18_566 | 181 |
| 295 | 3300053142 | Ga0500577_0003399 | Ga0500577_0003399_1146_1694 | 181 |
| 296 | 3300053142 | Ga0500577_0008772 | Ga0500577_0008772_2046_2594 | 181 |
| 297 | 3300053142 | Ga0500577_0024618 | Ga0500577_0024618_939_1487 | 181 |
| 298 | 3300053153 | Ga0500616_0000010 | Ga0500616_0000010_433450_433998 | 181 |
| 299 | 3300053153 | Ga0500616_0005840 | Ga0500616_0005840_4521_5135 | 181 |
| 300 | 3300053155 | Ga0500620_000054 | Ga0500620_000054_13381_13935 | 181 |
| 301 | 3300053155 | Ga0500620_095514 | Ga0500620_095514_246_794 | 181 |
| 302 | 3300053730 | Ga0500645_005986 | Ga0500645_005986_1409_1957 | 181 |
| 303 | 3300054114 | Ga0501084_0671449 | Ga0501084_0671449_181_735 | 181 |
| 304 | 3300060353 | Ga0501082_0637405 | Ga0501082_0637405_297_851 | 181 |
| 305 | iso_pu_bacteria | 2808606372 | 2808900355 | 181 |
| 306 | iso_pu_bacteria | 2857479173 | 2857480240 | 181 |
| 307 | iso_pu_bacteria | 2857632687 | 2857632901 | 181 |
| 308 | iso_pu_bacteria | 2870801768 | 2870803612 | 181 |
| 309 | iso_pu_bacteria | 2870804320 | 2870805568 | 181 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hkf-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) | 0.9664 | 1 | 179 |
| 5hkl-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with inorganic phosphate | 0.9634 | 1 | 180 |
| 5hkf-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) | 0.9478 | 3 | 180 |
| 5hki-assembly2.cif.gz_C | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with fe(iii) dicitrate | 0.9377 | 3 | 180 |
| 5hkf-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) | 0.9366 | 3 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hkiC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9377 | 3 | 180 | 3.40.50.2020 |
| 5hkiC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9271 | 3 | 180 | 3.40.50.2020 |
| af_G5EDZ2_3_216_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8953 | 3 | 178 | 3.40.50.2020 |
| af_Q58509_1_175_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.895 | 1 | 181 | 3.40.50.2020 |
| af_Q58509_1_175_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8903 | 1 | 181 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A653SFQ7-F1-model_v4 | Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) | 0.9869 | 1 | 181 |
GO:0000287
GO:0004588 GO:0019856 GO:0044205 |
| AF-A0A1I2XPT4-F1-model_v4 | deleted | 0.985 | 2 | 181 |
|
| AF-A0A6L6E196-F1-model_v4 | Orotate phosphoribosyltransferase | 0.9831 | 107 | 181 |
GO:0004588
GO:0006222 GO:0019856 |
| AF-A0A653SFQ7-F1-model_v4 | Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) | 0.9815 | 1 | 181 |
GO:0000287
GO:0004588 GO:0019856 GO:0044205 |
| AF-A0A1I2XPT4-F1-model_v4 | deleted | 0.9742 | 2 | 181 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar