F400499

General Info

Members Datasets Scaffolds Average Seq Length
310 225 165 237

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10017579|JGI25151J46595_100175793
Length 234
Sequence MAKTKEEHVHEVFESISQSYDKMNGVISFQMHVGWRNDTMKRMAVKPGAKALDVCCGTADWTIALAEAVGEGGEVKGVDFSKNMLKVGEQKVKPYPQIELIHGNAMELPFPDNTFDYVTIGFGLRNVPDYIQVLKEMNRVVKPGGMVVCLETSQPEIPGYRQLFRFYFKYIMPVFGKIFAKSFKEYSWLQESANDFPGMKKLAAMFEQAGLEKVTYKAYSGGAAAMHMGFKKVR

Samples

Sample ID Description Type Environment
1 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
2 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
3 2554235283 Bacillus safensis VK Isolate Rhizosphere
4 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
5 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
6 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
7 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
8 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
9 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
10 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
11 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
12 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
13 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
14 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
15 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
16 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
17 2643221729 Bacillus sp. Root11 Isolate Unclassified
18 2643221730 Bacillus sp. Root131 Isolate Unclassified
19 2643221735 Bacillus sp. Root920 Isolate Unclassified
20 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
21 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
22 2684622632 Bacillus cereus 905 Isolate Unclassified
23 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
24 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
25 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
26 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
27 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
28 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
29 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
30 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
31 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
32 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
33 2738541295 Bacillus sp. OK085 Isolate Unclassified
34 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
35 2738541358 Bacillus sp. OV752 Isolate Unclassified
36 2738543006 Bacillus sp. OK077 Isolate Unclassified
37 2738543017 Bacillus sp. OV186 Isolate Unclassified
38 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
39 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
40 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
41 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
42 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
43 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
44 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
45 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
46 2811994870 Bacillus sp. JB4 Isolate Unclassified
47 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
48 2818991441 Niallia circulans 3243 Isolate Rhizosphere
49 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
50 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
51 2818991459 Paenibacillus sp. 597 Isolate Unclassified
52 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
53 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
54 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
55 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
56 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
57 2857472729 Cohnella sp. R-74144 Isolate Unclassified
58 2857586860 Bacillus sp. R-71935 Isolate Unclassified
59 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
60 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
61 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
62 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
63 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
64 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
65 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
66 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
67 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
68 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
69 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
70 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
71 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
72 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
73 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
74 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
75 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
76 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
77 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
78 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
79 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
80 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
81 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
82 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
83 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
84 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
85 2919726948 Bacillus pumilus 4489 Isolate Unclassified
86 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
87 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
88 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
89 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
90 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
91 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
92 2938917290 Bacillus sp. CR71 Isolate Unclassified
93 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
94 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
95 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
96 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
97 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
98 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
99 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
100 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
101 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
102 2965761152 Bacillus sp. COPE52 Isolate Unclassified
103 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
104 2969141011 Bacillus velezensis MH25 Isolate Unclassified
105 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
106 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
107 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
108 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
109 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
110 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
111 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
112 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
113 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
114 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
115 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
116 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
117 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
118 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
119 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
120 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
121 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
122 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
123 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
124 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
125 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
126 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
127 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
128 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
129 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
130 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
131 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
132 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
133 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
134 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
135 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
136 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
159 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
160 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
188 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
205 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
206 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
207 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
208 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
209 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
210 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
211 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
212 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
213 8022792930 Bacillus sp. Xin Isolate Rhizosphere
214 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
215 8023438354 Bacillus sp. BH2 Isolate Unclassified
216 8023444577 Bacillus sp. BH32 Isolate Unclassified
217 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
218 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
219 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
220 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
221 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
222 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
223 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
224 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
225 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 40.65
Metatranscriptomes 12.58
Isolates 46.77

Biome Distribution

Category Percentage (%)
Aerial Root 0.65
Bulb 0
Endosphere 15.81
Nodule 0
Rhizoplane 2.58
Rhizosphere 48.39
Stem 0
Stem Tuber 0
Unclassified 32.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1003968 3300002987 Bacteria 5046
2 JGI25159J45721_1006235 3300002987 Bacteria 3604
3 JGI25151J46595_10000006 3300003187 Bacteria 419711
4 JGI25151J46595_10000029 3300003187 Bacteria 205878
5 JGI25151J46595_10002407 3300003187 Bacteria 11303
6 JGI25151J46595_10017579 3300003187 Bacteria 3095
7 JGI25151J46595_10026689 3300003187 Bacteria 2326
8 JGI25151J46595_10026822 3300003187 Bacteria 2318
9 JGI25151J46595_10027147 3300003187 Bacteria 2300
10 JGI25151J46595_10039777 3300003187 Bacteria 1731
11 JGI25151J46595_10039819 3300003187 Bacteria 1730
12 JGI25151J46595_10093834 3300003187 Bacteria 827
13 Ga0006562J51391_1001112 3300003578 Bacteria 17420
14 Ga0006562J51391_1010378 3300003578 Bacteria 1897
15 Ga0055538_1000103 3300003751 Bacteria 67925
16 Ga0055538_1000127 3300003751 Bacteria 57318
17 Ga0055532_1000079 3300003758 Bacteria 121008
18 Ga0055532_1000216 3300003758 Bacteria 45278
19 Ga0105251_10069700 3300009011 Bacteria 1639
20 Ga0105244_10005982 3300009036 Bacteria 7969
21 Ga0105244_10022416 3300009036 Bacteria 3476
22 Ga0105244_10025244 3300009036 Bacteria 3232
23 Ga0105244_10045021 3300009036 Bacteria 2271
24 Ga0105244_10067808 3300009036 Bacteria 1784
25 Ga0105244_10185703 3300009036 Bacteria 985
26 Ga0105250_10011142 3300009092 Bacteria 3734
27 Ga0105250_10012481 3300009092 Bacteria 3507
28 Ga0105250_10024020 3300009092 Bacteria 2457
29 Ga0105250_10029503 3300009092 Bacteria 2207
30 Ga0105246_10039959 3300011119 Bacteria 3163
31 Ga0209784_100031 3300025224 Bacteria 318854
32 Ga0209784_100046 3300025224 Bacteria 200009
33 Ga0209566_100015 3300025225 Bacteria 457963
34 Ga0209566_100090 3300025225 Bacteria 141829
35 Ga0209566_100711 3300025225 Bacteria 19035
36 Ga0209147_100014 3300025229 Bacteria 597841
37 Ga0209147_109833 3300025229 Bacteria 1118
38 Ga0209437_101024 3300025233 Bacteria 9545
39 Ga0209258_101447 3300025242 Bacteria 8320
40 Ga0209130_1006106 3300025284 Bacteria 3984
41 Ga0209130_1007059 3300025284 Bacteria 3528
42 Ga0209130_1007468 3300025284 Bacteria 3368
43 Ga0209130_1029587 3300025284 Bacteria 1139
44 Ga0209675_1019834 3300025291 Bacteria 1839
45 Ga0209676_1002209 3300025292 Bacteria 14520
46 Ga0209676_1007839 3300025292 Bacteria 4910
47 Ga0209676_1042997 3300025292 Bacteria 1250
48 Ga0209676_1060399 3300025292 Bacteria 946
49 Ga0209025_1000001 3300025294 Bacteria 1888151
50 Ga0209025_1000041 3300025294 Bacteria 373694
51 Ga0209025_1002108 3300025294 Bacteria 22452
52 Ga0209025_1002373 3300025294 Bacteria 20153
53 Ga0209025_1004501 3300025294 Bacteria 12052
54 Ga0209025_1008472 3300025294 Bacteria 7395
55 Ga0209025_1008832 3300025294 Bacteria 7157
56 Ga0209025_1010217 3300025294 Bacteria 6397
57 Ga0209025_1014924 3300025294 Bacteria 4731
58 Ga0209025_1018285 3300025294 Bacteria 3987
59 Ga0209025_1019397 3300025294 Bacteria 3783
60 Ga0209025_1022975 3300025294 Bacteria 3283
61 Ga0209025_1045564 3300025294 Bacteria 1816
62 Ga0209025_1057955 3300025294 Bacteria 1475
63 Ga0209025_1066430 3300025294 Bacteria 1310
64 Ga0207696_1070503 3300025711 Bacteria 972
65 Ga0207655_1000925 3300025728 Bacteria 30529
66 Ga0207655_1058936 3300025728 Bacteria 1497
67 Ga0209974_10014038 3300027876 Bacteria 2668
68 Ga0237817_10548 3300030083 Bacteria 4421
69 Ga0307405_10086737 3300031731 Bacteria 2061
70 Ga0307409_100011503 3300031995 Bacteria 5586
71 Ga0307416_100154625 3300032002 Bacteria 2110
72 Ga0395899_0046447 3300037312 Bacteria 3235
73 Ga0395900_0818921 3300037418 Bacteria 858
74 Ga0237819_02605 3300038705 Bacteria 3540
75 Ga0237819_02613 3300038705 Bacteria 3534
76 Ga0439436_0010778 3300041404 Bacteria 2785
77 Ga0439439_0002364 3300041406 Bacteria 3995
78 Ga0439433_0002233 3300041999 Bacteria 4089
79 Ga0439462_0001311 3300042015 Bacteria 5472
80 Ga0466967_0001012 3300045976 Bacteria 15385
81 Ga0495590_0024585 3300046457 Bacteria 2122
82 Ga0495661_0073082 3300046665 Bacteria 1999
83 Ga0495660_0012037 3300046810 Bacteria 5018
84 Ga0495660_0041031 3300046810 Bacteria 2564
85 Ga0496102_0165356 3300048905 Bacteria 2082
86 Ga0496102_0307011 3300048905 Bacteria 1495
87 Ga0496103_0259047 3300048906 Bacteria 1119
88 Ga0496106_0561449 3300048909 Bacteria 916
89 Ga0496112_0069542 3300048915 Bacteria 3478
90 Ga0496113_0380301 3300048916 Bacteria 1133
91 Ga0496116_0004021 3300048919 Bacteria 14259
92 Ga0496116_0024178 3300048919 Bacteria 4499
93 Ga0496116_0035619 3300048919 Bacteria 3493
94 Ga0496116_0055292 3300048919 Bacteria 2608
95 Ga0496116_0066345 3300048919 Bacteria 2309
96 Ga0496116_0149363 3300048919 Bacteria 1301
97 Ga0496116_0203178 3300048919 Bacteria 1035
98 Ga0496117_0004206 3300048920 Bacteria 16068
99 Ga0496117_0006963 3300048920 Bacteria 11211
100 Ga0496118_0040247 3300048921 Bacteria 3718
101 Ga0496119_0000221 3300048922 Bacteria 79912
102 Ga0496119_0004974 3300048922 Bacteria 12981
103 Ga0496120_0000045 3300048923 Bacteria 191663
104 Ga0496120_0004419 3300048923 Bacteria 11799
105 Ga0496121_0083739 3300048924 Bacteria 2517
106 Ga0496121_0100859 3300048924 Bacteria 2228
107 Ga0496122_0017645 3300048925 Bacteria 6656
108 Ga0496122_0037304 3300048925 Bacteria 3914
109 Ga0496122_0039842 3300048925 Bacteria 3741
110 Ga0496122_0078388 3300048925 Bacteria 2314
111 Ga0496123_0007304 3300048926 Bacteria 10478
112 Ga0496123_0044425 3300048926 Bacteria 3038
113 Ga0496124_0000657 3300048927 Bacteria 57039
114 Ga0496124_0000694 3300048927 Bacteria 55198
115 Ga0496124_0038261 3300048927 Bacteria 4167
116 Ga0496124_0201863 3300048927 Bacteria 1511
117 Ga0496125_0002232 3300048928 Bacteria 25769
118 Ga0496125_0071661 3300048928 Bacteria 2705
119 Ga0496125_0095054 3300048928 Bacteria 2218
120 Ga0496126_0010054 3300048929 Bacteria 9982
121 Ga0496126_0085954 3300048929 Bacteria 2772
122 Ga0496126_0089602 3300048929 Bacteria 2707
123 Ga0501306_003396 3300049127 Bacteria 1712
124 Ga0501310_019912 3300049130 Bacteria 829
125 Ga0501341_04259 3300049131 Bacteria 832
126 Ga0501343_000271 3300049132 Bacteria 2833
127 Ga0501343_000579 3300049132 Bacteria 2203
128 Ga0501343_001018 3300049132 Bacteria 1826
129 Ga0501344_00215 3300049133 Bacteria 2134
130 Ga0501305_002772 3300049161 Bacteria 1924
131 Ga0501290_002983 3300049513 Bacteria 2153
132 Ga0501311_001574 3300049527 Bacteria 2020
133 Ga0501312_000363 3300049528 Bacteria 3468
134 Ga0501312_001031 3300049528 Bacteria 2591
135 Ga0501312_001511 3300049528 Bacteria 2305
136 Ga0501312_018570 3300049528 Bacteria 1014
137 Ga0501313_000921 3300049529 Bacteria 2305
138 Ga0501313_001500 3300049529 Bacteria 2050
139 Ga0501314_001807 3300049530 Bacteria 1590
140 Ga0501315_001514 3300049531 Bacteria 2015
141 Ga0501315_002270 3300049531 Bacteria 1783
142 Ga0501315_019874 3300049531 Bacteria 897
143 Ga0501316_000629 3300049532 Bacteria 2577
144 Ga0501317_000165 3300049533 Bacteria 3794
145 Ga0501317_000596 3300049533 Bacteria 2663
146 Ga0501317_000971 3300049533 Bacteria 2308
147 Ga0501317_007488 3300049533 Bacteria 1233
148 Ga0501318_000407 3300049534 Bacteria 2669
149 Ga0501318_000520 3300049534 Bacteria 2504
150 Ga0501321_000145 3300049537 Bacteria 3703
151 Ga0501323_009618 3300049539 Bacteria 1142
152 Ga0501331_03228 3300049547 Bacteria 872
153 Ga0501331_03781 3300049547 Bacteria 825
154 Ga0501333_000133 3300049549 Bacteria 2686
155 Ga0501335_000426 3300049551 Bacteria 2655
156 Ga0501336_001806 3300049552 Bacteria 1321
157 Ga0501336_005007 3300049552 Bacteria 946
158 Ga0501337_000533 3300049553 Bacteria 1896
159 Ga0501338_00829 3300049554 Bacteria 1518
160 Ga0501338_01195 3300049554 Bacteria 1349
161 Ga0501198_011230 3300049649 Bacteria 1334
162 Ga0501208_005536 3300049655 Bacteria 1558
163 Ga0501217_000737 3300049661 Bacteria 5654
164 Ga0501234_010859 3300049707 Bacteria 1420
165 Ga0501279_012633 3300049775 Bacteria 1150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049528 Ga0501312_018570 Ga0501312_018570_42_656 202
2 3300049130 Ga0501310_019912 Ga0501310_019912_149_787 212
3 3300049547 Ga0501331_03781 Ga0501331_03781_22_660 212
4 3300048909 Ga0496106_0561449 Ga0496106_0561449_27_698 223
5 3300049131 Ga0501341_04259 Ga0501341_04259_10_681 223
6 3300049533 Ga0501317_007488 Ga0501317_007488_26_697 223
7 3300049547 Ga0501331_03228 Ga0501331_03228_30_701 223
8 3300049552 Ga0501336_005007 Ga0501336_005007_26_697 223
9 iso_pu_bacteria 2964375228 2964377181 227
10 iso_pu_bacteria 2816332295 2817480513 228
11 iso_pu_bacteria 2852673933 2852675279 228
12 iso_pu_bacteria 2928510474 2928513913 228
13 iso_pu_bacteria 3006858327 3006860859 228
14 iso_pu_bacteria 2545555800 2545556732 229
15 iso_pu_bacteria 2576861599 2578930981 229
16 iso_pu_bacteria 2630968484 2631984356 229
17 iso_pu_bacteria 2648501850 2651532075 229
18 iso_pu_bacteria 2671180844 2674419151 229
19 iso_pu_bacteria 2695420354 2695628024 229
20 iso_pu_bacteria 2716884898 2717916262 229
21 iso_pu_bacteria 2738541299 2738840272 229
22 iso_pu_bacteria 2808606364 2808869222 229
23 iso_pu_bacteria 2818991441 2819569589 229
24 iso_pu_bacteria 2857604169 2857604278 229
25 iso_pu_bacteria 2857609550 2857610935 229
26 iso_pu_bacteria 2877768649 2877770928 229
27 iso_pu_bacteria 2880169592 2880171793 229
28 iso_pu_bacteria 2897109615 2897112018 229
29 iso_pu_bacteria 2904560550 2904561883 229
30 iso_pu_bacteria 2969141011 2969143375 229
31 iso_pu_bacteria 2971893375 2971895573 229
32 iso_pu_bacteria 3006973921 3006975654 229
33 iso_pu_bacteria 8022630665 8022633628 229
34 iso_pu_bacteria 8022948649 8022949624 229
35 iso_pu_bacteria 8051952484 8051955487 229
36 iso_pu_bacteria 8052174270 8052176800 229
37 iso_pu_bacteria 2554235283 2555467448 230
38 iso_pu_bacteria 2643221735 2644740622 230
39 iso_pu_bacteria 2684623153 2686997274 230
40 iso_pu_bacteria 2687453109 2687498581 230
41 iso_pu_bacteria 2738541295 2738814273 230
42 iso_pu_bacteria 2788500588 2791212708 230
43 iso_pu_bacteria 2811994870 2812316466 230
44 iso_pu_bacteria 2818991451 2819626853 230
45 iso_pu_bacteria 2818991468 2819723535 230
46 iso_pu_bacteria 2823526263 2823528447 230
47 iso_pu_bacteria 2904113452 2904118289 230
48 iso_pu_bacteria 2904606771 2904606970 230
49 iso_pu_bacteria 2908665501 2908668348 230
50 iso_pu_bacteria 2919093281 2919096117 230
51 iso_pu_bacteria 2919414237 2919415235 230
52 iso_pu_bacteria 2919726948 2919728165 230
53 iso_pu_bacteria 2939593269 2939595415 230
54 iso_pu_bacteria 2954773129 2954774037 230
55 iso_pu_bacteria 2977254563 2977256808 230
56 iso_pu_bacteria 2990275345 2990277683 230
57 iso_pu_bacteria 3001272096 3001273685 230
58 iso_pu_bacteria 3001892409 3001898002 230
59 iso_pu_bacteria 8055531788 8055533445 230
60 iso_pu_bacteria 8055632911 8055635619 230
61 iso_pu_bacteria 3006978542 3006981557 231
62 iso_pu_bacteria 2593339131 2595087744 232
63 iso_pu_bacteria 2757320391 2757565730 232
64 iso_pu_bacteria 2775507177 2777761349 232
65 iso_pu_bacteria 2775507192 2777838820 232
66 iso_pu_bacteria 2791355222 2793184490 232
67 iso_pu_bacteria 2857586860 2857587425 232
68 iso_pu_bacteria 2936340661 2936341603 232
69 3300025229 Ga0209147_109833 Ga0209147_1098331 233
70 3300025292 Ga0209676_1042997 Ga0209676_10429971 233
71 3300046665 Ga0495661_0073082 Ga0495661_0073082_1138_1878 233
72 3300048905 Ga0496102_0165356 Ga0496102_0165356_1076_1777 233
73 3300048919 Ga0496116_0035619 Ga0496116_0035619_513_1232 233
74 3300048920 Ga0496117_0006963 Ga0496117_0006963_5565_6284 233
75 3300048922 Ga0496119_0000221 Ga0496119_0000221_25204_25923 233
76 3300048923 Ga0496120_0000045 Ga0496120_0000045_80589_81308 233
77 3300048925 Ga0496122_0017645 Ga0496122_0017645_2033_2752 233
78 3300048927 Ga0496124_0000694 Ga0496124_0000694_8547_9266 233
79 3300048929 Ga0496126_0010054 Ga0496126_0010054_4018_4737 233
80 3300048929 Ga0496126_0085954 Ga0496126_0085954_65_784 233
81 3300049649 Ga0501198_011230 Ga0501198_011230_255_956 233
82 iso_pu_bacteria 2551306519 2553391652 233
83 iso_pu_bacteria 2643221729 2644704006 233
84 iso_pu_bacteria 2643221730 2644708699 233
85 iso_pu_bacteria 2684622632 2685149436 233
86 iso_pu_bacteria 2695420987 2698323744 233
87 iso_pu_bacteria 2703719227 2705993482 233
88 iso_pu_bacteria 2718218445 2721504816 233
89 iso_pu_bacteria 2738541358 2739156214 233
90 iso_pu_bacteria 2738543006 2739210847 233
91 iso_pu_bacteria 2818991443 2819579417 233
92 iso_pu_bacteria 2865002811 2865003688 233
93 iso_pu_bacteria 2888578766 2888581168 233
94 iso_pu_bacteria 2889295896 2889297172 233
95 iso_pu_bacteria 2929233124 2929234711 233
96 iso_pu_bacteria 2938917290 2938918885 233
97 iso_pu_bacteria 2947426588 2947428257 233
98 iso_pu_bacteria 2956897341 2956898072 233
99 iso_pu_bacteria 2965761152 2965762750 233
100 iso_pu_bacteria 2979083700 2979085182 233
101 iso_pu_bacteria 2981284811 2981285651 233
102 iso_pu_bacteria 2981289755 2981290598 233
103 iso_pu_bacteria 2981980479 2981980779 233
104 iso_pu_bacteria 2981985349 2981985657 233
105 iso_pu_bacteria 3006984091 3006984797 233
106 iso_pu_bacteria 8022621104 8022622680 233
107 iso_pu_bacteria 8022792930 8022798111 233
108 iso_pu_bacteria 8023438354 8023442435 233
109 iso_pu_bacteria 8023444577 8023447969 233
110 iso_pu_bacteria 8057582654 8057584266 233
111 3300003187 JGI25151J46595_10000006 JGI25151J46595_10000006166 234
112 3300003187 JGI25151J46595_10000029 JGI25151J46595_10000029202 234
113 3300003187 JGI25151J46595_10017579 JGI25151J46595_100175793 234
114 3300003578 Ga0006562J51391_1001112 Ga0006562J51391_10011126 234
115 3300003578 Ga0006562J51391_1010378 Ga0006562J51391_10103782 234
116 3300003751 Ga0055538_1000127 Ga0055538_100012759 234
117 3300025224 Ga0209784_100031 Ga0209784_100031150 234
118 3300025292 Ga0209676_1007839 Ga0209676_10078393 234
119 3300025292 Ga0209676_1060399 Ga0209676_10603991 234
120 3300025294 Ga0209025_1000001 Ga0209025_1000001829 234
121 3300025294 Ga0209025_1010217 Ga0209025_10102175 234
122 3300025294 Ga0209025_1018285 Ga0209025_10182852 234
123 3300025294 Ga0209025_1022975 Ga0209025_10229752 234
124 3300025294 Ga0209025_1057955 Ga0209025_10579552 234
125 3300031731 Ga0307405_10086737 Ga0307405_100867372 234
126 3300031995 Ga0307409_100011503 Ga0307409_1000115032 234
127 3300032002 Ga0307416_100154625 Ga0307416_1001546252 234
128 3300046810 Ga0495660_0041031 Ga0495660_0041031_556_1260 234
129 3300048915 Ga0496112_0069542 Ga0496112_0069542_1376_2080 234
130 3300048916 Ga0496113_0380301 Ga0496113_0380301_55_759 234
131 3300048919 Ga0496116_0149363 Ga0496116_0149363_385_1089 234
132 3300049127 Ga0501306_003396 Ga0501306_003396_527_1231 234
133 3300049132 Ga0501343_000271 Ga0501343_000271_155_859 234
134 3300049132 Ga0501343_000579 Ga0501343_000579_1322_2062 234
135 3300049132 Ga0501343_001018 Ga0501343_001018_855_1559 234
136 3300049133 Ga0501344_00215 Ga0501344_00215_145_849 234
137 3300049161 Ga0501305_002772 Ga0501305_002772_1067_1807 234
138 3300049513 Ga0501290_002983 Ga0501290_002983_373_1077 234
139 3300049527 Ga0501311_001574 Ga0501311_001574_158_898 234
140 3300049528 Ga0501312_000363 Ga0501312_000363_1746_2450 234
141 3300049528 Ga0501312_001031 Ga0501312_001031_1758_2498 234
142 3300049528 Ga0501312_001511 Ga0501312_001511_996_1700 234
143 3300049529 Ga0501313_000921 Ga0501313_000921_1156_1896 234
144 3300049529 Ga0501313_001500 Ga0501313_001500_350_1054 234
145 3300049530 Ga0501314_001807 Ga0501314_001807_527_1231 234
146 3300049531 Ga0501315_001514 Ga0501315_001514_314_1018 234
147 3300049531 Ga0501315_002270 Ga0501315_002270_873_1613 234
148 3300049531 Ga0501315_019874 Ga0501315_019874_159_863 234
149 3300049532 Ga0501316_000629 Ga0501316_000629_155_895 234
150 3300049533 Ga0501317_000165 Ga0501317_000165_1629_2333 234
151 3300049533 Ga0501317_000596 Ga0501317_000596_1809_2549 234
152 3300049533 Ga0501317_000971 Ga0501317_000971_999_1703 234
153 3300049534 Ga0501318_000407 Ga0501318_000407_169_909 234
154 3300049534 Ga0501318_000520 Ga0501318_000520_380_1084 234
155 3300049537 Ga0501321_000145 Ga0501321_000145_413_1153 234
156 3300049539 Ga0501323_009618 Ga0501323_009618_292_996 234
157 3300049549 Ga0501333_000133 Ga0501333_000133_1743_2483 234
158 3300049551 Ga0501335_000426 Ga0501335_000426_1804_2544 234
159 3300049552 Ga0501336_001806 Ga0501336_001806_532_1236 234
160 3300049553 Ga0501337_000533 Ga0501337_000533_985_1725 234
161 3300049554 Ga0501338_00829 Ga0501338_00829_96_800 234
162 3300049554 Ga0501338_01195 Ga0501338_01195_437_1177 234
163 3300049707 Ga0501234_010859 Ga0501234_010859_103_807 234
164 3300049775 Ga0501279_012633 Ga0501279_012633_374_1078 234
165 iso_pu_bacteria 2857472729 2857473980 234
166 iso_pu_bacteria 2919425241 2919431554 234
167 iso_pu_bacteria 2925326138 2925331731 234
168 iso_pu_bacteria 2984527788 2984530068 234
169 iso_pu_bacteria 2984532647 2984536174 234
170 iso_pu_bacteria 3006988479 3006989143 234
171 3300025284 Ga0209130_1007468 Ga0209130_10074683 235
172 3300025294 Ga0209025_1002373 Ga0209025_100237310 235
173 3300037418 Ga0395900_0818921 Ga0395900_0818921_111_827 235
174 3300041404 Ga0439436_0010778 Ga0439436_0010778_207_923 235
175 3300041406 Ga0439439_0002364 Ga0439439_0002364_2318_3034 235
176 3300041999 Ga0439433_0002233 Ga0439433_0002233_1977_2693 235
177 3300042015 Ga0439462_0001311 Ga0439462_0001311_4005_4721 235
178 3300048925 Ga0496122_0037304 Ga0496122_0037304_1511_2230 235
179 3300048926 Ga0496123_0007304 Ga0496123_0007304_7166_7885 235
180 3300048927 Ga0496124_0000657 Ga0496124_0000657_41313_42032 235
181 3300048928 Ga0496125_0002232 Ga0496125_0002232_15236_15955 235
182 iso_pu_bacteria 2593339198 2595315555 235
183 3300003187 JGI25151J46595_10002407 JGI25151J46595_100024073 236
184 3300003187 JGI25151J46595_10039777 JGI25151J46595_100397772 236
185 3300003187 JGI25151J46595_10039819 JGI25151J46595_100398192 236
186 3300003751 Ga0055538_1000103 Ga0055538_10001035 236
187 3300003758 Ga0055532_1000079 Ga0055532_1000079138 236
188 3300003758 Ga0055532_1000216 Ga0055532_10002168 236
189 3300009036 Ga0105244_10005982 Ga0105244_100059826 236
190 3300009036 Ga0105244_10067808 Ga0105244_100678082 236
191 3300011119 Ga0105246_10039959 Ga0105246_100399594 236
192 3300025224 Ga0209784_100046 Ga0209784_1000466 236
193 3300025225 Ga0209566_100015 Ga0209566_100015179 236
194 3300025225 Ga0209566_100090 Ga0209566_100090105 236
195 3300025225 Ga0209566_100711 Ga0209566_10071115 236
196 3300025229 Ga0209147_100014 Ga0209147_100014521 236
197 3300025233 Ga0209437_101024 Ga0209437_1010249 236
198 3300025242 Ga0209258_101447 Ga0209258_1014472 236
199 3300025284 Ga0209130_1029587 Ga0209130_10295872 236
200 3300025291 Ga0209675_1019834 Ga0209675_10198342 236
201 3300025292 Ga0209676_1002209 Ga0209676_100220910 236
202 3300025294 Ga0209025_1000041 Ga0209025_1000041406 236
203 3300025294 Ga0209025_1008472 Ga0209025_10084728 236
204 3300025294 Ga0209025_1008832 Ga0209025_10088326 236
205 3300025294 Ga0209025_1014924 Ga0209025_10149244 236
206 3300025294 Ga0209025_1066430 Ga0209025_10664302 236
207 3300037312 Ga0395899_0046447 Ga0395899_0046447_44_778 236
208 3300046457 Ga0495590_0024585 Ga0495590_0024585_140_892 236
209 3300046810 Ga0495660_0012037 Ga0495660_0012037_2103_2855 236
210 3300048905 Ga0496102_0307011 Ga0496102_0307011_486_1196 236
211 3300048906 Ga0496103_0259047 Ga0496103_0259047_187_897 236
212 3300048919 Ga0496116_0004021 Ga0496116_0004021_7669_8397 236
213 3300048919 Ga0496116_0024178 Ga0496116_0024178_1411_2130 236
214 3300048919 Ga0496116_0055292 Ga0496116_0055292_1609_2337 236
215 3300048919 Ga0496116_0066345 Ga0496116_0066345_1467_2195 236
216 3300048919 Ga0496116_0203178 Ga0496116_0203178_179_922 236
217 3300048920 Ga0496117_0004206 Ga0496117_0004206_6229_6957 236
218 3300048921 Ga0496118_0040247 Ga0496118_0040247_533_1261 236
219 3300048922 Ga0496119_0004974 Ga0496119_0004974_8417_9145 236
220 3300048923 Ga0496120_0004419 Ga0496120_0004419_4003_4731 236
221 3300048924 Ga0496121_0083739 Ga0496121_0083739_305_1024 236
222 3300048924 Ga0496121_0100859 Ga0496121_0100859_522_1250 236
223 3300048925 Ga0496122_0039842 Ga0496122_0039842_123_851 236
224 3300048925 Ga0496122_0078388 Ga0496122_0078388_1112_1855 236
225 3300048926 Ga0496123_0044425 Ga0496123_0044425_828_1556 236
226 3300048927 Ga0496124_0038261 Ga0496124_0038261_1425_2153 236
227 3300048927 Ga0496124_0201863 Ga0496124_0201863_149_877 236
228 3300048928 Ga0496125_0071661 Ga0496125_0071661_1573_2301 236
229 3300048928 Ga0496125_0095054 Ga0496125_0095054_481_1209 236
230 3300048929 Ga0496126_0089602 Ga0496126_0089602_84_812 236
231 3300049655 Ga0501208_005536 Ga0501208_005536_723_1442 236
232 3300049661 Ga0501217_000737 Ga0501217_000737_2141_2860 236
233 iso_pu_bacteria 2563366752 2563928985 236
234 iso_pu_bacteria 2571042143 2571533532 236
235 iso_pu_bacteria 2571042588 2573039519 236
236 iso_pu_bacteria 2579778775 2580930043 236
237 iso_pu_bacteria 2585428059 2587738715 236
238 iso_pu_bacteria 2600255286 2601638791 236
239 iso_pu_bacteria 2619619294 2621276051 236
240 iso_pu_bacteria 2643221543 2643738364 236
241 iso_pu_bacteria 2643221676 2644421709 236
242 iso_pu_bacteria 2721755693 2723604632 236
243 iso_pu_bacteria 2728368933 2728529572 236
244 iso_pu_bacteria 2728369359 2730135272 236
245 iso_pu_bacteria 2738543017 2739270051 236
246 iso_pu_bacteria 2751185905 2753809919 236
247 iso_pu_bacteria 2802428803 2802436893 236
248 iso_pu_bacteria 2818991459 2819669227 236
249 iso_pu_bacteria 2821111986 2821114329 236
250 iso_pu_bacteria 2857453340 2857453803 236
251 iso_pu_bacteria 2864733723 2864737421 236
252 iso_pu_bacteria 2881636855 2881636942 236
253 iso_pu_bacteria 2885526491 2885527785 236
254 iso_pu_bacteria 2889042446 2889046435 236
255 iso_pu_bacteria 2889276214 2889280538 236
256 iso_pu_bacteria 2904162308 2904163574 236
257 iso_pu_bacteria 2904490793 2904493338 236
258 iso_pu_bacteria 2904595352 2904595529 236
259 iso_pu_bacteria 2904755435 2904762075 236
260 iso_pu_bacteria 2907202186 2907205221 236
261 iso_pu_bacteria 2919160200 2919162630 236
262 iso_pu_bacteria 2931384279 2931389884 236
263 iso_pu_bacteria 2938649242 2938651817 236
264 iso_pu_bacteria 2939679117 2939680728 236
265 iso_pu_bacteria 2939702853 2939705282 236
266 iso_pu_bacteria 2945991243 2945991424 236
267 iso_pu_bacteria 2946053406 2946054120 236
268 iso_pu_bacteria 2968558590 2968562853 236
269 iso_pu_bacteria 2971403814 2971407832 236
270 iso_pu_bacteria 2971410472 2971417092 236
271 iso_pu_bacteria 2971511577 2971512313 236
272 iso_pu_bacteria 2980176882 2980177409 236
273 iso_pu_bacteria 2988225383 2988231984 236
274 iso_pu_bacteria 2996632988 2996638173 236
275 iso_pu_bacteria 2996706504 2996709075 236
276 iso_pu_bacteria 648028048 648170675 236
277 iso_pu_bacteria 8002317523 8002323763 236
278 iso_pu_bacteria 8046991243 8046998777 236
279 iso_pu_bacteria 8054465665 8054469568 236
280 iso_pu_bacteria 8056533031 8056536496 236
281 iso_pu_bacteria 8057733483 8057739506 236
282 3300002987 JGI25159J45721_1003968 JGI25159J45721_10039683 237
283 3300002987 JGI25159J45721_1006235 JGI25159J45721_10062353 237
284 3300003187 JGI25151J46595_10026689 JGI25151J46595_100266893 237
285 3300003187 JGI25151J46595_10026822 JGI25151J46595_100268223 237
286 3300003187 JGI25151J46595_10027147 JGI25151J46595_100271473 237
287 3300003187 JGI25151J46595_10093834 JGI25151J46595_100938341 237
288 3300009011 Ga0105251_10069700 Ga0105251_100697001 237
289 3300009036 Ga0105244_10022416 Ga0105244_100224162 237
290 3300009036 Ga0105244_10025244 Ga0105244_100252442 237
291 3300009036 Ga0105244_10045021 Ga0105244_100450212 237
292 3300009036 Ga0105244_10185703 Ga0105244_101857032 237
293 3300009092 Ga0105250_10011142 Ga0105250_100111423 237
294 3300009092 Ga0105250_10012481 Ga0105250_100124812 237
295 3300009092 Ga0105250_10024020 Ga0105250_100240203 237
296 3300009092 Ga0105250_10029503 Ga0105250_100295033 237
297 3300025284 Ga0209130_1006106 Ga0209130_10061064 237
298 3300025284 Ga0209130_1007059 Ga0209130_10070593 237
299 3300025294 Ga0209025_1002108 Ga0209025_100210825 237
300 3300025294 Ga0209025_1004501 Ga0209025_10045014 237
301 3300025294 Ga0209025_1019397 Ga0209025_10193973 237
302 3300025294 Ga0209025_1045564 Ga0209025_10455642 237
303 3300025711 Ga0207696_1070503 Ga0207696_10705031 237
304 3300025728 Ga0207655_1000925 Ga0207655_100092523 237
305 3300025728 Ga0207655_1058936 Ga0207655_10589362 237
306 3300027876 Ga0209974_10014038 Ga0209974_100140383 237
307 3300030083 Ga0237817_10548 Ga0237817_105485 237
308 3300038705 Ga0237819_02605 Ga0237819_02605_1188_1901 237
309 3300038705 Ga0237819_02613 Ga0237819_02613_1634_2347 237
310 3300045976 Ga0466967_0001012 Ga0466967_0001012_7483_8196 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

1

231

0.99

PF08241

Methyltransf_11

Methyltransferase domain

52

149

0.96

PF13649

Methyltransf_25

Methyltransferase domain

51

145

0.92

PF08242

Methyltransf_12

Methyltransferase domain

52

147

0.9

PF07021

MetW

Methionine biosynthesis protein MetW

36

197

0.82

PF13847

Methyltransf_31

Methyltransferase domain

45

210

0.82

PF13489

Methyltransf_23

Methyltransferase domain

30

216

0.8

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

3

155

0.77

PF01728

FtsJ

FtsJ-like methyltransferase

37

185

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.931 16 233
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.8659 36 231
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.8623 36 221
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8623 16 233
6wlf-assembly1.cif.gz_A phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.8621 9 155
ID Description Score Start End Superfamily
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9728 16 233 3.40.50.150
af_Q2FYG5_1_193_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9675 40 233 3.40.50.150
af_Q2FYG5_1_193_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9577 40 233 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9556 16 233 3.40.50.150
af_A4IC78_24_256_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9444 16 233 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2E2SF17-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9771 5 234 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A6A5KTX5-F1-model_v4 deleted 0.9745 5 234
AF-A0A1V5LFI5-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9728 6 233 GO:0009234
GO:0032259
GO:0043770
AF-A0A7V5PGH2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9726 5 194 GO:0008425
GO:0009234
GO:0032259
AF-A0A0D6P4T0-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9712 5 233 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770

Feature Viewer

pLDDT pTM Quality
86.33 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map