F400571

General Info

Members Datasets Scaffolds Average Seq Length
310 179 309 109

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_101775635|Ga0070714_1017756352
Length 130
Sequence LSGSIEGIKKLIIKNKNMAIASLITRDVEKLADQTGNVYESLVIIARRSRQISTKVKEELNNKLADFASTVDNLEEIFENREQIEISKFYERMPKPTVLATEEFIEGKIMFRKPMLEAEVAEEAKETKKQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
57 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
92 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
105 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
117 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
118 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
119 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
120 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
121 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
122 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
160 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
161 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
162 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
163 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
164 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
165 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
166 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
171 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.74
Metatranscriptomes 11.94
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.13
Nodule 0
Rhizoplane 1.94
Rhizosphere 86.77
Stem 0
Stem Tuber 0
Unclassified 5.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_7652595 2162886012 Bacteria 3970
2 JGI24740J21852_10027059 3300001979 Bacteria 1912
3 JGI25150J39212_1000014 3300002774 Bacteria 170955
4 JGI25151J46595_10000042 3300003187 Bacteria 170955
5 JGI25153J46596_10000009 3300003215 Bacteria 340925
6 rootH2_10233156 3300003320 Bacteria 1481
7 rootL2_10344690 3300003322 Bacteria 1432
8 Ga0055530_10039940 3300003791 Bacteria 1155
9 Ga0055531_10000015 3300003794 Bacteria 182104
10 Ga0058859_10995574 3300004798 Bacteria 938
11 Ga0065714_10069650 3300005288 Bacteria 4135
12 Ga0065704_10222255 3300005289 Bacteria 1070
13 Ga0070658_10017399 3300005327 Bacteria 5752
14 Ga0068869_100522852 3300005334 Bacteria 993
15 Ga0068868_101519550 3300005338 Unclassified 627
16 Ga0070669_101264945 3300005353 Bacteria 638
17 Ga0070675_102000667 3300005354 Unclassified 534
18 Ga0070674_101423079 3300005356 Bacteria 621
19 Ga0070673_100943913 3300005364 Bacteria 801
20 Ga0070714_100739712 3300005435 Bacteria 950
21 Ga0070714_101775635 3300005435 Bacteria 602
22 Ga0070663_100003942 3300005455 Bacteria 8653
23 Ga0070678_101003292 3300005456 Bacteria 767
24 Ga0070698_100962663 3300005471 Bacteria 800
25 Ga0068855_100627813 3300005563 Bacteria 1156
26 Ga0068857_100364385 3300005577 Bacteria 1340
27 Ga0068857_100906937 3300005577 Bacteria 845
28 Ga0068856_100639046 3300005614 Bacteria 1085
29 Ga0068856_102403338 3300005614 Bacteria 534
30 Ga0070702_101679262 3300005615 Bacteria 527
31 Ga0068852_100451012 3300005616 Bacteria 1273
32 Ga0068859_100670672 3300005617 Bacteria 1128
33 Ga0068864_101420056 3300005618 Bacteria 696
34 Ga0068860_102792910 3300005843 Bacteria 506
35 Ga0068862_100385335 3300005844 Bacteria 1308
36 Ga0070716_101336715 3300006173 Bacteria 580
37 Ga0075428_101255584 3300006844 Bacteria 780
38 Ga0097620_100670654 3300006931 Bacteria 1128
39 Ga0105244_10166511 3300009036 Bacteria 1050
40 Ga0105240_11895356 3300009093 Unclassified 620
41 Ga0111539_10007466 3300009094 Bacteria 14002
42 Ga0111539_11155683 3300009094 Unclassified 899
43 Ga0105245_11527328 3300009098 Bacteria 719
44 Ga0105242_10024193 3300009176 Bacteria 4794
45 Ga0105237_10068445 3300009545 Bacteria 3543
46 Ga0105239_13298970 3300010375 Bacteria 525
47 Ga0157373_10083894 3300013100 Bacteria 2246
48 Ga0157371_10001108 3300013102 Bacteria 29201
49 Ga0157371_10003740 3300013102 Bacteria 13624
50 Ga0157371_10015721 3300013102 Bacteria 5666
51 Ga0157371_10096323 3300013102 Bacteria 2097
52 Ga0157370_10000935 3300013104 Bacteria 37047
53 Ga0157370_10012943 3300013104 Bacteria 8624
54 Ga0157370_10039142 3300013104 Bacteria 4582
55 Ga0157370_10104346 3300013104 Bacteria 2653
56 Ga0157370_10297292 3300013104 Bacteria 1491
57 Ga0157370_10350123 3300013104 Bacteria 1361
58 Ga0157370_11118425 3300013104 Bacteria 712
59 Ga0157369_10000897 3300013105 Bacteria 37997
60 Ga0157369_10001172 3300013105 Bacteria 32699
61 Ga0157374_10364837 3300013296 Bacteria 1437
62 Ga0163162_10001647 3300013306 Bacteria 20926
63 Ga0163162_11462371 3300013306 Unclassified 778
64 Ga0157372_10000042 3300013307 Bacteria 157651
65 Ga0157372_10001546 3300013307 Bacteria 25062
66 Ga0157375_10174848 3300013308 Bacteria 2296
67 Ga0157375_10282937 3300013308 Bacteria 1821
68 Ga0157375_13132668 3300013308 Bacteria 552
69 Ga0157380_10017602 3300014326 Bacteria 5289
70 Ga0157380_11202875 3300014326 Unclassified 801
71 Ga0182008_10000024 3300014497 Bacteria 199978
72 Ga0182008_10001650 3300014497 Bacteria 14745
73 Ga0182008_10001930 3300014497 Bacteria 13389
74 Ga0182006_1000853 3300015261 Bacteria 20516
75 Ga0182006_1001310 3300015261 Bacteria 15282
76 Ga0182006_1012671 3300015261 Bacteria 3683
77 Ga0182006_1177639 3300015261 Bacteria 711
78 Ga0182007_10000002 3300015262 Bacteria 564661
79 Ga0183373_1004 3300015682 Bacteria 537398
80 Ga0183368_1131 3300015687 Bacteria 722
81 Ga0163161_10002656 3300017792 Bacteria 12702
82 Ga0163161_10031005 3300017792 Bacteria 3808
83 Ga0163161_10226018 3300017792 Bacteria 1451
84 Ga0163161_11928780 3300017792 Bacteria 526
85 Ga0206356_11876452 3300020070 Bacteria 819
86 Ga0206351_10630490 3300020077 Bacteria 1985
87 Ga0206350_11033248 3300020080 Bacteria 1287
88 Ga0207425_1000023 3300025245 Bacteria 341339
89 Ga0209026_1016661 3300025250 Bacteria 1186
90 Ga0209129_1000032 3300025258 Bacteria 341150
91 Ga0209676_1000009 3300025292 Bacteria 981719
92 Ga0209025_1000047 3300025294 Bacteria 341150
93 Ga0209758_1000145 3300025297 Bacteria 170553
94 Ga0209050_1000094 3300025298 Bacteria 242893
95 Ga0209050_1003364 3300025298 Bacteria 11907
96 Ga0207426_1103080 3300025302 Bacteria 733
97 Ga0209257_1000005 3300025304 Bacteria 1592528
98 Ga0209257_1064876 3300025304 Bacteria 981
99 Ga0207695_10666171 3300025913 Bacteria 921
100 Ga0207671_10063810 3300025914 Bacteria 2737
101 Ga0207681_10647083 3300025923 Unclassified 876
102 Ga0207664_11016082 3300025929 Bacteria 743
103 Ga0207686_10020038 3300025934 Bacteria 3816
104 Ga0207665_10159914 3300025939 Bacteria 1620
105 Ga0207665_10975995 3300025939 Bacteria 673
106 Ga0207689_10647387 3300025942 Unclassified 890
107 Ga0207667_10285208 3300025949 Bacteria 1687
108 Ga0207677_11727293 3300026023 Unclassified 580
109 Ga0207678_10018368 3300026067 Bacteria 6141
110 Ga0207702_10137034 3300026078 Bacteria 2210
111 Ga0207702_10921997 3300026078 Bacteria 866
112 Ga0207702_12346939 3300026078 Bacteria 521
113 Ga0207676_11274408 3300026095 Bacteria 729
114 Ga0207683_10657133 3300026121 Bacteria 971
115 Ga0207428_10136735 3300027907 Bacteria 1873
116 Ga0307515_10000007 3300028794 Bacteria 719669
117 Ga0307515_10188269 3300028794 Bacteria 1984
118 Ga0265338_10004546 3300028800 Bacteria 18680
119 Ga0265327_10027920 3300031251 Bacteria 3240
120 Ga0265327_10032581 3300031251 Bacteria 2915
121 Ga0265327_10051688 3300031251 Bacteria 2144
122 Ga0307513_10742097 3300031456 Bacteria 687
123 Ga0307513_10844987 3300031456 Bacteria 622
124 Ga0307509_10147229 3300031507 Bacteria 2278
125 Ga0307408_100000275 3300031548 Bacteria 51714
126 Ga0307514_10067378 3300031649 Bacteria 2702
127 Ga0316579_10105594 3300031691 Unclassified 1350
128 Ga0316576_10037344 3300031727 Bacteria 3477
129 Ga0316576_10148253 3300031727 Bacteria 1768
130 Ga0316576_10612791 3300031727 Bacteria 794
131 Ga0316576_10661162 3300031727 Bacteria 759
132 Ga0316578_10014959 3300031728 Bacteria 4161
133 Ga0307405_10000015 3300031731 Bacteria 206299
134 Ga0316577_10029324 3300031733 Bacteria 3071
135 Ga0307413_10183122 3300031824 Bacteria 1496
136 Ga0307406_12074957 3300031901 Bacteria 509
137 Ga0307407_10000054 3300031903 Bacteria 49850
138 Ga0307407_10548706 3300031903 Bacteria 854
139 Ga0307409_100091553 3300031995 Bacteria 2493
140 Ga0307416_100000755 3300032002 Bacteria 16928
141 Ga0307414_10017000 3300032004 Bacteria 4441
142 Ga0307414_10045637 3300032004 Bacteria 3002
143 Ga0307411_10246577 3300032005 Bacteria 1402
144 Ga0307411_11741884 3300032005 Bacteria 577
145 Ga0316585_10024500 3300032137 Unclassified 1868
146 Ga0316593_10042828 3300032168 Bacteria 1511
147 Ga0316593_10100297 3300032168 Unclassified 1027
148 Ga0316592_1017959 3300033524 Bacteria 1488
149 Ga0316588_1145114 3300033528 Unclassified 608
150 Ga0316596_1064618 3300033541 Bacteria 978
151 Ga0316596_1074220 3300033541 Bacteria 912
152 Ga0316596_1172853 3300033541 Bacteria 597
153 Ga0373941_0461985 3300035115 Bacteria 534
154 Ga0316574_0393350 3300035398 Bacteria 873
155 Ga0316574_0698060 3300035398 Bacteria 622
156 Ga0316574_0767738 3300035398 Bacteria 588
157 Ga0316584_0000938 3300036712 Bacteria 16604
158 Ga0316584_0732528 3300036712 Bacteria 676
159 Ga0316584_0750412 3300036712 Bacteria 666
160 Ga0395899_0000238 3300037312 Bacteria 74240
161 Ga0395899_0585015 3300037312 Bacteria 713
162 Ga0395900_0031111 3300037418 Bacteria 5483
163 Ga0395900_0492379 3300037418 Bacteria 1177
164 Ga0395905_0000003 3300037471 Bacteria 1347396
165 Ga0395901_0666049 3300038443 Unclassified 1042
166 Ga0395901_1546962 3300038443 Bacteria 618
167 Ga0400490_46880 3300038726 Bacteria 18732
168 Ga0400483_236062 3300039062 Bacteria 2482
169 Ga0451790_18693 3300041444 Bacteria 542
170 Ga0451790_45183 3300041444 Bacteria 533
171 Ga0451795_1584026 3300041456 Bacteria 521
172 Ga0451802_1034903 3300041460 Bacteria 578
173 Ga0451804_0425720 3300041463 Bacteria 798
174 Ga0451852_17740 3300041508 Bacteria 824
175 Ga0451853_3296407 3300041512 Bacteria 691
176 Ga0439445_0043674 3300042004 Bacteria 1196
177 Ga0451577_0000197 3300042876 Bacteria 126180
178 Ga0451577_0000208 3300042876 Bacteria 122820
179 Ga0451577_0001281 3300042876 Bacteria 34580
180 Ga0451577_0020262 3300042876 Bacteria 6106
181 Ga0451577_0046879 3300042876 Bacteria 3865
182 Ga0451577_0068512 3300042876 Bacteria 3164
183 Ga0451577_0075268 3300042876 Bacteria 3011
184 Ga0451577_0150741 3300042876 Bacteria 2092
185 Ga0451577_0182814 3300042876 Bacteria 1890
186 Ga0451577_0197631 3300042876 Bacteria 1815
187 Ga0451577_0257174 3300042876 Unclassified 1581
188 Ga0451577_0294578 3300042876 Unclassified 1470
189 Ga0451577_0302074 3300042876 Bacteria 1450
190 Ga0451577_0373140 3300042876 Unclassified 1294
191 Ga0451577_0486774 3300042876 Bacteria 1120
192 Ga0451577_0595720 3300042876 Bacteria 1003
193 Ga0451577_0924863 3300042876 Bacteria 785
194 Ga0451577_1303620 3300042876 Bacteria 646
195 Ga0451577_1418926 3300042876 Bacteria 615
196 Ga0451577_1489264 3300042876 Bacteria 599
197 Ga0466969_0173813 3300044656 Bacteria 987
198 Ga0453683_0000015 3300044673 Bacteria 346024
199 Ga0453683_0000357 3300044673 Bacteria 55358
200 Ga0453683_0000370 3300044673 Bacteria 53913
201 Ga0453683_0016013 3300044673 Bacteria 4844
202 Ga0453683_0058460 3300044673 Bacteria 2412
203 Ga0453683_0074879 3300044673 Bacteria 2120
204 Ga0453683_0095320 3300044673 Bacteria 1867
205 Ga0453683_0191021 3300044673 Bacteria 1299
206 Ga0453683_0277262 3300044673 Bacteria 1070
207 Ga0453683_0277822 3300044673 Unclassified 1069
208 Ga0453683_0311403 3300044673 Bacteria 1008
209 Ga0453683_0417760 3300044673 Bacteria 865
210 Ga0453683_0591053 3300044673 Unclassified 723
211 Ga0453683_0749124 3300044673 Bacteria 641
212 Ga0453683_0785410 3300044673 Bacteria 626
213 Ga0453683_0914500 3300044673 Bacteria 580
214 Ga0466966_0013924 3300044684 Bacteria 5324
215 Ga0453684_0000148 3300044712 Bacteria 308453
216 Ga0453684_0000668 3300044712 Bacteria 122805
217 Ga0453684_0000961 3300044712 Bacteria 94901
218 Ga0453684_0001184 3300044712 Bacteria 80745
219 Ga0453684_0001433 3300044712 Bacteria 68182
220 Ga0453684_0002194 3300044712 Bacteria 48629
221 Ga0453684_0007236 3300044712 Bacteria 20571
222 Ga0453684_0013673 3300044712 Bacteria 13149
223 Ga0453684_0025412 3300044712 Bacteria 8600
224 Ga0453684_0032591 3300044712 Bacteria 7288
225 Ga0453684_0037170 3300044712 Bacteria 6688
226 Ga0453684_0055610 3300044712 Bacteria 5144
227 Ga0453684_0084650 3300044712 Unclassified 3943
228 Ga0453684_0107010 3300044712 Unclassified 3406
229 Ga0453684_0121092 3300044712 Unclassified 3159
230 Ga0453684_0195954 3300044712 Bacteria 2359
231 Ga0453684_0241889 3300044712 Unclassified 2077
232 Ga0453684_0255533 3300044712 Bacteria 2010
233 Ga0453684_0535915 3300044712 Bacteria 1291
234 Ga0453684_0545051 3300044712 Bacteria 1278
235 Ga0453684_0678100 3300044712 Unclassified 1122
236 Ga0453684_1390647 3300044712 Bacteria 728
237 Ga0453684_1706134 3300044712 Bacteria 643
238 Ga0466959_0093551 3300045049 Bacteria 2157
239 Ga0451576_0000127 3300045051 Bacteria 192727
240 Ga0451576_0000291 3300045051 Bacteria 122805
241 Ga0451576_0000720 3300045051 Bacteria 66656
242 Ga0451576_0008015 3300045051 Bacteria 12483
243 Ga0451576_0009705 3300045051 Bacteria 11133
244 Ga0451576_0020693 3300045051 Bacteria 7160
245 Ga0451576_0026157 3300045051 Bacteria 6278
246 Ga0451576_0039632 3300045051 Bacteria 4986
247 Ga0451576_0051312 3300045051 Bacteria 4324
248 Ga0451576_0176909 3300045051 Bacteria 2228
249 Ga0451576_0205130 3300045051 Bacteria 2058
250 Ga0451576_0278718 3300045051 Unclassified 1748
251 Ga0451576_0323153 3300045051 Unclassified 1615
252 Ga0451576_0359258 3300045051 Bacteria 1525
253 Ga0451576_0494775 3300045051 Bacteria 1284
254 Ga0451576_0662966 3300045051 Unclassified 1096
255 Ga0451576_0899437 3300045051 Unclassified 929
256 Ga0451576_1439183 3300045051 Bacteria 717
257 Ga0466958_0111878 3300045836 Bacteria 1705
258 Ga0495638_0000025 3300046460 Bacteria 353356
259 Ga0495606_0108338 3300046507 Bacteria 1679
260 Ga0495610_0000197 3300046512 Bacteria 67429
261 Ga0495610_0000974 3300046512 Bacteria 26457
262 Ga0495637_0014865 3300046520 Bacteria 3667
263 Ga0495644_0004642 3300046523 Bacteria 5396
264 Ga0495633_0450970 3300046558 Bacteria 581
265 Ga0495661_0449813 3300046665 Bacteria 620
266 Ga0495670_0176110 3300046691 Bacteria 1128
267 Ga0495636_0683087 3300047318 Bacteria 506
268 Ga0495677_0016819 3300047445 Bacteria 2652
269 Ga0495685_062054 3300047447 Bacteria 1259
270 Ga0496115_0251447 3300048918 Bacteria 1455
271 Ga0496122_0001975 3300048925 Bacteria 30642
272 Ga0496123_0011770 3300048926 Bacteria 7536
273 Ga0501343_025863 3300049132 Bacteria 531
274 Ga0501344_14894 3300049133 Bacteria 501
275 Ga0501307_000608 3300049162 Bacteria 2564
276 Ga0501312_055872 3300049528 Bacteria 675
277 Ga0501312_084224 3300049528 Bacteria 579
278 Ga0501315_057177 3300049531 Bacteria 624
279 Ga0501320_070385 3300049536 Bacteria 505
280 Ga0501323_045132 3300049539 Bacteria 656
281 Ga0501332_08416 3300049548 Bacteria 668
282 Ga0501335_010332 3300049551 Bacteria 900
283 Ga0501336_035159 3300049552 Bacteria 505
284 Ga0501340_024027 3300049556 Bacteria 525
285 Ga0501069_0179779 3300049585 Bacteria 1222
286 Ga0501235_054232 3300049669 Bacteria 932
287 Ga0501249_013491 3300049679 Bacteria 1737
288 Ga0501252_076056 3300049682 Bacteria 549
289 Ga0501260_022355 3300049689 Bacteria 692
290 Ga0501225_0281147 3300049705 Bacteria 557
291 Ga0501241_007420 3300049758 Bacteria 2007
292 Ga0501280_063715 3300049776 Bacteria 646
293 Ga0501204_007097 3300049850 Bacteria 1256
294 nmdc:mga08y16_273049_c1 3300050511 Bacteria 1745
295 Ga0500557_002520 3300053105 Bacteria 3388
296 Ga0500616_0000024 3300053153 Bacteria 455811
297 Ga0500616_0015484 3300053153 Bacteria 4359
298 Ga0500622_0286441 3300053156 Bacteria 708
299 Ga0587066_094103 3300059490 Bacteria 670
300 Ga0587070_038449 3300059491 Bacteria 904
301 Ga0587070_045712 3300059491 Bacteria 855
302 Ga0587077_036296 3300059493 Bacteria 967
303 Ga0587080_131562 3300059503 Bacteria 564
304 Ga0587083_0075529 3300059505 Bacteria 792
305 Ga0587083_0208016 3300059505 Bacteria 562
306 Ga0587088_192682 3300059508 Unclassified 517
307 Ga0587115_086623 3300059626 Bacteria 563
308 Ga0587071_080748 3300060344 Bacteria 724
309 Ga0587111_0023489 3300060346 Bacteria 1206

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025913 Ga0207695_10666171 Ga0207695_106661712 101
2 3300005456 Ga0070678_101003292 Ga0070678_1010032922 102
3 3300026121 Ga0207683_10657133 Ga0207683_106571332 102
4 3300039062 Ga0400483_236062 Ga0400483_236062_1450_1767 102
5 3300042876 Ga0451577_0075268 Ga0451577_0075268_874_1197 102
6 3300042876 Ga0451577_0257174 Ga0451577_0257174_167_493 102
7 3300042876 Ga0451577_0302074 Ga0451577_0302074_25_351 102
8 3300042876 Ga0451577_0373140 Ga0451577_0373140_276_599 102
9 3300044673 Ga0453683_0277822 Ga0453683_0277822_613_939 102
10 3300044673 Ga0453683_0785410 Ga0453683_0785410_105_428 102
11 3300044712 Ga0453684_0037170 Ga0453684_0037170_2396_2719 102
12 3300044712 Ga0453684_0107010 Ga0453684_0107010_2602_2928 102
13 3300044712 Ga0453684_0241889 Ga0453684_0241889_424_747 102
14 3300044712 Ga0453684_0678100 Ga0453684_0678100_341_667 102
15 3300044712 Ga0453684_1390647 Ga0453684_1390647_377_703 102
16 3300045051 Ga0451576_0494775 Ga0451576_0494775_330_656 102
17 3300045051 Ga0451576_0899437 Ga0451576_0899437_38_361 102
18 3300045051 Ga0451576_1439183 Ga0451576_1439183_14_337 102
19 3300003794 Ga0055531_10000015 Ga0055531_10000015105 103
20 3300005353 Ga0070669_101264945 Ga0070669_1012649452 103
21 3300005471 Ga0070698_100962663 Ga0070698_1009626632 103
22 3300009094 Ga0111539_11155683 Ga0111539_111556832 103
23 3300009098 Ga0105245_11527328 Ga0105245_115273282 103
24 3300009176 Ga0105242_10024193 Ga0105242_100241935 103
25 3300013102 Ga0157371_10015721 Ga0157371_100157212 103
26 3300013306 Ga0163162_11462371 Ga0163162_114623712 103
27 3300014326 Ga0157380_11202875 Ga0157380_112028752 103
28 3300020070 Ga0206356_11876452 Ga0206356_118764522 103
29 3300025304 Ga0209257_1000005 Ga0209257_1000005360 103
30 3300025923 Ga0207681_10647083 Ga0207681_106470832 103
31 3300025934 Ga0207686_10020038 Ga0207686_100200383 103
32 3300028794 Ga0307515_10000007 Ga0307515_1000000794 103
33 3300031548 Ga0307408_100000275 Ga0307408_10000027513 103
34 3300031649 Ga0307514_10067378 Ga0307514_100673783 103
35 3300031903 Ga0307407_10548706 Ga0307407_105487062 103
36 3300041463 Ga0451804_0425720 Ga0451804_0425720_414_734 103
37 3300046665 Ga0495661_0449813 Ga0495661_0449813_111_437 103
38 3300046691 Ga0495670_0176110 Ga0495670_0176110_505_831 103
39 3300049133 Ga0501344_14894 Ga0501344_14894_138_464 103
40 3300049162 Ga0501307_000608 Ga0501307_000608_1845_2162 103
41 3300049528 Ga0501312_084224 Ga0501312_084224_167_484 103
42 3300049539 Ga0501323_045132 Ga0501323_045132_87_413 103
43 3300049548 Ga0501332_08416 Ga0501332_08416_28_357 103
44 3300049552 Ga0501336_035159 Ga0501336_035159_165_491 103
45 3300049669 Ga0501235_054232 Ga0501235_054232_132_449 103
46 3300049682 Ga0501252_076056 Ga0501252_076056_62_379 103
47 3300049689 Ga0501260_022355 Ga0501260_022355_123_452 103
48 3300049705 Ga0501225_0281147 Ga0501225_0281147_103_420 103
49 3300049758 Ga0501241_007420 Ga0501241_007420_393_710 103
50 3300049850 Ga0501204_007097 Ga0501204_007097_705_1022 103
51 3300003320 rootH2_10233156 rootH2_102331562 104
52 3300004798 Ga0058859_10995574 Ga0058859_109955741 104
53 3300005356 Ga0070674_101423079 Ga0070674_1014230791 104
54 3300005577 Ga0068857_100364385 Ga0068857_1003643852 104
55 3300005617 Ga0068859_100670672 Ga0068859_1006706722 104
56 3300005844 Ga0068862_100385335 Ga0068862_1003853352 104
57 3300006844 Ga0075428_101255584 Ga0075428_1012555842 104
58 3300006931 Ga0097620_100670654 Ga0097620_1006706542 104
59 3300009094 Ga0111539_10007466 Ga0111539_1000746611 104
60 3300013296 Ga0157374_10364837 Ga0157374_103648372 104
61 3300014326 Ga0157380_10017602 Ga0157380_100176023 104
62 3300025250 Ga0209026_1016661 Ga0209026_10166611 104
63 3300025298 Ga0209050_1003364 Ga0209050_10033645 104
64 3300025302 Ga0207426_1103080 Ga0207426_11030802 104
65 3300025304 Ga0209257_1064876 Ga0209257_10648761 104
66 3300027907 Ga0207428_10136735 Ga0207428_101367352 104
67 3300031456 Ga0307513_10742097 Ga0307513_107420972 104
68 3300031456 Ga0307513_10844987 Ga0307513_108449872 104
69 3300031507 Ga0307509_10147229 Ga0307509_101472292 104
70 3300031824 Ga0307413_10183122 Ga0307413_101831222 104
71 3300032005 Ga0307411_11741884 Ga0307411_117418842 104
72 3300035115 Ga0373941_0461985 Ga0373941_0461985_156_482 104
73 3300037418 Ga0395900_0492379 Ga0395900_0492379_112_429 104
74 3300038443 Ga0395901_1546962 Ga0395901_1546962_249_566 104
75 3300041456 Ga0451795_1584026 Ga0451795_1584026_13_330 104
76 3300042004 Ga0439445_0043674 Ga0439445_0043674_740_1063 104
77 3300042876 Ga0451577_1303620 Ga0451577_1303620_196_525 104
78 3300045051 Ga0451576_0176909 Ga0451576_0176909_1019_1342 104
79 3300046460 Ga0495638_0000025 Ga0495638_0000025_339362_339685 104
80 3300046523 Ga0495644_0004642 Ga0495644_0004642_1858_2184 104
81 3300046558 Ga0495633_0450970 Ga0495633_0450970_38_364 104
82 3300047318 Ga0495636_0683087 Ga0495636_0683087_139_465 104
83 3300047445 Ga0495677_0016819 Ga0495677_0016819_1346_1672 104
84 3300047447 Ga0495685_062054 Ga0495685_062054_911_1237 104
85 3300049132 Ga0501343_025863 Ga0501343_025863_129_458 104
86 3300049528 Ga0501312_055872 Ga0501312_055872_309_638 104
87 3300049531 Ga0501315_057177 Ga0501315_057177_102_431 104
88 3300049536 Ga0501320_070385 Ga0501320_070385_150_467 104
89 3300049551 Ga0501335_010332 Ga0501335_010332_184_513 104
90 3300049556 Ga0501340_024027 Ga0501340_024027_73_402 104
91 3300049585 Ga0501069_0179779 Ga0501069_0179779_725_1048 104
92 3300050511 nmdc:mga08y16_273049_c1 nmdc:mga08y16_273049_c1_721_1044 104
93 3300053105 Ga0500557_002520 Ga0500557_002520_1971_2294 104
94 3300053153 Ga0500616_0000024 Ga0500616_0000024_338597_338920 104
95 3300053153 Ga0500616_0015484 Ga0500616_0015484_1496_1819 104
96 3300053156 Ga0500622_0286441 Ga0500622_0286441_113_436 104
97 iso_pu_bacteria 2902048731 2902051114 104
98 3300001979 JGI24740J21852_10027059 JGI24740J21852_100270593 105
99 3300002774 JGI25150J39212_1000014 JGI25150J39212_10000144 105
100 3300003187 JGI25151J46595_10000042 JGI25151J46595_100000424 105
101 3300003215 JGI25153J46596_10000009 JGI25153J46596_100000094 105
102 3300003322 rootL2_10344690 rootL2_103446901 105
103 3300003791 Ga0055530_10039940 Ga0055530_100399402 105
104 3300005288 Ga0065714_10069650 Ga0065714_100696504 105
105 3300005289 Ga0065704_10222255 Ga0065704_102222552 105
106 3300005327 Ga0070658_10017399 Ga0070658_100173993 105
107 3300005334 Ga0068869_100522852 Ga0068869_1005228521 105
108 3300005338 Ga0068868_101519550 Ga0068868_1015195501 105
109 3300005364 Ga0070673_100943913 Ga0070673_1009439132 105
110 3300005455 Ga0070663_100003942 Ga0070663_1000039427 105
111 3300005563 Ga0068855_100627813 Ga0068855_1006278132 105
112 3300005577 Ga0068857_100906937 Ga0068857_1009069372 105
113 3300005614 Ga0068856_100639046 Ga0068856_1006390462 105
114 3300005614 Ga0068856_102403338 Ga0068856_1024033382 105
115 3300005615 Ga0070702_101679262 Ga0070702_1016792621 105
116 3300005616 Ga0068852_100451012 Ga0068852_1004510122 105
117 3300005843 Ga0068860_102792910 Ga0068860_1027929102 105
118 3300006173 Ga0070716_101336715 Ga0070716_1013367152 105
119 3300009036 Ga0105244_10166511 Ga0105244_101665112 105
120 3300009093 Ga0105240_11895356 Ga0105240_118953562 105
121 3300009545 Ga0105237_10068445 Ga0105237_100684454 105
122 3300010375 Ga0105239_13298970 Ga0105239_132989702 105
123 3300013100 Ga0157373_10083894 Ga0157373_100838942 105
124 3300013102 Ga0157371_10001108 Ga0157371_100011082 105
125 3300013102 Ga0157371_10003740 Ga0157371_1000374011 105
126 3300013102 Ga0157371_10096323 Ga0157371_100963232 105
127 3300013104 Ga0157370_10000935 Ga0157370_100009353 105
128 3300013104 Ga0157370_10012943 Ga0157370_100129437 105
129 3300013104 Ga0157370_10039142 Ga0157370_100391425 105
130 3300013104 Ga0157370_10104346 Ga0157370_101043462 105
131 3300013104 Ga0157370_10297292 Ga0157370_102972922 105
132 3300013104 Ga0157370_10350123 Ga0157370_103501232 105
133 3300013104 Ga0157370_11118425 Ga0157370_111184252 105
134 3300013105 Ga0157369_10000897 Ga0157369_100008972 105
135 3300013105 Ga0157369_10001172 Ga0157369_1000117225 105
136 3300013306 Ga0163162_10001647 Ga0163162_1000164716 105
137 3300013307 Ga0157372_10000042 Ga0157372_10000042139 105
138 3300013307 Ga0157372_10001546 Ga0157372_1000154618 105
139 3300013308 Ga0157375_10174848 Ga0157375_101748482 105
140 3300013308 Ga0157375_10282937 Ga0157375_102829373 105
141 3300013308 Ga0157375_13132668 Ga0157375_131326682 105
142 3300014497 Ga0182008_10000024 Ga0182008_10000024155 105
143 3300014497 Ga0182008_10001650 Ga0182008_100016503 105
144 3300014497 Ga0182008_10001930 Ga0182008_1000193010 105
145 3300015261 Ga0182006_1000853 Ga0182006_100085313 105
146 3300015261 Ga0182006_1001310 Ga0182006_10013102 105
147 3300015261 Ga0182006_1012671 Ga0182006_10126713 105
148 3300015261 Ga0182006_1177639 Ga0182006_11776391 105
149 3300015262 Ga0182007_10000002 Ga0182007_100000022 105
150 3300015682 Ga0183373_1004 Ga0183373_1004478 105
151 3300015687 Ga0183368_1131 Ga0183368_11312 105
152 3300017792 Ga0163161_10002656 Ga0163161_100026561 105
153 3300017792 Ga0163161_10031005 Ga0163161_100310054 105
154 3300017792 Ga0163161_10226018 Ga0163161_102260181 105
155 3300017792 Ga0163161_11928780 Ga0163161_119287802 105
156 3300020077 Ga0206351_10630490 Ga0206351_106304903 105
157 3300020080 Ga0206350_11033248 Ga0206350_110332481 105
158 3300025245 Ga0207425_1000023 Ga0207425_10000234 105
159 3300025258 Ga0209129_1000032 Ga0209129_1000032269 105
160 3300025292 Ga0209676_1000009 Ga0209676_10000093 105
161 3300025294 Ga0209025_1000047 Ga0209025_1000047269 105
162 3300025297 Ga0209758_1000145 Ga0209758_10001454 105
163 3300025298 Ga0209050_1000094 Ga0209050_10000943 105
164 3300025914 Ga0207671_10063810 Ga0207671_100638102 105
165 3300025939 Ga0207665_10159914 Ga0207665_101599142 105
166 3300025939 Ga0207665_10975995 Ga0207665_109759952 105
167 3300025942 Ga0207689_10647387 Ga0207689_106473871 105
168 3300025949 Ga0207667_10285208 Ga0207667_102852082 105
169 3300026023 Ga0207677_11727293 Ga0207677_117272931 105
170 3300026067 Ga0207678_10018368 Ga0207678_100183685 105
171 3300026078 Ga0207702_10137034 Ga0207702_101370342 105
172 3300026078 Ga0207702_10921997 Ga0207702_109219972 105
173 3300026078 Ga0207702_12346939 Ga0207702_123469392 105
174 3300028794 Ga0307515_10188269 Ga0307515_101882693 105
175 3300028800 Ga0265338_10004546 Ga0265338_100045462 105
176 3300031251 Ga0265327_10027920 Ga0265327_100279203 105
177 3300031251 Ga0265327_10032581 Ga0265327_100325812 105
178 3300031251 Ga0265327_10051688 Ga0265327_100516881 105
179 3300031691 Ga0316579_10105594 Ga0316579_101055942 105
180 3300031727 Ga0316576_10037344 Ga0316576_100373444 105
181 3300031727 Ga0316576_10148253 Ga0316576_101482532 105
182 3300031727 Ga0316576_10612791 Ga0316576_106127911 105
183 3300031727 Ga0316576_10661162 Ga0316576_106611622 105
184 3300031728 Ga0316578_10014959 Ga0316578_100149592 105
185 3300031731 Ga0307405_10000015 Ga0307405_10000015170 105
186 3300031733 Ga0316577_10029324 Ga0316577_100293242 105
187 3300031901 Ga0307406_12074957 Ga0307406_120749571 105
188 3300031903 Ga0307407_10000054 Ga0307407_1000005439 105
189 3300031995 Ga0307409_100091553 Ga0307409_1000915531 105
190 3300032002 Ga0307416_100000755 Ga0307416_10000075512 105
191 3300032004 Ga0307414_10017000 Ga0307414_100170005 105
192 3300032004 Ga0307414_10045637 Ga0307414_100456372 105
193 3300032005 Ga0307411_10246577 Ga0307411_102465772 105
194 3300032137 Ga0316585_10024500 Ga0316585_100245003 105
195 3300032168 Ga0316593_10042828 Ga0316593_100428283 105
196 3300032168 Ga0316593_10100297 Ga0316593_101002972 105
197 3300033524 Ga0316592_1017959 Ga0316592_10179592 105
198 3300033528 Ga0316588_1145114 Ga0316588_11451142 105
199 3300033541 Ga0316596_1064618 Ga0316596_10646182 105
200 3300033541 Ga0316596_1074220 Ga0316596_10742201 105
201 3300033541 Ga0316596_1172853 Ga0316596_11728531 105
202 3300035398 Ga0316574_0393350 Ga0316574_0393350_38_373 105
203 3300035398 Ga0316574_0698060 Ga0316574_0698060_56_391 105
204 3300035398 Ga0316574_0767738 Ga0316574_0767738_57_392 105
205 3300036712 Ga0316584_0000938 Ga0316584_0000938_590_916 105
206 3300036712 Ga0316584_0732528 Ga0316584_0732528_26_361 105
207 3300036712 Ga0316584_0750412 Ga0316584_0750412_171_506 105
208 3300037312 Ga0395899_0000238 Ga0395899_0000238_72030_72365 105
209 3300037312 Ga0395899_0585015 Ga0395899_0585015_117_452 105
210 3300037418 Ga0395900_0031111 Ga0395900_0031111_4337_4672 105
211 3300037471 Ga0395905_0000003 Ga0395905_0000003_295318_295650 105
212 3300038443 Ga0395901_0666049 Ga0395901_0666049_625_960 105
213 3300038726 Ga0400490_46880 Ga0400490_46880_4529_4864 105
214 3300041444 Ga0451790_18693 Ga0451790_18693_103_429 105
215 3300041444 Ga0451790_45183 Ga0451790_45183_11_334 105
216 3300041460 Ga0451802_1034903 Ga0451802_1034903_106_432 105
217 3300041508 Ga0451852_17740 Ga0451852_17740_222_554 105
218 3300041512 Ga0451853_3296407 Ga0451853_3296407_101_427 105
219 3300042876 Ga0451577_0000197 Ga0451577_0000197_8223_8561 105
220 3300042876 Ga0451577_0000208 Ga0451577_0000208_112295_112621 105
221 3300042876 Ga0451577_0001281 Ga0451577_0001281_6508_6846 105
222 3300042876 Ga0451577_0020262 Ga0451577_0020262_904_1242 105
223 3300042876 Ga0451577_0046879 Ga0451577_0046879_2077_2415 105
224 3300042876 Ga0451577_0068512 Ga0451577_0068512_722_1048 105
225 3300042876 Ga0451577_0150741 Ga0451577_0150741_675_1013 105
226 3300042876 Ga0451577_0182814 Ga0451577_0182814_468_797 105
227 3300042876 Ga0451577_0197631 Ga0451577_0197631_581_919 105
228 3300042876 Ga0451577_0294578 Ga0451577_0294578_351_674 105
229 3300042876 Ga0451577_0486774 Ga0451577_0486774_64_402 105
230 3300042876 Ga0451577_0595720 Ga0451577_0595720_289_615 105
231 3300042876 Ga0451577_0924863 Ga0451577_0924863_242_574 105
232 3300042876 Ga0451577_1418926 Ga0451577_1418926_218_556 105
233 3300044656 Ga0466969_0173813 Ga0466969_0173813_203_538 105
234 3300044673 Ga0453683_0000015 Ga0453683_0000015_273491_273829 105
235 3300044673 Ga0453683_0000357 Ga0453683_0000357_4210_4536 105
236 3300044673 Ga0453683_0000370 Ga0453683_0000370_5238_5576 105
237 3300044673 Ga0453683_0016013 Ga0453683_0016013_4080_4403 105
238 3300044673 Ga0453683_0058460 Ga0453683_0058460_778_1104 105
239 3300044673 Ga0453683_0074879 Ga0453683_0074879_537_863 105
240 3300044673 Ga0453683_0095320 Ga0453683_0095320_840_1178 105
241 3300044673 Ga0453683_0277262 Ga0453683_0277262_629_967 105
242 3300044673 Ga0453683_0311403 Ga0453683_0311403_60_395 105
243 3300044673 Ga0453683_0417760 Ga0453683_0417760_393_719 105
244 3300044673 Ga0453683_0749124 Ga0453683_0749124_131_469 105
245 3300044684 Ga0466966_0013924 Ga0466966_0013924_1610_1945 105
246 3300044712 Ga0453684_0000148 Ga0453684_0000148_16747_17085 105
247 3300044712 Ga0453684_0000668 Ga0453684_0000668_10200_10526 105
248 3300044712 Ga0453684_0000961 Ga0453684_0000961_60046_60384 105
249 3300044712 Ga0453684_0001184 Ga0453684_0001184_26903_27241 105
250 3300044712 Ga0453684_0001433 Ga0453684_0001433_58096_58434 105
251 3300044712 Ga0453684_0002194 Ga0453684_0002194_14637_14975 105
252 3300044712 Ga0453684_0007236 Ga0453684_0007236_3826_4161 105
253 3300044712 Ga0453684_0013673 Ga0453684_0013673_9952_10290 105
254 3300044712 Ga0453684_0025412 Ga0453684_0025412_4661_4999 105
255 3300044712 Ga0453684_0032591 Ga0453684_0032591_5357_5692 105
256 3300044712 Ga0453684_0055610 Ga0453684_0055610_1921_2247 105
257 3300044712 Ga0453684_0084650 Ga0453684_0084650_3546_3878 105
258 3300044712 Ga0453684_0121092 Ga0453684_0121092_605_928 105
259 3300044712 Ga0453684_0195954 Ga0453684_0195954_1005_1343 105
260 3300044712 Ga0453684_0255533 Ga0453684_0255533_316_642 105
261 3300044712 Ga0453684_0545051 Ga0453684_0545051_398_736 105
262 3300044712 Ga0453684_1706134 Ga0453684_1706134_290_628 105
263 3300045049 Ga0466959_0093551 Ga0466959_0093551_1795_2130 105
264 3300045051 Ga0451576_0000127 Ga0451576_0000127_138886_139224 105
265 3300045051 Ga0451576_0000291 Ga0451576_0000291_112295_112621 105
266 3300045051 Ga0451576_0000720 Ga0451576_0000720_58096_58434 105
267 3300045051 Ga0451576_0008015 Ga0451576_0008015_5373_5702 105
268 3300045051 Ga0451576_0009705 Ga0451576_0009705_9403_9741 105
269 3300045051 Ga0451576_0020693 Ga0451576_0020693_1319_1657 105
270 3300045051 Ga0451576_0026157 Ga0451576_0026157_4772_5110 105
271 3300045051 Ga0451576_0039632 Ga0451576_0039632_497_820 105
272 3300045051 Ga0451576_0051312 Ga0451576_0051312_392_718 105
273 3300045051 Ga0451576_0205130 Ga0451576_0205130_84_422 105
274 3300045051 Ga0451576_0278718 Ga0451576_0278718_629_964 105
275 3300045051 Ga0451576_0323153 Ga0451576_0323153_958_1290 105
276 3300045051 Ga0451576_0359258 Ga0451576_0359258_398_736 105
277 3300045051 Ga0451576_0662966 Ga0451576_0662966_40_366 105
278 3300045836 Ga0466958_0111878 Ga0466958_0111878_643_978 105
279 3300046507 Ga0495606_0108338 Ga0495606_0108338_814_1140 105
280 3300046512 Ga0495610_0000197 Ga0495610_0000197_1613_1942 105
281 3300046512 Ga0495610_0000974 Ga0495610_0000974_1715_2041 105
282 3300046520 Ga0495637_0014865 Ga0495637_0014865_1708_2037 105
283 3300048918 Ga0496115_0251447 Ga0496115_0251447_1022_1348 105
284 3300048925 Ga0496122_0001975 Ga0496122_0001975_2239_2565 105
285 3300048926 Ga0496123_0011770 Ga0496123_0011770_6008_6334 105
286 3300049679 Ga0501249_013491 Ga0501249_013491_46_372 105
287 3300049776 Ga0501280_063715 Ga0501280_063715_181_510 105
288 3300059491 Ga0587070_038449 Ga0587070_038449_398_745 105
289 3300059493 Ga0587077_036296 Ga0587077_036296_474_821 105
290 3300059505 Ga0587083_0208016 Ga0587083_0208016_70_417 105
291 3300042876 Ga0451577_1489264 Ga0451577_1489264_166_507 106
292 3300044712 Ga0453684_0535915 Ga0453684_0535915_774_1115 106
293 3300005618 Ga0068864_101420056 Ga0068864_1014200561 107
294 3300026095 Ga0207676_11274408 Ga0207676_112744081 107
295 3300044673 Ga0453683_0191021 Ga0453683_0191021_88_417 107
296 3300044673 Ga0453683_0591053 Ga0453683_0591053_21_350 107
297 3300044673 Ga0453683_0914500 Ga0453683_0914500_155_484 107
298 3300060346 Ga0587111_0023489 Ga0587111_0023489_103_426 107
299 3300005354 Ga0070675_102000667 Ga0070675_1020006671 111
300 3300005435 Ga0070714_101775635 Ga0070714_1017756352 111
301 3300059490 Ga0587066_094103 Ga0587066_094103_58_393 111
302 3300059491 Ga0587070_045712 Ga0587070_045712_171_506 111
303 3300059503 Ga0587080_131562 Ga0587080_131562_83_418 111
304 3300059505 Ga0587083_0075529 Ga0587083_0075529_363_698 111
305 3300059508 Ga0587088_192682 Ga0587088_192682_147_482 111
306 3300059626 Ga0587115_086623 Ga0587115_086623_147_482 111
307 3300060344 Ga0587071_080748 Ga0587071_080748_82_417 111
308 2162886012 MBSR1b_contig_7652595 MBSR1b_0453.00007800 114
309 3300005435 Ga0070714_100739712 Ga0070714_1007397122 114
310 3300025929 Ga0207664_11016082 Ga0207664_110160821 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

30

84

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zjc-assembly1.cif.gz_A crystal structure of gmppnp-bound human gimap7 l100q variant 0.7886 25 94
6koq-assembly1.cif.gz_E mycobacterium tuberculosis initial transcription complex comprising sigma h and 5'-oh rna of 10 nt 0.6624 1 99
6koq-assembly1.cif.gz_E mycobacterium tuberculosis initial transcription complex comprising sigma h and 5'-oh rna of 10 nt 0.621 1 99
2z3y-assembly1.cif.gz_A crystal structure of lysine-specific demethylase1 0.5411 15 94
2z5u-assembly1.cif.gz_A crystal structure of lysine-specific histone demethylase 1 0.5303 15 94
ID Description Score Start End Superfamily
1d5aA04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.5896 37 78 1.10.287.690
4k8xA04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.5871 37 78 1.10.287.690
5vu5A04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.5731 37 78 1.10.287.690
1zw0H00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.5672 25 91 1.20.5.420
2z3yA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.5411 15 94 1.10.287.80
ID Description Score Start End GO Terms
AF-A0A076HU56-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.9884 16 99 GO:0000428
GO:0003677
GO:0003899
GO:0006351
AF-A0A519JXN0-F1-model_v4 DNA-directed RNA polymerase subunit omega 0.9617 11 83 GO:0000428
GO:0003677
GO:0003899
GO:0006351
AF-A0A6I0E185-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.9544 11 99 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A7X8IHD2-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.9506 9 101 GO:0000428
GO:0003677
GO:0003899
GO:0006351
AF-J0NZ47-F1-model_v4 RNA polymerase Rpb6 0.9493 10 102

Feature Viewer

pLDDT pTM Quality
81.95 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map