F400571
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 310 | 179 | 309 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_101775635|Ga0070714_1017756352 |
| Length | 130 |
| Sequence | LSGSIEGIKKLIIKNKNMAIASLITRDVEKLADQTGNVYESLVIIARRSRQISTKVKEELNNKLADFASTVDNLEEIFENREQIEISKFYERMPKPTVLATEEFIEGKIMFRKPMLEAEVAEEAKETKKQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 54 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 57 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 85 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 86 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 87 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 88 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 89 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 90 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 91 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 92 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 93 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 94 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 95 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 96 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 97 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 98 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 99 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 100 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 101 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 102 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 103 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 104 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 105 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 110 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 111 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 112 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 113 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 114 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 115 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 116 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 117 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 118 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 119 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 120 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 121 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 123 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 124 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 125 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 126 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 127 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 128 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 129 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 130 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 131 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 132 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 133 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 145 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 146 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 147 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 160 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 161 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 162 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 163 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 164 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 165 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 166 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 167 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 169 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 170 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 171 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.74 |
| Metatranscriptomes | 11.94 |
| Isolates | 0.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.13 |
| Nodule | 0 |
| Rhizoplane | 1.94 |
| Rhizosphere | 86.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_7652595 | 2162886012 | Bacteria | 3970 |
| 2 | JGI24740J21852_10027059 | 3300001979 | Bacteria | 1912 |
| 3 | JGI25150J39212_1000014 | 3300002774 | Bacteria | 170955 |
| 4 | JGI25151J46595_10000042 | 3300003187 | Bacteria | 170955 |
| 5 | JGI25153J46596_10000009 | 3300003215 | Bacteria | 340925 |
| 6 | rootH2_10233156 | 3300003320 | Bacteria | 1481 |
| 7 | rootL2_10344690 | 3300003322 | Bacteria | 1432 |
| 8 | Ga0055530_10039940 | 3300003791 | Bacteria | 1155 |
| 9 | Ga0055531_10000015 | 3300003794 | Bacteria | 182104 |
| 10 | Ga0058859_10995574 | 3300004798 | Bacteria | 938 |
| 11 | Ga0065714_10069650 | 3300005288 | Bacteria | 4135 |
| 12 | Ga0065704_10222255 | 3300005289 | Bacteria | 1070 |
| 13 | Ga0070658_10017399 | 3300005327 | Bacteria | 5752 |
| 14 | Ga0068869_100522852 | 3300005334 | Bacteria | 993 |
| 15 | Ga0068868_101519550 | 3300005338 | Unclassified | 627 |
| 16 | Ga0070669_101264945 | 3300005353 | Bacteria | 638 |
| 17 | Ga0070675_102000667 | 3300005354 | Unclassified | 534 |
| 18 | Ga0070674_101423079 | 3300005356 | Bacteria | 621 |
| 19 | Ga0070673_100943913 | 3300005364 | Bacteria | 801 |
| 20 | Ga0070714_100739712 | 3300005435 | Bacteria | 950 |
| 21 | Ga0070714_101775635 | 3300005435 | Bacteria | 602 |
| 22 | Ga0070663_100003942 | 3300005455 | Bacteria | 8653 |
| 23 | Ga0070678_101003292 | 3300005456 | Bacteria | 767 |
| 24 | Ga0070698_100962663 | 3300005471 | Bacteria | 800 |
| 25 | Ga0068855_100627813 | 3300005563 | Bacteria | 1156 |
| 26 | Ga0068857_100364385 | 3300005577 | Bacteria | 1340 |
| 27 | Ga0068857_100906937 | 3300005577 | Bacteria | 845 |
| 28 | Ga0068856_100639046 | 3300005614 | Bacteria | 1085 |
| 29 | Ga0068856_102403338 | 3300005614 | Bacteria | 534 |
| 30 | Ga0070702_101679262 | 3300005615 | Bacteria | 527 |
| 31 | Ga0068852_100451012 | 3300005616 | Bacteria | 1273 |
| 32 | Ga0068859_100670672 | 3300005617 | Bacteria | 1128 |
| 33 | Ga0068864_101420056 | 3300005618 | Bacteria | 696 |
| 34 | Ga0068860_102792910 | 3300005843 | Bacteria | 506 |
| 35 | Ga0068862_100385335 | 3300005844 | Bacteria | 1308 |
| 36 | Ga0070716_101336715 | 3300006173 | Bacteria | 580 |
| 37 | Ga0075428_101255584 | 3300006844 | Bacteria | 780 |
| 38 | Ga0097620_100670654 | 3300006931 | Bacteria | 1128 |
| 39 | Ga0105244_10166511 | 3300009036 | Bacteria | 1050 |
| 40 | Ga0105240_11895356 | 3300009093 | Unclassified | 620 |
| 41 | Ga0111539_10007466 | 3300009094 | Bacteria | 14002 |
| 42 | Ga0111539_11155683 | 3300009094 | Unclassified | 899 |
| 43 | Ga0105245_11527328 | 3300009098 | Bacteria | 719 |
| 44 | Ga0105242_10024193 | 3300009176 | Bacteria | 4794 |
| 45 | Ga0105237_10068445 | 3300009545 | Bacteria | 3543 |
| 46 | Ga0105239_13298970 | 3300010375 | Bacteria | 525 |
| 47 | Ga0157373_10083894 | 3300013100 | Bacteria | 2246 |
| 48 | Ga0157371_10001108 | 3300013102 | Bacteria | 29201 |
| 49 | Ga0157371_10003740 | 3300013102 | Bacteria | 13624 |
| 50 | Ga0157371_10015721 | 3300013102 | Bacteria | 5666 |
| 51 | Ga0157371_10096323 | 3300013102 | Bacteria | 2097 |
| 52 | Ga0157370_10000935 | 3300013104 | Bacteria | 37047 |
| 53 | Ga0157370_10012943 | 3300013104 | Bacteria | 8624 |
| 54 | Ga0157370_10039142 | 3300013104 | Bacteria | 4582 |
| 55 | Ga0157370_10104346 | 3300013104 | Bacteria | 2653 |
| 56 | Ga0157370_10297292 | 3300013104 | Bacteria | 1491 |
| 57 | Ga0157370_10350123 | 3300013104 | Bacteria | 1361 |
| 58 | Ga0157370_11118425 | 3300013104 | Bacteria | 712 |
| 59 | Ga0157369_10000897 | 3300013105 | Bacteria | 37997 |
| 60 | Ga0157369_10001172 | 3300013105 | Bacteria | 32699 |
| 61 | Ga0157374_10364837 | 3300013296 | Bacteria | 1437 |
| 62 | Ga0163162_10001647 | 3300013306 | Bacteria | 20926 |
| 63 | Ga0163162_11462371 | 3300013306 | Unclassified | 778 |
| 64 | Ga0157372_10000042 | 3300013307 | Bacteria | 157651 |
| 65 | Ga0157372_10001546 | 3300013307 | Bacteria | 25062 |
| 66 | Ga0157375_10174848 | 3300013308 | Bacteria | 2296 |
| 67 | Ga0157375_10282937 | 3300013308 | Bacteria | 1821 |
| 68 | Ga0157375_13132668 | 3300013308 | Bacteria | 552 |
| 69 | Ga0157380_10017602 | 3300014326 | Bacteria | 5289 |
| 70 | Ga0157380_11202875 | 3300014326 | Unclassified | 801 |
| 71 | Ga0182008_10000024 | 3300014497 | Bacteria | 199978 |
| 72 | Ga0182008_10001650 | 3300014497 | Bacteria | 14745 |
| 73 | Ga0182008_10001930 | 3300014497 | Bacteria | 13389 |
| 74 | Ga0182006_1000853 | 3300015261 | Bacteria | 20516 |
| 75 | Ga0182006_1001310 | 3300015261 | Bacteria | 15282 |
| 76 | Ga0182006_1012671 | 3300015261 | Bacteria | 3683 |
| 77 | Ga0182006_1177639 | 3300015261 | Bacteria | 711 |
| 78 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 79 | Ga0183373_1004 | 3300015682 | Bacteria | 537398 |
| 80 | Ga0183368_1131 | 3300015687 | Bacteria | 722 |
| 81 | Ga0163161_10002656 | 3300017792 | Bacteria | 12702 |
| 82 | Ga0163161_10031005 | 3300017792 | Bacteria | 3808 |
| 83 | Ga0163161_10226018 | 3300017792 | Bacteria | 1451 |
| 84 | Ga0163161_11928780 | 3300017792 | Bacteria | 526 |
| 85 | Ga0206356_11876452 | 3300020070 | Bacteria | 819 |
| 86 | Ga0206351_10630490 | 3300020077 | Bacteria | 1985 |
| 87 | Ga0206350_11033248 | 3300020080 | Bacteria | 1287 |
| 88 | Ga0207425_1000023 | 3300025245 | Bacteria | 341339 |
| 89 | Ga0209026_1016661 | 3300025250 | Bacteria | 1186 |
| 90 | Ga0209129_1000032 | 3300025258 | Bacteria | 341150 |
| 91 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 92 | Ga0209025_1000047 | 3300025294 | Bacteria | 341150 |
| 93 | Ga0209758_1000145 | 3300025297 | Bacteria | 170553 |
| 94 | Ga0209050_1000094 | 3300025298 | Bacteria | 242893 |
| 95 | Ga0209050_1003364 | 3300025298 | Bacteria | 11907 |
| 96 | Ga0207426_1103080 | 3300025302 | Bacteria | 733 |
| 97 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 98 | Ga0209257_1064876 | 3300025304 | Bacteria | 981 |
| 99 | Ga0207695_10666171 | 3300025913 | Bacteria | 921 |
| 100 | Ga0207671_10063810 | 3300025914 | Bacteria | 2737 |
| 101 | Ga0207681_10647083 | 3300025923 | Unclassified | 876 |
| 102 | Ga0207664_11016082 | 3300025929 | Bacteria | 743 |
| 103 | Ga0207686_10020038 | 3300025934 | Bacteria | 3816 |
| 104 | Ga0207665_10159914 | 3300025939 | Bacteria | 1620 |
| 105 | Ga0207665_10975995 | 3300025939 | Bacteria | 673 |
| 106 | Ga0207689_10647387 | 3300025942 | Unclassified | 890 |
| 107 | Ga0207667_10285208 | 3300025949 | Bacteria | 1687 |
| 108 | Ga0207677_11727293 | 3300026023 | Unclassified | 580 |
| 109 | Ga0207678_10018368 | 3300026067 | Bacteria | 6141 |
| 110 | Ga0207702_10137034 | 3300026078 | Bacteria | 2210 |
| 111 | Ga0207702_10921997 | 3300026078 | Bacteria | 866 |
| 112 | Ga0207702_12346939 | 3300026078 | Bacteria | 521 |
| 113 | Ga0207676_11274408 | 3300026095 | Bacteria | 729 |
| 114 | Ga0207683_10657133 | 3300026121 | Bacteria | 971 |
| 115 | Ga0207428_10136735 | 3300027907 | Bacteria | 1873 |
| 116 | Ga0307515_10000007 | 3300028794 | Bacteria | 719669 |
| 117 | Ga0307515_10188269 | 3300028794 | Bacteria | 1984 |
| 118 | Ga0265338_10004546 | 3300028800 | Bacteria | 18680 |
| 119 | Ga0265327_10027920 | 3300031251 | Bacteria | 3240 |
| 120 | Ga0265327_10032581 | 3300031251 | Bacteria | 2915 |
| 121 | Ga0265327_10051688 | 3300031251 | Bacteria | 2144 |
| 122 | Ga0307513_10742097 | 3300031456 | Bacteria | 687 |
| 123 | Ga0307513_10844987 | 3300031456 | Bacteria | 622 |
| 124 | Ga0307509_10147229 | 3300031507 | Bacteria | 2278 |
| 125 | Ga0307408_100000275 | 3300031548 | Bacteria | 51714 |
| 126 | Ga0307514_10067378 | 3300031649 | Bacteria | 2702 |
| 127 | Ga0316579_10105594 | 3300031691 | Unclassified | 1350 |
| 128 | Ga0316576_10037344 | 3300031727 | Bacteria | 3477 |
| 129 | Ga0316576_10148253 | 3300031727 | Bacteria | 1768 |
| 130 | Ga0316576_10612791 | 3300031727 | Bacteria | 794 |
| 131 | Ga0316576_10661162 | 3300031727 | Bacteria | 759 |
| 132 | Ga0316578_10014959 | 3300031728 | Bacteria | 4161 |
| 133 | Ga0307405_10000015 | 3300031731 | Bacteria | 206299 |
| 134 | Ga0316577_10029324 | 3300031733 | Bacteria | 3071 |
| 135 | Ga0307413_10183122 | 3300031824 | Bacteria | 1496 |
| 136 | Ga0307406_12074957 | 3300031901 | Bacteria | 509 |
| 137 | Ga0307407_10000054 | 3300031903 | Bacteria | 49850 |
| 138 | Ga0307407_10548706 | 3300031903 | Bacteria | 854 |
| 139 | Ga0307409_100091553 | 3300031995 | Bacteria | 2493 |
| 140 | Ga0307416_100000755 | 3300032002 | Bacteria | 16928 |
| 141 | Ga0307414_10017000 | 3300032004 | Bacteria | 4441 |
| 142 | Ga0307414_10045637 | 3300032004 | Bacteria | 3002 |
| 143 | Ga0307411_10246577 | 3300032005 | Bacteria | 1402 |
| 144 | Ga0307411_11741884 | 3300032005 | Bacteria | 577 |
| 145 | Ga0316585_10024500 | 3300032137 | Unclassified | 1868 |
| 146 | Ga0316593_10042828 | 3300032168 | Bacteria | 1511 |
| 147 | Ga0316593_10100297 | 3300032168 | Unclassified | 1027 |
| 148 | Ga0316592_1017959 | 3300033524 | Bacteria | 1488 |
| 149 | Ga0316588_1145114 | 3300033528 | Unclassified | 608 |
| 150 | Ga0316596_1064618 | 3300033541 | Bacteria | 978 |
| 151 | Ga0316596_1074220 | 3300033541 | Bacteria | 912 |
| 152 | Ga0316596_1172853 | 3300033541 | Bacteria | 597 |
| 153 | Ga0373941_0461985 | 3300035115 | Bacteria | 534 |
| 154 | Ga0316574_0393350 | 3300035398 | Bacteria | 873 |
| 155 | Ga0316574_0698060 | 3300035398 | Bacteria | 622 |
| 156 | Ga0316574_0767738 | 3300035398 | Bacteria | 588 |
| 157 | Ga0316584_0000938 | 3300036712 | Bacteria | 16604 |
| 158 | Ga0316584_0732528 | 3300036712 | Bacteria | 676 |
| 159 | Ga0316584_0750412 | 3300036712 | Bacteria | 666 |
| 160 | Ga0395899_0000238 | 3300037312 | Bacteria | 74240 |
| 161 | Ga0395899_0585015 | 3300037312 | Bacteria | 713 |
| 162 | Ga0395900_0031111 | 3300037418 | Bacteria | 5483 |
| 163 | Ga0395900_0492379 | 3300037418 | Bacteria | 1177 |
| 164 | Ga0395905_0000003 | 3300037471 | Bacteria | 1347396 |
| 165 | Ga0395901_0666049 | 3300038443 | Unclassified | 1042 |
| 166 | Ga0395901_1546962 | 3300038443 | Bacteria | 618 |
| 167 | Ga0400490_46880 | 3300038726 | Bacteria | 18732 |
| 168 | Ga0400483_236062 | 3300039062 | Bacteria | 2482 |
| 169 | Ga0451790_18693 | 3300041444 | Bacteria | 542 |
| 170 | Ga0451790_45183 | 3300041444 | Bacteria | 533 |
| 171 | Ga0451795_1584026 | 3300041456 | Bacteria | 521 |
| 172 | Ga0451802_1034903 | 3300041460 | Bacteria | 578 |
| 173 | Ga0451804_0425720 | 3300041463 | Bacteria | 798 |
| 174 | Ga0451852_17740 | 3300041508 | Bacteria | 824 |
| 175 | Ga0451853_3296407 | 3300041512 | Bacteria | 691 |
| 176 | Ga0439445_0043674 | 3300042004 | Bacteria | 1196 |
| 177 | Ga0451577_0000197 | 3300042876 | Bacteria | 126180 |
| 178 | Ga0451577_0000208 | 3300042876 | Bacteria | 122820 |
| 179 | Ga0451577_0001281 | 3300042876 | Bacteria | 34580 |
| 180 | Ga0451577_0020262 | 3300042876 | Bacteria | 6106 |
| 181 | Ga0451577_0046879 | 3300042876 | Bacteria | 3865 |
| 182 | Ga0451577_0068512 | 3300042876 | Bacteria | 3164 |
| 183 | Ga0451577_0075268 | 3300042876 | Bacteria | 3011 |
| 184 | Ga0451577_0150741 | 3300042876 | Bacteria | 2092 |
| 185 | Ga0451577_0182814 | 3300042876 | Bacteria | 1890 |
| 186 | Ga0451577_0197631 | 3300042876 | Bacteria | 1815 |
| 187 | Ga0451577_0257174 | 3300042876 | Unclassified | 1581 |
| 188 | Ga0451577_0294578 | 3300042876 | Unclassified | 1470 |
| 189 | Ga0451577_0302074 | 3300042876 | Bacteria | 1450 |
| 190 | Ga0451577_0373140 | 3300042876 | Unclassified | 1294 |
| 191 | Ga0451577_0486774 | 3300042876 | Bacteria | 1120 |
| 192 | Ga0451577_0595720 | 3300042876 | Bacteria | 1003 |
| 193 | Ga0451577_0924863 | 3300042876 | Bacteria | 785 |
| 194 | Ga0451577_1303620 | 3300042876 | Bacteria | 646 |
| 195 | Ga0451577_1418926 | 3300042876 | Bacteria | 615 |
| 196 | Ga0451577_1489264 | 3300042876 | Bacteria | 599 |
| 197 | Ga0466969_0173813 | 3300044656 | Bacteria | 987 |
| 198 | Ga0453683_0000015 | 3300044673 | Bacteria | 346024 |
| 199 | Ga0453683_0000357 | 3300044673 | Bacteria | 55358 |
| 200 | Ga0453683_0000370 | 3300044673 | Bacteria | 53913 |
| 201 | Ga0453683_0016013 | 3300044673 | Bacteria | 4844 |
| 202 | Ga0453683_0058460 | 3300044673 | Bacteria | 2412 |
| 203 | Ga0453683_0074879 | 3300044673 | Bacteria | 2120 |
| 204 | Ga0453683_0095320 | 3300044673 | Bacteria | 1867 |
| 205 | Ga0453683_0191021 | 3300044673 | Bacteria | 1299 |
| 206 | Ga0453683_0277262 | 3300044673 | Bacteria | 1070 |
| 207 | Ga0453683_0277822 | 3300044673 | Unclassified | 1069 |
| 208 | Ga0453683_0311403 | 3300044673 | Bacteria | 1008 |
| 209 | Ga0453683_0417760 | 3300044673 | Bacteria | 865 |
| 210 | Ga0453683_0591053 | 3300044673 | Unclassified | 723 |
| 211 | Ga0453683_0749124 | 3300044673 | Bacteria | 641 |
| 212 | Ga0453683_0785410 | 3300044673 | Bacteria | 626 |
| 213 | Ga0453683_0914500 | 3300044673 | Bacteria | 580 |
| 214 | Ga0466966_0013924 | 3300044684 | Bacteria | 5324 |
| 215 | Ga0453684_0000148 | 3300044712 | Bacteria | 308453 |
| 216 | Ga0453684_0000668 | 3300044712 | Bacteria | 122805 |
| 217 | Ga0453684_0000961 | 3300044712 | Bacteria | 94901 |
| 218 | Ga0453684_0001184 | 3300044712 | Bacteria | 80745 |
| 219 | Ga0453684_0001433 | 3300044712 | Bacteria | 68182 |
| 220 | Ga0453684_0002194 | 3300044712 | Bacteria | 48629 |
| 221 | Ga0453684_0007236 | 3300044712 | Bacteria | 20571 |
| 222 | Ga0453684_0013673 | 3300044712 | Bacteria | 13149 |
| 223 | Ga0453684_0025412 | 3300044712 | Bacteria | 8600 |
| 224 | Ga0453684_0032591 | 3300044712 | Bacteria | 7288 |
| 225 | Ga0453684_0037170 | 3300044712 | Bacteria | 6688 |
| 226 | Ga0453684_0055610 | 3300044712 | Bacteria | 5144 |
| 227 | Ga0453684_0084650 | 3300044712 | Unclassified | 3943 |
| 228 | Ga0453684_0107010 | 3300044712 | Unclassified | 3406 |
| 229 | Ga0453684_0121092 | 3300044712 | Unclassified | 3159 |
| 230 | Ga0453684_0195954 | 3300044712 | Bacteria | 2359 |
| 231 | Ga0453684_0241889 | 3300044712 | Unclassified | 2077 |
| 232 | Ga0453684_0255533 | 3300044712 | Bacteria | 2010 |
| 233 | Ga0453684_0535915 | 3300044712 | Bacteria | 1291 |
| 234 | Ga0453684_0545051 | 3300044712 | Bacteria | 1278 |
| 235 | Ga0453684_0678100 | 3300044712 | Unclassified | 1122 |
| 236 | Ga0453684_1390647 | 3300044712 | Bacteria | 728 |
| 237 | Ga0453684_1706134 | 3300044712 | Bacteria | 643 |
| 238 | Ga0466959_0093551 | 3300045049 | Bacteria | 2157 |
| 239 | Ga0451576_0000127 | 3300045051 | Bacteria | 192727 |
| 240 | Ga0451576_0000291 | 3300045051 | Bacteria | 122805 |
| 241 | Ga0451576_0000720 | 3300045051 | Bacteria | 66656 |
| 242 | Ga0451576_0008015 | 3300045051 | Bacteria | 12483 |
| 243 | Ga0451576_0009705 | 3300045051 | Bacteria | 11133 |
| 244 | Ga0451576_0020693 | 3300045051 | Bacteria | 7160 |
| 245 | Ga0451576_0026157 | 3300045051 | Bacteria | 6278 |
| 246 | Ga0451576_0039632 | 3300045051 | Bacteria | 4986 |
| 247 | Ga0451576_0051312 | 3300045051 | Bacteria | 4324 |
| 248 | Ga0451576_0176909 | 3300045051 | Bacteria | 2228 |
| 249 | Ga0451576_0205130 | 3300045051 | Bacteria | 2058 |
| 250 | Ga0451576_0278718 | 3300045051 | Unclassified | 1748 |
| 251 | Ga0451576_0323153 | 3300045051 | Unclassified | 1615 |
| 252 | Ga0451576_0359258 | 3300045051 | Bacteria | 1525 |
| 253 | Ga0451576_0494775 | 3300045051 | Bacteria | 1284 |
| 254 | Ga0451576_0662966 | 3300045051 | Unclassified | 1096 |
| 255 | Ga0451576_0899437 | 3300045051 | Unclassified | 929 |
| 256 | Ga0451576_1439183 | 3300045051 | Bacteria | 717 |
| 257 | Ga0466958_0111878 | 3300045836 | Bacteria | 1705 |
| 258 | Ga0495638_0000025 | 3300046460 | Bacteria | 353356 |
| 259 | Ga0495606_0108338 | 3300046507 | Bacteria | 1679 |
| 260 | Ga0495610_0000197 | 3300046512 | Bacteria | 67429 |
| 261 | Ga0495610_0000974 | 3300046512 | Bacteria | 26457 |
| 262 | Ga0495637_0014865 | 3300046520 | Bacteria | 3667 |
| 263 | Ga0495644_0004642 | 3300046523 | Bacteria | 5396 |
| 264 | Ga0495633_0450970 | 3300046558 | Bacteria | 581 |
| 265 | Ga0495661_0449813 | 3300046665 | Bacteria | 620 |
| 266 | Ga0495670_0176110 | 3300046691 | Bacteria | 1128 |
| 267 | Ga0495636_0683087 | 3300047318 | Bacteria | 506 |
| 268 | Ga0495677_0016819 | 3300047445 | Bacteria | 2652 |
| 269 | Ga0495685_062054 | 3300047447 | Bacteria | 1259 |
| 270 | Ga0496115_0251447 | 3300048918 | Bacteria | 1455 |
| 271 | Ga0496122_0001975 | 3300048925 | Bacteria | 30642 |
| 272 | Ga0496123_0011770 | 3300048926 | Bacteria | 7536 |
| 273 | Ga0501343_025863 | 3300049132 | Bacteria | 531 |
| 274 | Ga0501344_14894 | 3300049133 | Bacteria | 501 |
| 275 | Ga0501307_000608 | 3300049162 | Bacteria | 2564 |
| 276 | Ga0501312_055872 | 3300049528 | Bacteria | 675 |
| 277 | Ga0501312_084224 | 3300049528 | Bacteria | 579 |
| 278 | Ga0501315_057177 | 3300049531 | Bacteria | 624 |
| 279 | Ga0501320_070385 | 3300049536 | Bacteria | 505 |
| 280 | Ga0501323_045132 | 3300049539 | Bacteria | 656 |
| 281 | Ga0501332_08416 | 3300049548 | Bacteria | 668 |
| 282 | Ga0501335_010332 | 3300049551 | Bacteria | 900 |
| 283 | Ga0501336_035159 | 3300049552 | Bacteria | 505 |
| 284 | Ga0501340_024027 | 3300049556 | Bacteria | 525 |
| 285 | Ga0501069_0179779 | 3300049585 | Bacteria | 1222 |
| 286 | Ga0501235_054232 | 3300049669 | Bacteria | 932 |
| 287 | Ga0501249_013491 | 3300049679 | Bacteria | 1737 |
| 288 | Ga0501252_076056 | 3300049682 | Bacteria | 549 |
| 289 | Ga0501260_022355 | 3300049689 | Bacteria | 692 |
| 290 | Ga0501225_0281147 | 3300049705 | Bacteria | 557 |
| 291 | Ga0501241_007420 | 3300049758 | Bacteria | 2007 |
| 292 | Ga0501280_063715 | 3300049776 | Bacteria | 646 |
| 293 | Ga0501204_007097 | 3300049850 | Bacteria | 1256 |
| 294 | nmdc:mga08y16_273049_c1 | 3300050511 | Bacteria | 1745 |
| 295 | Ga0500557_002520 | 3300053105 | Bacteria | 3388 |
| 296 | Ga0500616_0000024 | 3300053153 | Bacteria | 455811 |
| 297 | Ga0500616_0015484 | 3300053153 | Bacteria | 4359 |
| 298 | Ga0500622_0286441 | 3300053156 | Bacteria | 708 |
| 299 | Ga0587066_094103 | 3300059490 | Bacteria | 670 |
| 300 | Ga0587070_038449 | 3300059491 | Bacteria | 904 |
| 301 | Ga0587070_045712 | 3300059491 | Bacteria | 855 |
| 302 | Ga0587077_036296 | 3300059493 | Bacteria | 967 |
| 303 | Ga0587080_131562 | 3300059503 | Bacteria | 564 |
| 304 | Ga0587083_0075529 | 3300059505 | Bacteria | 792 |
| 305 | Ga0587083_0208016 | 3300059505 | Bacteria | 562 |
| 306 | Ga0587088_192682 | 3300059508 | Unclassified | 517 |
| 307 | Ga0587115_086623 | 3300059626 | Bacteria | 563 |
| 308 | Ga0587071_080748 | 3300060344 | Bacteria | 724 |
| 309 | Ga0587111_0023489 | 3300060346 | Bacteria | 1206 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025913 | Ga0207695_10666171 | Ga0207695_106661712 | 101 |
| 2 | 3300005456 | Ga0070678_101003292 | Ga0070678_1010032922 | 102 |
| 3 | 3300026121 | Ga0207683_10657133 | Ga0207683_106571332 | 102 |
| 4 | 3300039062 | Ga0400483_236062 | Ga0400483_236062_1450_1767 | 102 |
| 5 | 3300042876 | Ga0451577_0075268 | Ga0451577_0075268_874_1197 | 102 |
| 6 | 3300042876 | Ga0451577_0257174 | Ga0451577_0257174_167_493 | 102 |
| 7 | 3300042876 | Ga0451577_0302074 | Ga0451577_0302074_25_351 | 102 |
| 8 | 3300042876 | Ga0451577_0373140 | Ga0451577_0373140_276_599 | 102 |
| 9 | 3300044673 | Ga0453683_0277822 | Ga0453683_0277822_613_939 | 102 |
| 10 | 3300044673 | Ga0453683_0785410 | Ga0453683_0785410_105_428 | 102 |
| 11 | 3300044712 | Ga0453684_0037170 | Ga0453684_0037170_2396_2719 | 102 |
| 12 | 3300044712 | Ga0453684_0107010 | Ga0453684_0107010_2602_2928 | 102 |
| 13 | 3300044712 | Ga0453684_0241889 | Ga0453684_0241889_424_747 | 102 |
| 14 | 3300044712 | Ga0453684_0678100 | Ga0453684_0678100_341_667 | 102 |
| 15 | 3300044712 | Ga0453684_1390647 | Ga0453684_1390647_377_703 | 102 |
| 16 | 3300045051 | Ga0451576_0494775 | Ga0451576_0494775_330_656 | 102 |
| 17 | 3300045051 | Ga0451576_0899437 | Ga0451576_0899437_38_361 | 102 |
| 18 | 3300045051 | Ga0451576_1439183 | Ga0451576_1439183_14_337 | 102 |
| 19 | 3300003794 | Ga0055531_10000015 | Ga0055531_10000015105 | 103 |
| 20 | 3300005353 | Ga0070669_101264945 | Ga0070669_1012649452 | 103 |
| 21 | 3300005471 | Ga0070698_100962663 | Ga0070698_1009626632 | 103 |
| 22 | 3300009094 | Ga0111539_11155683 | Ga0111539_111556832 | 103 |
| 23 | 3300009098 | Ga0105245_11527328 | Ga0105245_115273282 | 103 |
| 24 | 3300009176 | Ga0105242_10024193 | Ga0105242_100241935 | 103 |
| 25 | 3300013102 | Ga0157371_10015721 | Ga0157371_100157212 | 103 |
| 26 | 3300013306 | Ga0163162_11462371 | Ga0163162_114623712 | 103 |
| 27 | 3300014326 | Ga0157380_11202875 | Ga0157380_112028752 | 103 |
| 28 | 3300020070 | Ga0206356_11876452 | Ga0206356_118764522 | 103 |
| 29 | 3300025304 | Ga0209257_1000005 | Ga0209257_1000005360 | 103 |
| 30 | 3300025923 | Ga0207681_10647083 | Ga0207681_106470832 | 103 |
| 31 | 3300025934 | Ga0207686_10020038 | Ga0207686_100200383 | 103 |
| 32 | 3300028794 | Ga0307515_10000007 | Ga0307515_1000000794 | 103 |
| 33 | 3300031548 | Ga0307408_100000275 | Ga0307408_10000027513 | 103 |
| 34 | 3300031649 | Ga0307514_10067378 | Ga0307514_100673783 | 103 |
| 35 | 3300031903 | Ga0307407_10548706 | Ga0307407_105487062 | 103 |
| 36 | 3300041463 | Ga0451804_0425720 | Ga0451804_0425720_414_734 | 103 |
| 37 | 3300046665 | Ga0495661_0449813 | Ga0495661_0449813_111_437 | 103 |
| 38 | 3300046691 | Ga0495670_0176110 | Ga0495670_0176110_505_831 | 103 |
| 39 | 3300049133 | Ga0501344_14894 | Ga0501344_14894_138_464 | 103 |
| 40 | 3300049162 | Ga0501307_000608 | Ga0501307_000608_1845_2162 | 103 |
| 41 | 3300049528 | Ga0501312_084224 | Ga0501312_084224_167_484 | 103 |
| 42 | 3300049539 | Ga0501323_045132 | Ga0501323_045132_87_413 | 103 |
| 43 | 3300049548 | Ga0501332_08416 | Ga0501332_08416_28_357 | 103 |
| 44 | 3300049552 | Ga0501336_035159 | Ga0501336_035159_165_491 | 103 |
| 45 | 3300049669 | Ga0501235_054232 | Ga0501235_054232_132_449 | 103 |
| 46 | 3300049682 | Ga0501252_076056 | Ga0501252_076056_62_379 | 103 |
| 47 | 3300049689 | Ga0501260_022355 | Ga0501260_022355_123_452 | 103 |
| 48 | 3300049705 | Ga0501225_0281147 | Ga0501225_0281147_103_420 | 103 |
| 49 | 3300049758 | Ga0501241_007420 | Ga0501241_007420_393_710 | 103 |
| 50 | 3300049850 | Ga0501204_007097 | Ga0501204_007097_705_1022 | 103 |
| 51 | 3300003320 | rootH2_10233156 | rootH2_102331562 | 104 |
| 52 | 3300004798 | Ga0058859_10995574 | Ga0058859_109955741 | 104 |
| 53 | 3300005356 | Ga0070674_101423079 | Ga0070674_1014230791 | 104 |
| 54 | 3300005577 | Ga0068857_100364385 | Ga0068857_1003643852 | 104 |
| 55 | 3300005617 | Ga0068859_100670672 | Ga0068859_1006706722 | 104 |
| 56 | 3300005844 | Ga0068862_100385335 | Ga0068862_1003853352 | 104 |
| 57 | 3300006844 | Ga0075428_101255584 | Ga0075428_1012555842 | 104 |
| 58 | 3300006931 | Ga0097620_100670654 | Ga0097620_1006706542 | 104 |
| 59 | 3300009094 | Ga0111539_10007466 | Ga0111539_1000746611 | 104 |
| 60 | 3300013296 | Ga0157374_10364837 | Ga0157374_103648372 | 104 |
| 61 | 3300014326 | Ga0157380_10017602 | Ga0157380_100176023 | 104 |
| 62 | 3300025250 | Ga0209026_1016661 | Ga0209026_10166611 | 104 |
| 63 | 3300025298 | Ga0209050_1003364 | Ga0209050_10033645 | 104 |
| 64 | 3300025302 | Ga0207426_1103080 | Ga0207426_11030802 | 104 |
| 65 | 3300025304 | Ga0209257_1064876 | Ga0209257_10648761 | 104 |
| 66 | 3300027907 | Ga0207428_10136735 | Ga0207428_101367352 | 104 |
| 67 | 3300031456 | Ga0307513_10742097 | Ga0307513_107420972 | 104 |
| 68 | 3300031456 | Ga0307513_10844987 | Ga0307513_108449872 | 104 |
| 69 | 3300031507 | Ga0307509_10147229 | Ga0307509_101472292 | 104 |
| 70 | 3300031824 | Ga0307413_10183122 | Ga0307413_101831222 | 104 |
| 71 | 3300032005 | Ga0307411_11741884 | Ga0307411_117418842 | 104 |
| 72 | 3300035115 | Ga0373941_0461985 | Ga0373941_0461985_156_482 | 104 |
| 73 | 3300037418 | Ga0395900_0492379 | Ga0395900_0492379_112_429 | 104 |
| 74 | 3300038443 | Ga0395901_1546962 | Ga0395901_1546962_249_566 | 104 |
| 75 | 3300041456 | Ga0451795_1584026 | Ga0451795_1584026_13_330 | 104 |
| 76 | 3300042004 | Ga0439445_0043674 | Ga0439445_0043674_740_1063 | 104 |
| 77 | 3300042876 | Ga0451577_1303620 | Ga0451577_1303620_196_525 | 104 |
| 78 | 3300045051 | Ga0451576_0176909 | Ga0451576_0176909_1019_1342 | 104 |
| 79 | 3300046460 | Ga0495638_0000025 | Ga0495638_0000025_339362_339685 | 104 |
| 80 | 3300046523 | Ga0495644_0004642 | Ga0495644_0004642_1858_2184 | 104 |
| 81 | 3300046558 | Ga0495633_0450970 | Ga0495633_0450970_38_364 | 104 |
| 82 | 3300047318 | Ga0495636_0683087 | Ga0495636_0683087_139_465 | 104 |
| 83 | 3300047445 | Ga0495677_0016819 | Ga0495677_0016819_1346_1672 | 104 |
| 84 | 3300047447 | Ga0495685_062054 | Ga0495685_062054_911_1237 | 104 |
| 85 | 3300049132 | Ga0501343_025863 | Ga0501343_025863_129_458 | 104 |
| 86 | 3300049528 | Ga0501312_055872 | Ga0501312_055872_309_638 | 104 |
| 87 | 3300049531 | Ga0501315_057177 | Ga0501315_057177_102_431 | 104 |
| 88 | 3300049536 | Ga0501320_070385 | Ga0501320_070385_150_467 | 104 |
| 89 | 3300049551 | Ga0501335_010332 | Ga0501335_010332_184_513 | 104 |
| 90 | 3300049556 | Ga0501340_024027 | Ga0501340_024027_73_402 | 104 |
| 91 | 3300049585 | Ga0501069_0179779 | Ga0501069_0179779_725_1048 | 104 |
| 92 | 3300050511 | nmdc:mga08y16_273049_c1 | nmdc:mga08y16_273049_c1_721_1044 | 104 |
| 93 | 3300053105 | Ga0500557_002520 | Ga0500557_002520_1971_2294 | 104 |
| 94 | 3300053153 | Ga0500616_0000024 | Ga0500616_0000024_338597_338920 | 104 |
| 95 | 3300053153 | Ga0500616_0015484 | Ga0500616_0015484_1496_1819 | 104 |
| 96 | 3300053156 | Ga0500622_0286441 | Ga0500622_0286441_113_436 | 104 |
| 97 | iso_pu_bacteria | 2902048731 | 2902051114 | 104 |
| 98 | 3300001979 | JGI24740J21852_10027059 | JGI24740J21852_100270593 | 105 |
| 99 | 3300002774 | JGI25150J39212_1000014 | JGI25150J39212_10000144 | 105 |
| 100 | 3300003187 | JGI25151J46595_10000042 | JGI25151J46595_100000424 | 105 |
| 101 | 3300003215 | JGI25153J46596_10000009 | JGI25153J46596_100000094 | 105 |
| 102 | 3300003322 | rootL2_10344690 | rootL2_103446901 | 105 |
| 103 | 3300003791 | Ga0055530_10039940 | Ga0055530_100399402 | 105 |
| 104 | 3300005288 | Ga0065714_10069650 | Ga0065714_100696504 | 105 |
| 105 | 3300005289 | Ga0065704_10222255 | Ga0065704_102222552 | 105 |
| 106 | 3300005327 | Ga0070658_10017399 | Ga0070658_100173993 | 105 |
| 107 | 3300005334 | Ga0068869_100522852 | Ga0068869_1005228521 | 105 |
| 108 | 3300005338 | Ga0068868_101519550 | Ga0068868_1015195501 | 105 |
| 109 | 3300005364 | Ga0070673_100943913 | Ga0070673_1009439132 | 105 |
| 110 | 3300005455 | Ga0070663_100003942 | Ga0070663_1000039427 | 105 |
| 111 | 3300005563 | Ga0068855_100627813 | Ga0068855_1006278132 | 105 |
| 112 | 3300005577 | Ga0068857_100906937 | Ga0068857_1009069372 | 105 |
| 113 | 3300005614 | Ga0068856_100639046 | Ga0068856_1006390462 | 105 |
| 114 | 3300005614 | Ga0068856_102403338 | Ga0068856_1024033382 | 105 |
| 115 | 3300005615 | Ga0070702_101679262 | Ga0070702_1016792621 | 105 |
| 116 | 3300005616 | Ga0068852_100451012 | Ga0068852_1004510122 | 105 |
| 117 | 3300005843 | Ga0068860_102792910 | Ga0068860_1027929102 | 105 |
| 118 | 3300006173 | Ga0070716_101336715 | Ga0070716_1013367152 | 105 |
| 119 | 3300009036 | Ga0105244_10166511 | Ga0105244_101665112 | 105 |
| 120 | 3300009093 | Ga0105240_11895356 | Ga0105240_118953562 | 105 |
| 121 | 3300009545 | Ga0105237_10068445 | Ga0105237_100684454 | 105 |
| 122 | 3300010375 | Ga0105239_13298970 | Ga0105239_132989702 | 105 |
| 123 | 3300013100 | Ga0157373_10083894 | Ga0157373_100838942 | 105 |
| 124 | 3300013102 | Ga0157371_10001108 | Ga0157371_100011082 | 105 |
| 125 | 3300013102 | Ga0157371_10003740 | Ga0157371_1000374011 | 105 |
| 126 | 3300013102 | Ga0157371_10096323 | Ga0157371_100963232 | 105 |
| 127 | 3300013104 | Ga0157370_10000935 | Ga0157370_100009353 | 105 |
| 128 | 3300013104 | Ga0157370_10012943 | Ga0157370_100129437 | 105 |
| 129 | 3300013104 | Ga0157370_10039142 | Ga0157370_100391425 | 105 |
| 130 | 3300013104 | Ga0157370_10104346 | Ga0157370_101043462 | 105 |
| 131 | 3300013104 | Ga0157370_10297292 | Ga0157370_102972922 | 105 |
| 132 | 3300013104 | Ga0157370_10350123 | Ga0157370_103501232 | 105 |
| 133 | 3300013104 | Ga0157370_11118425 | Ga0157370_111184252 | 105 |
| 134 | 3300013105 | Ga0157369_10000897 | Ga0157369_100008972 | 105 |
| 135 | 3300013105 | Ga0157369_10001172 | Ga0157369_1000117225 | 105 |
| 136 | 3300013306 | Ga0163162_10001647 | Ga0163162_1000164716 | 105 |
| 137 | 3300013307 | Ga0157372_10000042 | Ga0157372_10000042139 | 105 |
| 138 | 3300013307 | Ga0157372_10001546 | Ga0157372_1000154618 | 105 |
| 139 | 3300013308 | Ga0157375_10174848 | Ga0157375_101748482 | 105 |
| 140 | 3300013308 | Ga0157375_10282937 | Ga0157375_102829373 | 105 |
| 141 | 3300013308 | Ga0157375_13132668 | Ga0157375_131326682 | 105 |
| 142 | 3300014497 | Ga0182008_10000024 | Ga0182008_10000024155 | 105 |
| 143 | 3300014497 | Ga0182008_10001650 | Ga0182008_100016503 | 105 |
| 144 | 3300014497 | Ga0182008_10001930 | Ga0182008_1000193010 | 105 |
| 145 | 3300015261 | Ga0182006_1000853 | Ga0182006_100085313 | 105 |
| 146 | 3300015261 | Ga0182006_1001310 | Ga0182006_10013102 | 105 |
| 147 | 3300015261 | Ga0182006_1012671 | Ga0182006_10126713 | 105 |
| 148 | 3300015261 | Ga0182006_1177639 | Ga0182006_11776391 | 105 |
| 149 | 3300015262 | Ga0182007_10000002 | Ga0182007_100000022 | 105 |
| 150 | 3300015682 | Ga0183373_1004 | Ga0183373_1004478 | 105 |
| 151 | 3300015687 | Ga0183368_1131 | Ga0183368_11312 | 105 |
| 152 | 3300017792 | Ga0163161_10002656 | Ga0163161_100026561 | 105 |
| 153 | 3300017792 | Ga0163161_10031005 | Ga0163161_100310054 | 105 |
| 154 | 3300017792 | Ga0163161_10226018 | Ga0163161_102260181 | 105 |
| 155 | 3300017792 | Ga0163161_11928780 | Ga0163161_119287802 | 105 |
| 156 | 3300020077 | Ga0206351_10630490 | Ga0206351_106304903 | 105 |
| 157 | 3300020080 | Ga0206350_11033248 | Ga0206350_110332481 | 105 |
| 158 | 3300025245 | Ga0207425_1000023 | Ga0207425_10000234 | 105 |
| 159 | 3300025258 | Ga0209129_1000032 | Ga0209129_1000032269 | 105 |
| 160 | 3300025292 | Ga0209676_1000009 | Ga0209676_10000093 | 105 |
| 161 | 3300025294 | Ga0209025_1000047 | Ga0209025_1000047269 | 105 |
| 162 | 3300025297 | Ga0209758_1000145 | Ga0209758_10001454 | 105 |
| 163 | 3300025298 | Ga0209050_1000094 | Ga0209050_10000943 | 105 |
| 164 | 3300025914 | Ga0207671_10063810 | Ga0207671_100638102 | 105 |
| 165 | 3300025939 | Ga0207665_10159914 | Ga0207665_101599142 | 105 |
| 166 | 3300025939 | Ga0207665_10975995 | Ga0207665_109759952 | 105 |
| 167 | 3300025942 | Ga0207689_10647387 | Ga0207689_106473871 | 105 |
| 168 | 3300025949 | Ga0207667_10285208 | Ga0207667_102852082 | 105 |
| 169 | 3300026023 | Ga0207677_11727293 | Ga0207677_117272931 | 105 |
| 170 | 3300026067 | Ga0207678_10018368 | Ga0207678_100183685 | 105 |
| 171 | 3300026078 | Ga0207702_10137034 | Ga0207702_101370342 | 105 |
| 172 | 3300026078 | Ga0207702_10921997 | Ga0207702_109219972 | 105 |
| 173 | 3300026078 | Ga0207702_12346939 | Ga0207702_123469392 | 105 |
| 174 | 3300028794 | Ga0307515_10188269 | Ga0307515_101882693 | 105 |
| 175 | 3300028800 | Ga0265338_10004546 | Ga0265338_100045462 | 105 |
| 176 | 3300031251 | Ga0265327_10027920 | Ga0265327_100279203 | 105 |
| 177 | 3300031251 | Ga0265327_10032581 | Ga0265327_100325812 | 105 |
| 178 | 3300031251 | Ga0265327_10051688 | Ga0265327_100516881 | 105 |
| 179 | 3300031691 | Ga0316579_10105594 | Ga0316579_101055942 | 105 |
| 180 | 3300031727 | Ga0316576_10037344 | Ga0316576_100373444 | 105 |
| 181 | 3300031727 | Ga0316576_10148253 | Ga0316576_101482532 | 105 |
| 182 | 3300031727 | Ga0316576_10612791 | Ga0316576_106127911 | 105 |
| 183 | 3300031727 | Ga0316576_10661162 | Ga0316576_106611622 | 105 |
| 184 | 3300031728 | Ga0316578_10014959 | Ga0316578_100149592 | 105 |
| 185 | 3300031731 | Ga0307405_10000015 | Ga0307405_10000015170 | 105 |
| 186 | 3300031733 | Ga0316577_10029324 | Ga0316577_100293242 | 105 |
| 187 | 3300031901 | Ga0307406_12074957 | Ga0307406_120749571 | 105 |
| 188 | 3300031903 | Ga0307407_10000054 | Ga0307407_1000005439 | 105 |
| 189 | 3300031995 | Ga0307409_100091553 | Ga0307409_1000915531 | 105 |
| 190 | 3300032002 | Ga0307416_100000755 | Ga0307416_10000075512 | 105 |
| 191 | 3300032004 | Ga0307414_10017000 | Ga0307414_100170005 | 105 |
| 192 | 3300032004 | Ga0307414_10045637 | Ga0307414_100456372 | 105 |
| 193 | 3300032005 | Ga0307411_10246577 | Ga0307411_102465772 | 105 |
| 194 | 3300032137 | Ga0316585_10024500 | Ga0316585_100245003 | 105 |
| 195 | 3300032168 | Ga0316593_10042828 | Ga0316593_100428283 | 105 |
| 196 | 3300032168 | Ga0316593_10100297 | Ga0316593_101002972 | 105 |
| 197 | 3300033524 | Ga0316592_1017959 | Ga0316592_10179592 | 105 |
| 198 | 3300033528 | Ga0316588_1145114 | Ga0316588_11451142 | 105 |
| 199 | 3300033541 | Ga0316596_1064618 | Ga0316596_10646182 | 105 |
| 200 | 3300033541 | Ga0316596_1074220 | Ga0316596_10742201 | 105 |
| 201 | 3300033541 | Ga0316596_1172853 | Ga0316596_11728531 | 105 |
| 202 | 3300035398 | Ga0316574_0393350 | Ga0316574_0393350_38_373 | 105 |
| 203 | 3300035398 | Ga0316574_0698060 | Ga0316574_0698060_56_391 | 105 |
| 204 | 3300035398 | Ga0316574_0767738 | Ga0316574_0767738_57_392 | 105 |
| 205 | 3300036712 | Ga0316584_0000938 | Ga0316584_0000938_590_916 | 105 |
| 206 | 3300036712 | Ga0316584_0732528 | Ga0316584_0732528_26_361 | 105 |
| 207 | 3300036712 | Ga0316584_0750412 | Ga0316584_0750412_171_506 | 105 |
| 208 | 3300037312 | Ga0395899_0000238 | Ga0395899_0000238_72030_72365 | 105 |
| 209 | 3300037312 | Ga0395899_0585015 | Ga0395899_0585015_117_452 | 105 |
| 210 | 3300037418 | Ga0395900_0031111 | Ga0395900_0031111_4337_4672 | 105 |
| 211 | 3300037471 | Ga0395905_0000003 | Ga0395905_0000003_295318_295650 | 105 |
| 212 | 3300038443 | Ga0395901_0666049 | Ga0395901_0666049_625_960 | 105 |
| 213 | 3300038726 | Ga0400490_46880 | Ga0400490_46880_4529_4864 | 105 |
| 214 | 3300041444 | Ga0451790_18693 | Ga0451790_18693_103_429 | 105 |
| 215 | 3300041444 | Ga0451790_45183 | Ga0451790_45183_11_334 | 105 |
| 216 | 3300041460 | Ga0451802_1034903 | Ga0451802_1034903_106_432 | 105 |
| 217 | 3300041508 | Ga0451852_17740 | Ga0451852_17740_222_554 | 105 |
| 218 | 3300041512 | Ga0451853_3296407 | Ga0451853_3296407_101_427 | 105 |
| 219 | 3300042876 | Ga0451577_0000197 | Ga0451577_0000197_8223_8561 | 105 |
| 220 | 3300042876 | Ga0451577_0000208 | Ga0451577_0000208_112295_112621 | 105 |
| 221 | 3300042876 | Ga0451577_0001281 | Ga0451577_0001281_6508_6846 | 105 |
| 222 | 3300042876 | Ga0451577_0020262 | Ga0451577_0020262_904_1242 | 105 |
| 223 | 3300042876 | Ga0451577_0046879 | Ga0451577_0046879_2077_2415 | 105 |
| 224 | 3300042876 | Ga0451577_0068512 | Ga0451577_0068512_722_1048 | 105 |
| 225 | 3300042876 | Ga0451577_0150741 | Ga0451577_0150741_675_1013 | 105 |
| 226 | 3300042876 | Ga0451577_0182814 | Ga0451577_0182814_468_797 | 105 |
| 227 | 3300042876 | Ga0451577_0197631 | Ga0451577_0197631_581_919 | 105 |
| 228 | 3300042876 | Ga0451577_0294578 | Ga0451577_0294578_351_674 | 105 |
| 229 | 3300042876 | Ga0451577_0486774 | Ga0451577_0486774_64_402 | 105 |
| 230 | 3300042876 | Ga0451577_0595720 | Ga0451577_0595720_289_615 | 105 |
| 231 | 3300042876 | Ga0451577_0924863 | Ga0451577_0924863_242_574 | 105 |
| 232 | 3300042876 | Ga0451577_1418926 | Ga0451577_1418926_218_556 | 105 |
| 233 | 3300044656 | Ga0466969_0173813 | Ga0466969_0173813_203_538 | 105 |
| 234 | 3300044673 | Ga0453683_0000015 | Ga0453683_0000015_273491_273829 | 105 |
| 235 | 3300044673 | Ga0453683_0000357 | Ga0453683_0000357_4210_4536 | 105 |
| 236 | 3300044673 | Ga0453683_0000370 | Ga0453683_0000370_5238_5576 | 105 |
| 237 | 3300044673 | Ga0453683_0016013 | Ga0453683_0016013_4080_4403 | 105 |
| 238 | 3300044673 | Ga0453683_0058460 | Ga0453683_0058460_778_1104 | 105 |
| 239 | 3300044673 | Ga0453683_0074879 | Ga0453683_0074879_537_863 | 105 |
| 240 | 3300044673 | Ga0453683_0095320 | Ga0453683_0095320_840_1178 | 105 |
| 241 | 3300044673 | Ga0453683_0277262 | Ga0453683_0277262_629_967 | 105 |
| 242 | 3300044673 | Ga0453683_0311403 | Ga0453683_0311403_60_395 | 105 |
| 243 | 3300044673 | Ga0453683_0417760 | Ga0453683_0417760_393_719 | 105 |
| 244 | 3300044673 | Ga0453683_0749124 | Ga0453683_0749124_131_469 | 105 |
| 245 | 3300044684 | Ga0466966_0013924 | Ga0466966_0013924_1610_1945 | 105 |
| 246 | 3300044712 | Ga0453684_0000148 | Ga0453684_0000148_16747_17085 | 105 |
| 247 | 3300044712 | Ga0453684_0000668 | Ga0453684_0000668_10200_10526 | 105 |
| 248 | 3300044712 | Ga0453684_0000961 | Ga0453684_0000961_60046_60384 | 105 |
| 249 | 3300044712 | Ga0453684_0001184 | Ga0453684_0001184_26903_27241 | 105 |
| 250 | 3300044712 | Ga0453684_0001433 | Ga0453684_0001433_58096_58434 | 105 |
| 251 | 3300044712 | Ga0453684_0002194 | Ga0453684_0002194_14637_14975 | 105 |
| 252 | 3300044712 | Ga0453684_0007236 | Ga0453684_0007236_3826_4161 | 105 |
| 253 | 3300044712 | Ga0453684_0013673 | Ga0453684_0013673_9952_10290 | 105 |
| 254 | 3300044712 | Ga0453684_0025412 | Ga0453684_0025412_4661_4999 | 105 |
| 255 | 3300044712 | Ga0453684_0032591 | Ga0453684_0032591_5357_5692 | 105 |
| 256 | 3300044712 | Ga0453684_0055610 | Ga0453684_0055610_1921_2247 | 105 |
| 257 | 3300044712 | Ga0453684_0084650 | Ga0453684_0084650_3546_3878 | 105 |
| 258 | 3300044712 | Ga0453684_0121092 | Ga0453684_0121092_605_928 | 105 |
| 259 | 3300044712 | Ga0453684_0195954 | Ga0453684_0195954_1005_1343 | 105 |
| 260 | 3300044712 | Ga0453684_0255533 | Ga0453684_0255533_316_642 | 105 |
| 261 | 3300044712 | Ga0453684_0545051 | Ga0453684_0545051_398_736 | 105 |
| 262 | 3300044712 | Ga0453684_1706134 | Ga0453684_1706134_290_628 | 105 |
| 263 | 3300045049 | Ga0466959_0093551 | Ga0466959_0093551_1795_2130 | 105 |
| 264 | 3300045051 | Ga0451576_0000127 | Ga0451576_0000127_138886_139224 | 105 |
| 265 | 3300045051 | Ga0451576_0000291 | Ga0451576_0000291_112295_112621 | 105 |
| 266 | 3300045051 | Ga0451576_0000720 | Ga0451576_0000720_58096_58434 | 105 |
| 267 | 3300045051 | Ga0451576_0008015 | Ga0451576_0008015_5373_5702 | 105 |
| 268 | 3300045051 | Ga0451576_0009705 | Ga0451576_0009705_9403_9741 | 105 |
| 269 | 3300045051 | Ga0451576_0020693 | Ga0451576_0020693_1319_1657 | 105 |
| 270 | 3300045051 | Ga0451576_0026157 | Ga0451576_0026157_4772_5110 | 105 |
| 271 | 3300045051 | Ga0451576_0039632 | Ga0451576_0039632_497_820 | 105 |
| 272 | 3300045051 | Ga0451576_0051312 | Ga0451576_0051312_392_718 | 105 |
| 273 | 3300045051 | Ga0451576_0205130 | Ga0451576_0205130_84_422 | 105 |
| 274 | 3300045051 | Ga0451576_0278718 | Ga0451576_0278718_629_964 | 105 |
| 275 | 3300045051 | Ga0451576_0323153 | Ga0451576_0323153_958_1290 | 105 |
| 276 | 3300045051 | Ga0451576_0359258 | Ga0451576_0359258_398_736 | 105 |
| 277 | 3300045051 | Ga0451576_0662966 | Ga0451576_0662966_40_366 | 105 |
| 278 | 3300045836 | Ga0466958_0111878 | Ga0466958_0111878_643_978 | 105 |
| 279 | 3300046507 | Ga0495606_0108338 | Ga0495606_0108338_814_1140 | 105 |
| 280 | 3300046512 | Ga0495610_0000197 | Ga0495610_0000197_1613_1942 | 105 |
| 281 | 3300046512 | Ga0495610_0000974 | Ga0495610_0000974_1715_2041 | 105 |
| 282 | 3300046520 | Ga0495637_0014865 | Ga0495637_0014865_1708_2037 | 105 |
| 283 | 3300048918 | Ga0496115_0251447 | Ga0496115_0251447_1022_1348 | 105 |
| 284 | 3300048925 | Ga0496122_0001975 | Ga0496122_0001975_2239_2565 | 105 |
| 285 | 3300048926 | Ga0496123_0011770 | Ga0496123_0011770_6008_6334 | 105 |
| 286 | 3300049679 | Ga0501249_013491 | Ga0501249_013491_46_372 | 105 |
| 287 | 3300049776 | Ga0501280_063715 | Ga0501280_063715_181_510 | 105 |
| 288 | 3300059491 | Ga0587070_038449 | Ga0587070_038449_398_745 | 105 |
| 289 | 3300059493 | Ga0587077_036296 | Ga0587077_036296_474_821 | 105 |
| 290 | 3300059505 | Ga0587083_0208016 | Ga0587083_0208016_70_417 | 105 |
| 291 | 3300042876 | Ga0451577_1489264 | Ga0451577_1489264_166_507 | 106 |
| 292 | 3300044712 | Ga0453684_0535915 | Ga0453684_0535915_774_1115 | 106 |
| 293 | 3300005618 | Ga0068864_101420056 | Ga0068864_1014200561 | 107 |
| 294 | 3300026095 | Ga0207676_11274408 | Ga0207676_112744081 | 107 |
| 295 | 3300044673 | Ga0453683_0191021 | Ga0453683_0191021_88_417 | 107 |
| 296 | 3300044673 | Ga0453683_0591053 | Ga0453683_0591053_21_350 | 107 |
| 297 | 3300044673 | Ga0453683_0914500 | Ga0453683_0914500_155_484 | 107 |
| 298 | 3300060346 | Ga0587111_0023489 | Ga0587111_0023489_103_426 | 107 |
| 299 | 3300005354 | Ga0070675_102000667 | Ga0070675_1020006671 | 111 |
| 300 | 3300005435 | Ga0070714_101775635 | Ga0070714_1017756352 | 111 |
| 301 | 3300059490 | Ga0587066_094103 | Ga0587066_094103_58_393 | 111 |
| 302 | 3300059491 | Ga0587070_045712 | Ga0587070_045712_171_506 | 111 |
| 303 | 3300059503 | Ga0587080_131562 | Ga0587080_131562_83_418 | 111 |
| 304 | 3300059505 | Ga0587083_0075529 | Ga0587083_0075529_363_698 | 111 |
| 305 | 3300059508 | Ga0587088_192682 | Ga0587088_192682_147_482 | 111 |
| 306 | 3300059626 | Ga0587115_086623 | Ga0587115_086623_147_482 | 111 |
| 307 | 3300060344 | Ga0587071_080748 | Ga0587071_080748_82_417 | 111 |
| 308 | 2162886012 | MBSR1b_contig_7652595 | MBSR1b_0453.00007800 | 114 |
| 309 | 3300005435 | Ga0070714_100739712 | Ga0070714_1007397122 | 114 |
| 310 | 3300025929 | Ga0207664_11016082 | Ga0207664_110160821 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zjc-assembly1.cif.gz_A | crystal structure of gmppnp-bound human gimap7 l100q variant | 0.7886 | 25 | 94 |
| 6koq-assembly1.cif.gz_E | mycobacterium tuberculosis initial transcription complex comprising sigma h and 5'-oh rna of 10 nt | 0.6624 | 1 | 99 |
| 6koq-assembly1.cif.gz_E | mycobacterium tuberculosis initial transcription complex comprising sigma h and 5'-oh rna of 10 nt | 0.621 | 1 | 99 |
| 2z3y-assembly1.cif.gz_A | crystal structure of lysine-specific demethylase1 | 0.5411 | 15 | 94 |
| 2z5u-assembly1.cif.gz_A | crystal structure of lysine-specific histone demethylase 1 | 0.5303 | 15 | 94 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1d5aA04 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain | 0.5896 | 37 | 78 | 1.10.287.690 |
| 4k8xA04 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain | 0.5871 | 37 | 78 | 1.10.287.690 |
| 5vu5A04 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain | 0.5731 | 37 | 78 | 1.10.287.690 |
| 1zw0H00 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C | 0.5672 | 25 | 91 | 1.20.5.420 |
| 2z3yA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain | 0.5411 | 15 | 94 | 1.10.287.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A076HU56-F1-model_v4 | DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) | 0.9884 | 16 | 99 |
GO:0000428
GO:0003677 GO:0003899 GO:0006351 |
| AF-A0A519JXN0-F1-model_v4 | DNA-directed RNA polymerase subunit omega | 0.9617 | 11 | 83 |
GO:0000428
GO:0003677 GO:0003899 GO:0006351 |
| AF-A0A6I0E185-F1-model_v4 | DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) | 0.9544 | 11 | 99 |
GO:0000428
GO:0001054 GO:0001055 GO:0001056 GO:0001057 GO:0001058 GO:0001066 GO:0003677 |
| AF-A0A7X8IHD2-F1-model_v4 | DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) | 0.9506 | 9 | 101 |
GO:0000428
GO:0003677 GO:0003899 GO:0006351 |
| AF-J0NZ47-F1-model_v4 | RNA polymerase Rpb6 | 0.9493 | 10 | 102 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar