F400657

General Info

Members Datasets Scaffolds Average Seq Length
310 178 620 217

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10031584|Ga0075366_100315843
Length 248
Sequence MGDIIKKEDITAAASIADNEIIARVIRGEKDLFAIIVNRYNQRLYRVAMSIINNDTEAEDIMQSAYIKAYENLQKFEFRSGFGTWLTRILINESLLQLKKRKQSLTMNNDIIEDKMGQPATTEAHTPLSATLNGELREILEEAIRQLPEKYRTVFVMREIENMNVAETQECLAISEVNVKVRLNRSKALLRNALSRYYKKEDVFHFHLTRCSRVTDYVMQQINNLENNEQTXXEQGTRNIESRSERLI

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
152 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
153 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
154 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
155 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
156 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
157 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
158 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
163 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
171 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
175 2738541284 Pedobacter sp. YR016 Isolate Unclassified
176 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
177 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
178 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.9
Nodule 0
Rhizoplane 0.65
Rhizosphere 94.19
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10031584 3300006195 Bacteria 3117
2 ARSoilOldRDRAFT_c004607 3300000044 Bacteria 1166
3 JGI24736J21556_1006658 3300001904 Bacteria 1945
4 JGI24740J21852_10036634 3300001979 Bacteria 1521
5 JGI24737J22298_10001881 3300001990 Bacteria 7501
6 JGI24737J22298_10006491 3300001990 Bacteria 3995
7 JGI24737J22298_10012549 3300001990 Bacteria 2763
8 JGI24737J22298_10024042 3300001990 Bacteria 1930
9 JGI24735J21928_10000010 3300002067 Bacteria 237152
10 JGI24735J21928_10017120 3300002067 Bacteria 2242
11 JGI24751J29686_10001543 3300002459 Bacteria 4776
12 JGI25406J46586_10001864 3300003203 Bacteria 9896
13 rootH1_10167010 3300003323 Bacteria 7625
14 rootH1_10275605 3300003323 Bacteria 2636
15 Ga0070658_10000026 3300005327 Bacteria 171716
16 Ga0070676_10008344 3300005328 Bacteria 5582
17 Ga0070670_100370462 3300005331 Bacteria 1261
18 Ga0070677_10005721 3300005333 Bacteria 4109
19 Ga0068869_100008777 3300005334 Bacteria 6534
20 Ga0068869_100600784 3300005334 Bacteria 929
21 Ga0070680_100022599 3300005336 Bacteria 5011
22 Ga0070682_100015867 3300005337 Bacteria 4373
23 Ga0068868_100053687 3300005338 Bacteria 3175
24 Ga0068868_100676544 3300005338 Bacteria 921
25 Ga0070660_100024123 3300005339 Bacteria 4512
26 Ga0070660_100190346 3300005339 Unclassified 1662
27 Ga0070691_10001848 3300005341 Bacteria 9231
28 Ga0070668_100073405 3300005347 Unclassified 2667
29 Ga0070668_100654893 3300005347 Bacteria 923
30 Ga0070675_100020404 3300005354 Bacteria 5289
31 Ga0070675_100441380 3300005354 Bacteria 1166
32 Ga0070675_100748514 3300005354 Bacteria 892
33 Ga0070674_100041890 3300005356 Bacteria 3107
34 Ga0070673_100092621 3300005364 Bacteria 2473
35 Ga0070673_100245566 3300005364 Bacteria 1558
36 Ga0070673_100516064 3300005364 Bacteria 1082
37 Ga0070659_100011210 3300005366 Bacteria 6623
38 Ga0070659_100222882 3300005366 Unclassified 1557
39 Ga0070659_100809198 3300005366 Unclassified 815
40 Ga0070667_100036970 3300005367 Unclassified 4094
41 Ga0070663_100025381 3300005455 Bacteria 4000
42 Ga0070678_100005156 3300005456 Bacteria 7508
43 Ga0070678_100015271 3300005456 Bacteria 4876
44 Ga0070662_100000384 3300005457 Bacteria 26270
45 Ga0070681_10154255 3300005458 Bacteria 2222
46 Ga0068867_100993493 3300005459 Bacteria 760
47 Ga0070679_100013709 3300005530 Bacteria 7765
48 Ga0070684_100049653 3300005535 Bacteria 3642
49 Ga0068853_100015115 3300005539 Bacteria 6346
50 Ga0070672_100018696 3300005543 Bacteria 5017
51 Ga0070672_100172780 3300005543 Bacteria 1798
52 Ga0070672_100472591 3300005543 Bacteria 1082
53 Ga0070693_100032859 3300005547 Bacteria 2857
54 Ga0070665_100000267 3300005548 Bacteria 85526
55 Ga0070665_100092492 3300005548 Bacteria 3029
56 Ga0068855_100015597 3300005563 Bacteria 9141
57 Ga0068855_100055664 3300005563 Unclassified 4645
58 Ga0068855_100261506 3300005563 Unclassified 1927
59 Ga0068855_101545728 3300005563 Bacteria 680
60 Ga0068857_100131631 3300005577 Bacteria 2256
61 Ga0068857_100172349 3300005577 Bacteria 1967
62 Ga0068857_100271689 3300005577 Bacteria 1558
63 Ga0068856_100004615 3300005614 Bacteria 13688
64 Ga0068856_100233277 3300005614 Bacteria 1855
65 Ga0068852_101049565 3300005616 Bacteria 834
66 Ga0068859_100025296 3300005617 Bacteria 5955
67 Ga0068859_100055659 3300005617 Bacteria 3979
68 Ga0068866_10059008 3300005718 Bacteria 1983
69 Ga0068861_100166929 3300005719 Bacteria 1821
70 Ga0068861_100356176 3300005719 Bacteria 1285
71 Ga0068870_10005695 3300005840 Bacteria 5453
72 Ga0068860_100021490 3300005843 Bacteria 6248
73 Ga0068860_100075255 3300005843 Bacteria 3211
74 Ga0068862_100010249 3300005844 Bacteria 7733
75 Ga0068862_100405803 3300005844 Bacteria 1276
76 Ga0081539_10000914 3300005985 Bacteria 55819
77 Ga0075366_10003747 3300006195 Bacteria 8080
78 Ga0097621_100011903 3300006237 Bacteria 6434
79 Ga0097621_100083351 3300006237 Bacteria 2664
80 Ga0097621_100101807 3300006237 Unclassified 2417
81 Ga0097621_100874131 3300006237 Bacteria 836
82 Ga0068871_100116523 3300006358 Bacteria 2252
83 Ga0075428_100137289 3300006844 Bacteria 2658
84 Ga0075430_100041506 3300006846 Bacteria 3892
85 Ga0075429_100035880 3300006880 Bacteria 4312
86 Ga0068865_100006144 3300006881 Bacteria 7321
87 Ga0097620_100025296 3300006931 Bacteria 5955
88 Ga0097620_100055660 3300006931 Bacteria 3979
89 Ga0105240_10002931 3300009093 Bacteria 26924
90 Ga0105240_10045182 3300009093 Bacteria 5590
91 Ga0105240_10082774 3300009093 Bacteria 3941
92 Ga0105240_10104348 3300009093 Bacteria 3442
93 Ga0105240_10205807 3300009093 Unclassified 2303
94 Ga0105240_10221662 3300009093 Bacteria 2203
95 Ga0105240_10577987 3300009093 Bacteria 1240
96 Ga0111539_10725846 3300009094 Bacteria 1157
97 Ga0105241_10000855 3300009174 Bacteria 23116
98 Ga0105241_10005523 3300009174 Bacteria 9341
99 Ga0105241_10043132 3300009174 Bacteria 3415
100 Ga0105241_10049864 3300009174 Bacteria 3190
101 Ga0105241_10300586 3300009174 Unclassified 1377
102 Ga0105242_10082867 3300009176 Bacteria 2685
103 Ga0105242_10091889 3300009176 Bacteria 2556
104 Ga0105237_10000128 3300009545 Bacteria 106338
105 Ga0105237_10007207 3300009545 Bacteria 12208
106 Ga0105237_10268215 3300009545 Bacteria 1710
107 Ga0105237_10543104 3300009545 Unclassified 1169
108 Ga0105249_10019755 3300009553 Bacteria 6015
109 Ga0105239_10000042 3300010375 Bacteria 199662
110 Ga0105239_10006085 3300010375 Bacteria 14049
111 Ga0105239_10327746 3300010375 Bacteria 1727
112 Ga0105239_10779527 3300010375 Bacteria 1095
113 Ga0105246_10066945 3300011119 Bacteria 2516
114 Ga0105246_10370856 3300011119 Bacteria 1179
115 Ga0105246_10665251 3300011119 Bacteria 908
116 Ga0157373_10000169 3300013100 Bacteria 53279
117 Ga0157373_10002741 3300013100 Bacteria 13341
118 Ga0157373_10052759 3300013100 Bacteria 2892
119 Ga0157371_10000678 3300013102 Bacteria 40299
120 Ga0157371_10014913 3300013102 Bacteria 5848
121 Ga0157371_10060454 3300013102 Bacteria 2687
122 Ga0157371_10114349 3300013102 Bacteria 1916
123 Ga0157370_10017308 3300013104 Bacteria 7276
124 Ga0157370_10044602 3300013104 Bacteria 4259
125 Ga0157370_10306404 3300013104 Bacteria 1466
126 Ga0157370_10410279 3300013104 Bacteria 1246
127 Ga0157369_10001000 3300013105 Bacteria 35684
128 Ga0157369_10059384 3300013105 Bacteria 4124
129 Ga0157369_10084857 3300013105 Bacteria 3384
130 Ga0157369_10355153 3300013105 Bacteria 1522
131 Ga0157369_10669892 3300013105 Bacteria 1069
132 Ga0157374_10015423 3300013296 Bacteria 6702
133 Ga0157374_10027237 3300013296 Bacteria 5153
134 Ga0157374_10030764 3300013296 Bacteria 4877
135 Ga0157374_10646389 3300013296 Bacteria 1069
136 Ga0157374_10818587 3300013296 Unclassified 947
137 Ga0157378_10056070 3300013297 Bacteria 3510
138 Ga0157378_10204903 3300013297 Bacteria 1867
139 Ga0163162_10000074 3300013306 Bacteria 91138
140 Ga0157372_10000048 3300013307 Bacteria 142757
141 Ga0157372_10000243 3300013307 Bacteria 60266
142 Ga0157372_10001626 3300013307 Bacteria 24372
143 Ga0157372_10004992 3300013307 Bacteria 14096
144 Ga0157372_10082184 3300013307 Bacteria 3647
145 Ga0157372_10106232 3300013307 Unclassified 3211
146 Ga0157375_10269852 3300013308 Bacteria 1863
147 Ga0157375_10366739 3300013308 Bacteria 1606
148 Ga0157375_11207404 3300013308 Bacteria 887
149 Ga0163163_10445907 3300014325 Bacteria 1354
150 Ga0163163_10476495 3300014325 Bacteria 1309
151 Ga0157380_10058817 3300014326 Bacteria 3065
152 Ga0157380_10222972 3300014326 Bacteria 1688
153 Ga0182008_10020877 3300014497 Bacteria 3369
154 Ga0182008_10030613 3300014497 Bacteria 2712
155 Ga0182008_10056851 3300014497 Bacteria 1932
156 Ga0157377_10306652 3300014745 Bacteria 1050
157 Ga0157379_10412408 3300014968 Unclassified 1243
158 Ga0157379_10836857 3300014968 Bacteria 870
159 Ga0157376_10170976 3300014969 Bacteria 1979
160 Ga0157376_10941075 3300014969 Bacteria 884
161 Ga0182007_10004806 3300015262 Bacteria 6063
162 Ga0182007_10029027 3300015262 Unclassified 1896
163 Ga0182007_10030841 3300015262 Bacteria 1830
164 Ga0163161_10085862 3300017792 Bacteria 2322
165 Ga0209026_1003628 3300025250 Bacteria 4955
166 Ga0209233_1009537 3300025261 Bacteria 2948
167 Ga0209455_1002066 3300025272 Bacteria 8110
168 Ga0207682_10037519 3300025893 Bacteria 1963
169 Ga0207642_10088721 3300025899 Bacteria 1522
170 Ga0207680_10024322 3300025903 Bacteria 3323
171 Ga0207647_10000072 3300025904 Bacteria 79050
172 Ga0207647_10001291 3300025904 Bacteria 19269
173 Ga0207645_10002867 3300025907 Bacteria 13357
174 Ga0207643_10014142 3300025908 Bacteria 4332
175 Ga0207705_10000040 3300025909 Bacteria 185735
176 Ga0207654_10001666 3300025911 Bacteria 11606
177 Ga0207654_10003901 3300025911 Bacteria 7514
178 Ga0207707_10071171 3300025912 Bacteria 3030
179 Ga0207695_10005214 3300025913 Bacteria 17375
180 Ga0207695_10021283 3300025913 Bacteria 7405
181 Ga0207695_10038892 3300025913 Bacteria 5116
182 Ga0207695_10068334 3300025913 Bacteria 3641
183 Ga0207695_10109050 3300025913 Bacteria 2751
184 Ga0207695_10408990 3300025913 Bacteria 1241
185 Ga0207671_10000652 3300025914 Bacteria 45361
186 Ga0207671_10001786 3300025914 Bacteria 24101
187 Ga0207671_10413237 3300025914 Bacteria 1073
188 Ga0207660_10054981 3300025917 Bacteria 2842
189 Ga0207657_10019941 3300025919 Bacteria 6352
190 Ga0207652_10088009 3300025921 Bacteria 2724
191 Ga0207650_10068185 3300025925 Bacteria 2671
192 Ga0207650_10210636 3300025925 Bacteria 1561
193 Ga0207650_10634381 3300025925 Bacteria 900
194 Ga0207659_10178867 3300025926 Bacteria 1679
195 Ga0207690_10002663 3300025932 Bacteria 10763
196 Ga0207690_10126239 3300025932 Bacteria 1866
197 Ga0207706_10000043 3300025933 Bacteria 124186
198 Ga0207686_10125280 3300025934 Bacteria 1755
199 Ga0207669_10204411 3300025937 Bacteria 1436
200 Ga0207691_10042581 3300025940 Bacteria 4186
201 Ga0207691_10596662 3300025940 Bacteria 935
202 Ga0207689_10005719 3300025942 Bacteria 11053
203 Ga0207667_10009634 3300025949 Bacteria 11362
204 Ga0207667_10051288 3300025949 Bacteria 4351
205 Ga0207667_10057438 3300025949 Bacteria 4085
206 Ga0207651_10004856 3300025960 Bacteria 6848
207 Ga0207651_10785605 3300025960 Bacteria 843
208 Ga0207712_10021501 3300025961 Bacteria 4236
209 Ga0207712_10788929 3300025961 Bacteria 834
210 Ga0207640_10326277 3300025981 Bacteria 1224
211 Ga0207658_10093387 3300025986 Bacteria 2339
212 Ga0207677_10039038 3300026023 Bacteria 3118
213 Ga0207677_10645378 3300026023 Bacteria 934
214 Ga0207677_10832152 3300026023 Bacteria 828
215 Ga0207639_10015679 3300026041 Bacteria 5347
216 Ga0207639_10067722 3300026041 Bacteria 2779
217 Ga0207639_10128578 3300026041 Bacteria 2093
218 Ga0207639_10748565 3300026041 Unclassified 908
219 Ga0207678_10150067 3300026067 Bacteria 1990
220 Ga0207678_10649365 3300026067 Unclassified 927
221 Ga0207702_10006124 3300026078 Bacteria 10421
222 Ga0207702_10450573 3300026078 Bacteria 1248
223 Ga0207648_10000649 3300026089 Bacteria 39082
224 Ga0207648_10188285 3300026089 Bacteria 1828
225 Ga0207648_10304092 3300026089 Bacteria 1431
226 Ga0207674_10076141 3300026116 Bacteria 3364
227 Ga0207674_10122380 3300026116 Bacteria 2568
228 Ga0207674_10147682 3300026116 Bacteria 2309
229 Ga0207675_100021876 3300026118 Bacteria 5953
230 Ga0207683_10000439 3300026121 Bacteria 38420
231 Ga0207683_10027506 3300026121 Bacteria 4914
232 Ga0207683_10132961 3300026121 Bacteria 2238
233 Ga0268266_10000018 3300028379 Bacteria 569141
234 Ga0268266_10022842 3300028379 Bacteria 5324
235 Ga0268266_10250206 3300028379 Unclassified 1639
236 Ga0268265_10011287 3300028380 Bacteria 6039
237 Ga0268264_10045890 3300028381 Bacteria 3629
238 Ga0316182_1171643 3300030745 Bacteria 1909
239 Ga0307509_10234449 3300031507 Bacteria 1635
240 Ga0307408_100000220 3300031548 Bacteria 61009
241 Ga0307412_10560269 3300031911 Bacteria 961
242 Ga0307414_10177077 3300032004 Bacteria 1711
243 Ga0307414_10473415 3300032004 Bacteria 1103
244 Ga0373936_0064984 3300035113 Unclassified 1496
245 Ga0373935_0518526 3300035692 Bacteria 867
246 Ga0395899_0000050 3300037312 Bacteria 224591
247 Ga0395899_0000327 3300037312 Bacteria 60343
248 Ga0395899_0001258 3300037312 Bacteria 22040
249 Ga0395900_0000122 3300037418 Bacteria 133423
250 Ga0395900_0000231 3300037418 Bacteria 87314
251 Ga0395900_0008411 3300037418 Bacteria 10619
252 Ga0395898_0003522 3300037466 Bacteria 17453
253 Ga0395898_0059552 3300037466 Bacteria 3714
254 Ga0395905_0000261 3300037471 Bacteria 78643
255 Ga0395905_0001611 3300037471 Bacteria 26826
256 Ga0395901_0000236 3300038443 Bacteria 69250
257 Ga0466969_0045668 3300044656 Bacteria 2174
258 Ga0466966_0102549 3300044684 Bacteria 1768
259 Ga0466959_0070105 3300045049 Bacteria 2540
260 Ga0466959_0142066 3300045049 Bacteria 1696
261 Ga0495653_0461867 3300046463 Bacteria 797
262 Ga0495642_0226410 3300046528 Bacteria 817
263 Ga0495625_0128654 3300046660 Unclassified 1717
264 Ga0495661_0000607 3300046665 Bacteria 36518
265 Ga0495686_0065670 3300047472 Bacteria 2243
266 Ga0495686_0223062 3300047472 Unclassified 1071
267 Ga0496115_0198846 3300048918 Bacteria 1656
268 Ga0501034_0035434 3300049571 Bacteria 5059
269 Ga0501036_0596574 3300049572 Unclassified 916
270 Ga0501043_0055735 3300049579 Bacteria 3105
271 Ga0501046_0007063 3300049580 Bacteria 9887
272 Ga0501047_0028443 3300049581 Bacteria 5389
273 Ga0501047_0104895 3300049581 Unclassified 2707
274 Ga0501048_0240952 3300049582 Bacteria 1283
275 Ga0501070_0079472 3300049586 Unclassified 2714
276 Ga0501073_0003046 3300049589 Bacteria 12568
277 Ga0501073_0129038 3300049589 Unclassified 1752
278 Ga0501074_0010792 3300049590 Bacteria 6633
279 Ga0501074_0091854 3300049590 Unclassified 2174
280 Ga0501202_008256 3300049652 Bacteria 1896
281 Ga0501217_002539 3300049661 Bacteria 3606
282 Ga0501223_000517 3300049663 Bacteria 9302
283 Ga0501235_019729 3300049669 Bacteria 1496
284 Ga0501256_011384 3300049685 Bacteria 858
285 Ga0501257_001234 3300049686 Bacteria 5245
286 Ga0501259_000272 3300049688 Bacteria 8152
287 Ga0501245_008635 3300049708 Bacteria 1454
288 Ga0501079_0067830 3300049741 Unclassified 2753
289 Ga0501079_0418783 3300049741 Bacteria 1051
290 Ga0501080_0081345 3300049742 Bacteria 3009
291 Ga0501080_0360583 3300049742 Unclassified 1311
292 Ga0501083_0371119 3300049744 Bacteria 930
293 Ga0501266_000889 3300049763 Bacteria 3884
294 Ga0501268_000225 3300049765 Bacteria 5609
295 Ga0501035_0003970 3300049822 Bacteria 14097
296 Ga0501044_0156677 3300049823 Unclassified 2256
297 nmdc:mga0k408_103716_c1 3300050493 Unclassified 1678
298 nmdc:mga0k408_24816_c1 3300050493 Bacteria 3391
299 nmdc:mga09592_268511_c1 3300050508 Bacteria 1480
300 nmdc:mga0qj67_90185_c1 3300050509 Bacteria 2462
301 nmdc:mga08y16_541313_c1 3300050511 Bacteria 1179
302 Ga0500635_0004257 3300053080 Bacteria 3673
303 Ga0500642_0012239 3300053130 Bacteria 3103
304 Ga0500616_0007014 3300053153 Bacteria 7235
305 Ga0501084_0045131 3300054114 Unclassified 3690
306 2599481101 2599185184 Bacteria 6430550
307 2738762683 2738541284 Bacteria 5199923
308 2928083026 2928078545 Bacteria 6534839
309 2928150047 2928147474 Bacteria 6512076
310 2932086852 2932082852 Bacteria 6563563
311 Ga0075366_10031584
312 ARSoilOldRDRAFT_c004607
313 JGI24736J21556_1006658
314 JGI24740J21852_10036634
315 JGI24737J22298_10001881
316 JGI24737J22298_10006491
317 JGI24737J22298_10012549
318 JGI24737J22298_10024042
319 JGI24735J21928_10000010
320 JGI24735J21928_10017120
321 JGI24751J29686_10001543
322 JGI25406J46586_10001864
323 rootH1_10167010
324 rootH1_10275605
325 Ga0070658_10000026
326 Ga0070676_10008344
327 Ga0070670_100370462
328 Ga0070677_10005721
329 Ga0068869_100008777
330 Ga0068869_100600784
331 Ga0070680_100022599
332 Ga0070682_100015867
333 Ga0068868_100053687
334 Ga0068868_100676544
335 Ga0070660_100024123
336 Ga0070660_100190346
337 Ga0070691_10001848
338 Ga0070668_100073405
339 Ga0070668_100654893
340 Ga0070675_100020404
341 Ga0070675_100441380
342 Ga0070675_100748514
343 Ga0070674_100041890
344 Ga0070673_100092621
345 Ga0070673_100245566
346 Ga0070673_100516064
347 Ga0070659_100011210
348 Ga0070659_100222882
349 Ga0070659_100809198
350 Ga0070667_100036970
351 Ga0070663_100025381
352 Ga0070678_100005156
353 Ga0070678_100015271
354 Ga0070662_100000384
355 Ga0070681_10154255
356 Ga0068867_100993493
357 Ga0070679_100013709
358 Ga0070684_100049653
359 Ga0068853_100015115
360 Ga0070672_100018696
361 Ga0070672_100172780
362 Ga0070672_100472591
363 Ga0070693_100032859
364 Ga0070665_100000267
365 Ga0070665_100092492
366 Ga0068855_100015597
367 Ga0068855_100055664
368 Ga0068855_100261506
369 Ga0068855_101545728
370 Ga0068857_100131631
371 Ga0068857_100172349
372 Ga0068857_100271689
373 Ga0068856_100004615
374 Ga0068856_100233277
375 Ga0068852_101049565
376 Ga0068859_100025296
377 Ga0068859_100055659
378 Ga0068866_10059008
379 Ga0068861_100166929
380 Ga0068861_100356176
381 Ga0068870_10005695
382 Ga0068860_100021490
383 Ga0068860_100075255
384 Ga0068862_100010249
385 Ga0068862_100405803
386 Ga0081539_10000914
387 Ga0075366_10003747
388 Ga0097621_100011903
389 Ga0097621_100083351
390 Ga0097621_100101807
391 Ga0097621_100874131
392 Ga0068871_100116523
393 Ga0075428_100137289
394 Ga0075430_100041506
395 Ga0075429_100035880
396 Ga0068865_100006144
397 Ga0097620_100025296
398 Ga0097620_100055660
399 Ga0105240_10002931
400 Ga0105240_10045182
401 Ga0105240_10082774
402 Ga0105240_10104348
403 Ga0105240_10205807
404 Ga0105240_10221662
405 Ga0105240_10577987
406 Ga0111539_10725846
407 Ga0105241_10000855
408 Ga0105241_10005523
409 Ga0105241_10043132
410 Ga0105241_10049864
411 Ga0105241_10300586
412 Ga0105242_10082867
413 Ga0105242_10091889
414 Ga0105237_10000128
415 Ga0105237_10007207
416 Ga0105237_10268215
417 Ga0105237_10543104
418 Ga0105249_10019755
419 Ga0105239_10000042
420 Ga0105239_10006085
421 Ga0105239_10327746
422 Ga0105239_10779527
423 Ga0105246_10066945
424 Ga0105246_10370856
425 Ga0105246_10665251
426 Ga0157373_10000169
427 Ga0157373_10002741
428 Ga0157373_10052759
429 Ga0157371_10000678
430 Ga0157371_10014913
431 Ga0157371_10060454
432 Ga0157371_10114349
433 Ga0157370_10017308
434 Ga0157370_10044602
435 Ga0157370_10306404
436 Ga0157370_10410279
437 Ga0157369_10001000
438 Ga0157369_10059384
439 Ga0157369_10084857
440 Ga0157369_10355153
441 Ga0157369_10669892
442 Ga0157374_10015423
443 Ga0157374_10027237
444 Ga0157374_10030764
445 Ga0157374_10646389
446 Ga0157374_10818587
447 Ga0157378_10056070
448 Ga0157378_10204903
449 Ga0163162_10000074
450 Ga0157372_10000048
451 Ga0157372_10000243
452 Ga0157372_10001626
453 Ga0157372_10004992
454 Ga0157372_10082184
455 Ga0157372_10106232
456 Ga0157375_10269852
457 Ga0157375_10366739
458 Ga0157375_11207404
459 Ga0163163_10445907
460 Ga0163163_10476495
461 Ga0157380_10058817
462 Ga0157380_10222972
463 Ga0182008_10020877
464 Ga0182008_10030613
465 Ga0182008_10056851
466 Ga0157377_10306652
467 Ga0157379_10412408
468 Ga0157379_10836857
469 Ga0157376_10170976
470 Ga0157376_10941075
471 Ga0182007_10004806
472 Ga0182007_10029027
473 Ga0182007_10030841
474 Ga0163161_10085862
475 Ga0209026_1003628
476 Ga0209233_1009537
477 Ga0209455_1002066
478 Ga0207682_10037519
479 Ga0207642_10088721
480 Ga0207680_10024322
481 Ga0207647_10000072
482 Ga0207647_10001291
483 Ga0207645_10002867
484 Ga0207643_10014142
485 Ga0207705_10000040
486 Ga0207654_10001666
487 Ga0207654_10003901
488 Ga0207707_10071171
489 Ga0207695_10005214
490 Ga0207695_10021283
491 Ga0207695_10038892
492 Ga0207695_10068334
493 Ga0207695_10109050
494 Ga0207695_10408990
495 Ga0207671_10000652
496 Ga0207671_10001786
497 Ga0207671_10413237
498 Ga0207660_10054981
499 Ga0207657_10019941
500 Ga0207652_10088009
501 Ga0207650_10068185
502 Ga0207650_10210636
503 Ga0207650_10634381
504 Ga0207659_10178867
505 Ga0207690_10002663
506 Ga0207690_10126239
507 Ga0207706_10000043
508 Ga0207686_10125280
509 Ga0207669_10204411
510 Ga0207691_10042581
511 Ga0207691_10596662
512 Ga0207689_10005719
513 Ga0207667_10009634
514 Ga0207667_10051288
515 Ga0207667_10057438
516 Ga0207651_10004856
517 Ga0207651_10785605
518 Ga0207712_10021501
519 Ga0207712_10788929
520 Ga0207640_10326277
521 Ga0207658_10093387
522 Ga0207677_10039038
523 Ga0207677_10645378
524 Ga0207677_10832152
525 Ga0207639_10015679
526 Ga0207639_10067722
527 Ga0207639_10128578
528 Ga0207639_10748565
529 Ga0207678_10150067
530 Ga0207678_10649365
531 Ga0207702_10006124
532 Ga0207702_10450573
533 Ga0207648_10000649
534 Ga0207648_10188285
535 Ga0207648_10304092
536 Ga0207674_10076141
537 Ga0207674_10122380
538 Ga0207674_10147682
539 Ga0207675_100021876
540 Ga0207683_10000439
541 Ga0207683_10027506
542 Ga0207683_10132961
543 Ga0268266_10000018
544 Ga0268266_10022842
545 Ga0268266_10250206
546 Ga0268265_10011287
547 Ga0268264_10045890
548 Ga0316182_1171643
549 Ga0307509_10234449
550 Ga0307408_100000220
551 Ga0307412_10560269
552 Ga0307414_10177077
553 Ga0307414_10473415
554 Ga0373936_0064984
555 Ga0373935_0518526
556 Ga0395899_0000050
557 Ga0395899_0000327
558 Ga0395899_0001258
559 Ga0395900_0000122
560 Ga0395900_0000231
561 Ga0395900_0008411
562 Ga0395898_0003522
563 Ga0395898_0059552
564 Ga0395905_0000261
565 Ga0395905_0001611
566 Ga0395901_0000236
567 Ga0466969_0045668
568 Ga0466966_0102549
569 Ga0466959_0070105
570 Ga0466959_0142066
571 Ga0495653_0461867
572 Ga0495642_0226410
573 Ga0495625_0128654
574 Ga0495661_0000607
575 Ga0495686_0065670
576 Ga0495686_0223062
577 Ga0496115_0198846
578 Ga0501034_0035434
579 Ga0501036_0596574
580 Ga0501043_0055735
581 Ga0501046_0007063
582 Ga0501047_0028443
583 Ga0501047_0104895
584 Ga0501048_0240952
585 Ga0501070_0079472
586 Ga0501073_0003046
587 Ga0501073_0129038
588 Ga0501074_0010792
589 Ga0501074_0091854
590 Ga0501202_008256
591 Ga0501217_002539
592 Ga0501223_000517
593 Ga0501235_019729
594 Ga0501256_011384
595 Ga0501257_001234
596 Ga0501259_000272
597 Ga0501245_008635
598 Ga0501079_0067830
599 Ga0501079_0418783
600 Ga0501080_0081345
601 Ga0501080_0360583
602 Ga0501083_0371119
603 Ga0501266_000889
604 Ga0501268_000225
605 Ga0501035_0003970
606 Ga0501044_0156677
607 nmdc:mga0k408_103716_c1
608 nmdc:mga0k408_24816_c1
609 nmdc:mga09592_268511_c1
610 nmdc:mga0qj67_90185_c1
611 nmdc:mga08y16_541313_c1
612 Ga0500635_0004257
613 Ga0500642_0012239
614 Ga0500616_0007014
615 Ga0501084_0045131
616 2599481101
617 2738762683
618 2928083026
619 2928150047
620 2932086852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

137

190

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

36

104

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9543 142 190
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9523 126 193
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.9427 10 103
3hug-assembly6.cif.gz_M crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9374 125 193
3hug-assembly6.cif.gz_A crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9333 121 192
ID Description Score Start End Superfamily
1or7B01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9607 14 96 1.10.1740.10
4lupA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9561 12 102 1.10.1740.10
3hugK00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9521 130 193 1.10.10.10
4lupC00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9427 10 103 1.10.1740.10
3hugO00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9375 126 192 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3S2UN73-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.7292 10 221 GO:0003677
GO:0006352
GO:0016987
AF-A0A3S2UN73-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.7235 10 221 GO:0003677
GO:0006352
GO:0016987
AF-A0A5B8UFS5-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.6835 4 221 GO:0003677
GO:0006352
GO:0016987
AF-A0A5B8UFS5-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.6757 4 221 GO:0003677
GO:0006352
GO:0016987
AF-A0A537BZG9-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.6379 1 148 GO:0006352
GO:0016987

Map