F400706

General Info

Members Datasets Scaffolds Average Seq Length
310 168 312 155

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10600271|Ga0105241_106002712
Length 185
Sequence MPFSSISLKFAHMQIILSSAHPKSAHLHINNMYDDILNHLPYKSSFRFVDNITELSEDGVVGEYTLRPDAFFYEDHFVGNPVTPGVIITEIMAQIGLVVLGIFLLSKDPGVYSAADEAAFPLFTSTEISFHKIVLPGEKVKVISEKQYFRFGKLKCYVEMMDSAGDVVAKGMFSGFIKRMDVKNE

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
155 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
163 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
164 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
165 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
166 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
167 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.1
Nodule 0
Rhizoplane 0
Rhizosphere 83.87
Stem 0
Stem Tuber 0
Unclassified 9.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1007438 3300001904 Bacteria 1840
2 JGI24744J21845_10009282 3300002077 Unclassified 2019
3 JGI25164J39214_1002124 3300002772 Bacteria 3354
4 JGI25165J46597_1000957 3300003214 Bacteria 19672
5 rootH1_10103859 3300003316 Bacteria 2106
6 rootH1_10156130 3300003316 Bacteria 3728
7 rootH2_10005827 3300003320 Bacteria 117906
8 rootH2_10072788 3300003320 Unclassified 2810
9 rootH2_10158776 3300003320 Bacteria 6132
10 rootH2_10193259 3300003320 Unclassified 1723
11 rootH2_10226040 3300003320 Bacteria 1996
12 rootL2_10023708 3300003322 Bacteria 4285
13 rootL2_10080321 3300003322 Unclassified 1976
14 rootH1_10000566 3300003316 Bacteria 33162
15 rootH1_10000566 3300003323 Bacteria 205679
16 rootH1_10030244 3300003323 Bacteria 7579
17 rootH1_10049995 3300003323 Bacteria 2914
18 rootH1_10058394 3300003316 Bacteria 1323
19 rootH1_10058394 3300003323 Bacteria 7744
20 rootH1_10323614 3300003323 Bacteria 3450
21 rootH1_10388244 3300003323 Unclassified 1458
22 Ga0058863_10710440 3300004799 Bacteria 802
23 Ga0058862_10935451 3300004803 Bacteria 739
24 Ga0070658_10000075 3300005327 Bacteria 95412
25 Ga0070658_10053446 3300005327 Bacteria 3278
26 Ga0070658_10108478 3300005327 Bacteria 2298
27 Ga0070658_10915098 3300005327 Bacteria 763
28 Ga0070676_10001405 3300005328 Bacteria 12139
29 Ga0070683_100031869 3300005329 Bacteria 4796
30 Ga0068869_100211545 3300005334 Bacteria 1533
31 Ga0068869_100822979 3300005334 Bacteria 799
32 Ga0070680_100018468 3300005336 Bacteria 5509
33 Ga0070682_100000106 3300005337 Bacteria 74029
34 Ga0070682_100080145 3300005337 Bacteria 2110
35 Ga0070682_100472288 3300005337 Bacteria 965
36 Ga0068868_100043902 3300005338 Bacteria 3493
37 Ga0068868_100230994 3300005338 Bacteria 1552
38 Ga0068868_101538889 3300005338 Bacteria 623
39 Ga0070660_100011254 3300005339 Bacteria 6350
40 Ga0070660_100017831 3300005339 Bacteria 5179
41 Ga0070660_101218553 3300005339 Bacteria 638
42 Ga0070661_101216536 3300005344 Bacteria 630
43 Ga0070671_100187992 3300005355 Unclassified 1750
44 Ga0070674_100120152 3300005356 Bacteria 1944
45 Ga0070673_100005899 3300005364 Bacteria 7906
46 Ga0070673_100496041 3300005364 Bacteria 1104
47 Ga0070659_100001045 3300005366 Bacteria 20218
48 Ga0070710_10680060 3300005437 Unclassified 724
49 Ga0070663_100300588 3300005455 Bacteria 1284
50 Ga0070678_100000635 3300005456 Bacteria 17178
51 Ga0070662_100000167 3300005457 Bacteria 38204
52 Ga0070662_100925921 3300005457 Bacteria 744
53 Ga0070681_10225932 3300005458 Bacteria 1787
54 Ga0070681_11015168 3300005458 Bacteria 749
55 Ga0068867_100003317 3300005459 Bacteria 11339
56 Ga0070679_100031284 3300005530 Bacteria 5257
57 Ga0070679_100182354 3300005530 Bacteria 2071
58 Ga0070679_100785419 3300005530 Bacteria 895
59 Ga0070679_100960429 3300005530 Unclassified 798
60 Ga0068853_100002213 3300005539 Bacteria 14526
61 Ga0068853_100005556 3300005539 Bacteria 9894
62 Ga0068853_100333326 3300005539 Unclassified 1408
63 Ga0068853_100810600 3300005539 Bacteria 897
64 Ga0070672_100075953 3300005543 Unclassified 2683
65 Ga0070693_100445014 3300005547 Bacteria 908
66 Ga0070665_100000284 3300005548 Bacteria 82062
67 Ga0068855_100002441 3300005563 Bacteria 22952
68 Ga0068855_100009981 3300005563 Bacteria 11442
69 Ga0068855_100175440 3300005563 Bacteria 2425
70 Ga0068855_100210508 3300005563 Bacteria 2185
71 Ga0068855_100621662 3300005563 Bacteria 1163
72 Ga0068855_101878323 3300005563 Bacteria 607
73 Ga0070664_100013917 3300005564 Bacteria 6558
74 Ga0068854_100896209 3300005578 Bacteria 779
75 Ga0068856_100000044 3300005614 Bacteria 111437
76 Ga0068856_100003367 3300005614 Bacteria 16201
77 Ga0068856_100086462 3300005614 Bacteria 3115
78 Ga0068856_100122556 3300005614 Bacteria 2602
79 Ga0068856_100151253 3300005614 Bacteria 2330
80 Ga0068852_100018295 3300005616 Bacteria 5519
81 Ga0068864_100084569 3300005618 Unclassified 2788
82 Ga0068866_10033820 3300005718 Bacteria 2484
83 Ga0068866_10150989 3300005718 Bacteria 1345
84 Ga0068870_10177797 3300005840 Bacteria 1275
85 Ga0068863_100781004 3300005841 Bacteria 952
86 Ga0068858_101208161 3300005842 Bacteria 743
87 Ga0081539_10156423 3300005985 Unclassified 1091
88 Ga0075366_10001232 3300006195 Bacteria 12699
89 Ga0097621_100000076 3300006237 Bacteria 51192
90 Ga0075370_10258765 3300006353 Bacteria 1032
91 Ga0068871_100000070 3300006358 Bacteria 57286
92 Ga0068865_100000448 3300006881 Bacteria 22921
93 Ga0105240_10004296 3300009093 Bacteria 21764
94 Ga0105240_10012464 3300009093 Bacteria 11730
95 Ga0105240_10012579 3300009093 Bacteria 11674
96 Ga0105240_10025025 3300009093 Bacteria 7858
97 Ga0105240_10126145 3300009093 Bacteria 3075
98 Ga0105240_10721689 3300009093 Unclassified 1086
99 Ga0105240_10768962 3300009093 Bacteria 1046
100 Ga0105240_10906153 3300009093 Unclassified 948
101 Ga0105243_10319055 3300009148 Bacteria 1415
102 Ga0105241_10003945 3300009174 Bacteria 10980
103 Ga0105241_10059146 3300009174 Bacteria 2946
104 Ga0105241_10281944 3300009174 Bacteria 1419
105 Ga0105241_10479911 3300009174 Bacteria 1105
106 Ga0105241_10600271 3300009174 Bacteria 994
107 Ga0105241_10899990 3300009174 Bacteria 822
108 Ga0105242_10533513 3300009176 Unclassified 1122
109 Ga0105237_10001162 3300009545 Bacteria 35201
110 Ga0105237_10188471 3300009545 Unclassified 2063
111 Ga0105237_10465028 3300009545 Bacteria 1271
112 Ga0105238_10015761 3300009551 Bacteria 7653
113 Ga0105238_10303852 3300009551 Bacteria 1579
114 Ga0105238_11164032 3300009551 Unclassified 795
115 Ga0105238_11920362 3300009551 Bacteria 625
116 Ga0105249_10380360 3300009553 Bacteria 1438
117 Ga0105239_10000006 3300010375 Bacteria 442319
118 Ga0105239_10024262 3300010375 Bacteria 6680
119 Ga0105239_10073321 3300010375 Bacteria 3764
120 Ga0105239_10199011 3300010375 Bacteria 2244
121 Ga0105239_10238006 3300010375 Bacteria 2043
122 Ga0105239_10878233 3300010375 Bacteria 1029
123 Ga0105246_10222635 3300011119 Bacteria 1480
124 Ga0157373_10074927 3300013100 Bacteria 2388
125 Ga0157371_10115760 3300013102 Bacteria 1904
126 Ga0157370_10019559 3300013104 Bacteria 6786
127 Ga0157370_10242593 3300013104 Bacteria 1667
128 Ga0157370_10778644 3300013104 Bacteria 871
129 Ga0157370_10977006 3300013104 Bacteria 767
130 Ga0157370_11087512 3300013104 Bacteria 723
131 Ga0157369_10078749 3300013105 Bacteria 3530
132 Ga0157369_10568829 3300013105 Bacteria 1171
133 Ga0157374_10000147 3300013296 Bacteria 63762
134 Ga0157374_10004549 3300013296 Bacteria 11638
135 Ga0157374_10004914 3300013296 Bacteria 11219
136 Ga0157374_10081588 3300013296 Bacteria 3069
137 Ga0157374_10386641 3300013296 Bacteria 1394
138 Ga0157378_10016211 3300013297 Bacteria 6526
139 Ga0157378_10028584 3300013297 Bacteria 4921
140 Ga0157378_11047079 3300013297 Unclassified 852
141 Ga0157378_11120394 3300013297 Bacteria 824
142 Ga0163162_10000044 3300013306 Bacteria 128200
143 Ga0163162_10019758 3300013306 Bacteria 6614
144 Ga0163162_10094739 3300013306 Unclassified 3072
145 Ga0163162_10356861 3300013306 Bacteria 1595
146 Ga0157372_10010312 3300013307 Bacteria 9928
147 Ga0157372_10125026 3300013307 Bacteria 2957
148 Ga0157375_10010894 3300013308 Bacteria 8016
149 Ga0157375_10014654 3300013308 Bacteria 7003
150 Ga0157375_10322294 3300013308 Bacteria 1710
151 Ga0157375_10736180 3300013308 Bacteria 1138
152 Ga0157375_11142485 3300013308 Unclassified 912
153 Ga0157377_10013567 3300014745 Unclassified 4127
154 Ga0157377_10568698 3300014745 Unclassified 804
155 Ga0157376_10121716 3300014969 Unclassified 2314
156 Ga0157376_11889926 3300014969 Bacteria 634
157 Ga0157376_12935659 3300014969 Bacteria 516
158 Ga0213872_10043185 3300021361 Bacteria 2055
159 Ga0213876_10011213 3300021384 Bacteria 4790
160 Ga0207427_100093 3300025231 Bacteria 125910
161 Ga0209437_100008 3300025233 Bacteria 921142
162 Ga0209258_110456 3300025242 Bacteria 1203
163 Ga0209026_1021849 3300025250 Bacteria 984
164 Ga0209233_1000024 3300025261 Bacteria 695418
165 Ga0209233_1046334 3300025261 Bacteria 910
166 Ga0209455_1005140 3300025272 Bacteria 4113
167 Ga0207642_10128922 3300025899 Bacteria 1317
168 Ga0207642_10246488 3300025899 Bacteria 1011
169 Ga0207647_10000209 3300025904 Bacteria 47604
170 Ga0207645_10001060 3300025907 Bacteria 22749
171 Ga0207705_10000102 3300025909 Bacteria 98105
172 Ga0207705_10084165 3300025909 Bacteria 2322
173 Ga0207705_11141353 3300025909 Bacteria 599
174 Ga0207654_10036834 3300025911 Bacteria 2736
175 Ga0207654_10138980 3300025911 Bacteria 1547
176 Ga0207654_10140150 3300025911 Bacteria 1541
177 Ga0207654_10330321 3300025911 Bacteria 1045
178 Ga0207654_10516771 3300025911 Bacteria 845
179 Ga0207654_10774513 3300025911 Bacteria 692
180 Ga0207695_10016425 3300025913 Bacteria 8661
181 Ga0207695_10032746 3300025913 Bacteria 5683
182 Ga0207695_10087749 3300025913 Bacteria 3133
183 Ga0207695_10315499 3300025913 Bacteria 1453
184 Ga0207695_10420531 3300025913 Bacteria 1220
185 Ga0207695_10552102 3300025913 Unclassified 1033
186 Ga0207671_10000901 3300025914 Bacteria 37526
187 Ga0207671_10002483 3300025914 Bacteria 19710
188 Ga0207671_10031097 3300025914 Unclassified 3980
189 Ga0207660_10018816 3300025917 Bacteria 4611
190 Ga0207657_10055649 3300025919 Unclassified 3417
191 Ga0207657_10066677 3300025919 Bacteria 3063
192 Ga0207652_10045163 3300025921 Unclassified 3755
193 Ga0207652_10301357 3300025921 Bacteria 1446
194 Ga0207694_10275289 3300025924 Bacteria 1381
195 Ga0207694_10878322 3300025924 Unclassified 758
196 Ga0207687_11204263 3300025927 Bacteria 651
197 Ga0207644_10196593 3300025931 Unclassified 1588
198 Ga0207690_10000770 3300025932 Bacteria 20723
199 Ga0207706_10000257 3300025933 Bacteria 57965
200 Ga0207686_10145419 3300025934 Bacteria 1644
201 Ga0207709_10143487 3300025935 Bacteria 1644
202 Ga0207669_10191093 3300025937 Bacteria 1477
203 Ga0207704_10000016 3300025938 Bacteria 158362
204 Ga0207691_10082920 3300025940 Unclassified 2879
205 Ga0207689_10182878 3300025942 Bacteria 1729
206 Ga0207667_10007901 3300025949 Bacteria 12701
207 Ga0207667_10100674 3300025949 Bacteria 2981
208 Ga0207667_10281283 3300025949 Bacteria 1700
209 Ga0207651_10023616 3300025960 Bacteria 3787
210 Ga0207640_11215844 3300025981 Bacteria 670
211 Ga0207677_10040686 3300026023 Bacteria 3067
212 Ga0207677_10089688 3300026023 Bacteria 2232
213 Ga0207677_10865643 3300026023 Bacteria 813
214 Ga0207703_11063402 3300026035 Bacteria 777
215 Ga0207639_10004646 3300026041 Bacteria 9247
216 Ga0207639_10039069 3300026041 Bacteria 3534
217 Ga0207639_10094960 3300026041 Bacteria 2395
218 Ga0207639_10392281 3300026041 Bacteria 1249
219 Ga0207639_11825327 3300026041 Bacteria 569
220 Ga0207678_10049791 3300026067 Unclassified 3620
221 Ga0207678_10434334 3300026067 Bacteria 1140
222 Ga0207702_10000140 3300026078 Bacteria 87544
223 Ga0207702_10027576 3300026078 Bacteria 4717
224 Ga0207702_10060442 3300026078 Bacteria 3231
225 Ga0207702_10092895 3300026078 Bacteria 2645
226 Ga0207702_10207652 3300026078 Bacteria 1819
227 Ga0207648_10011699 3300026089 Bacteria 8257
228 Ga0207676_11305186 3300026095 Bacteria 721
229 Ga0207683_10003553 3300026121 Bacteria 13596
230 Ga0207698_10003621 3300026142 Bacteria 9323
231 Ga0207698_10995404 3300026142 Bacteria 849
232 Ga0207698_11646716 3300026142 Bacteria 657
233 Ga0268266_10000291 3300028379 Bacteria 82093
234 Ga0307517_10003309 3300028786 Bacteria 25165
235 Ga0307515_10000790 3300028794 Bacteria 72891
236 Ga0307515_10001523 3300028794 Bacteria 51822
237 Ga0307511_10046867 3300030521 Bacteria 3547
238 Ga0307509_10183855 3300031507 Bacteria 1951
239 Ga0307509_10374046 3300031507 Bacteria 1140
240 Ga0307516_10009496 3300031730 Bacteria 10837
241 Ga0307507_10000078 3300033179 Bacteria 151026
242 Ga0307510_10000612 3300033180 Bacteria 36207
243 Ga0307510_10000638 3300033180 Bacteria 35529
244 Ga0373941_0003172 3300035115 Bacteria 3693
245 Ga0373927_0083630 3300035695 Unclassified 2069
246 Ga0395899_0000001 3300037312 Bacteria 1750322
247 Ga0395899_0004840 3300037312 Bacteria 10482
248 Ga0395899_0027187 3300037312 Bacteria 4315
249 Ga0395900_0000327 3300037418 Bacteria 70365
250 Ga0395900_0001751 3300037418 Bacteria 24946
251 Ga0395900_0012635 3300037418 Bacteria 8634
252 Ga0395900_1234732 3300037418 Bacteria 662
253 Ga0395898_0008234 3300037466 Bacteria 11020
254 Ga0395898_0360963 3300037466 Bacteria 1385
255 Ga0395905_0000461 3300037471 Bacteria 56680
256 Ga0395905_0001887 3300037471 Bacteria 24161
257 Ga0395901_0000464 3300038443 Bacteria 47061
258 Ga0395901_0041539 3300038443 Bacteria 4767
259 Ga0436365_0548634 3300039437 Bacteria 13605
260 Ga0436361_0572592 3300039447 Bacteria 5527
261 Ga0439448_0012160 3300042005 Bacteria 2572
262 Ga0466968_0424364 3300044735 Unclassified 654
263 Ga0495651_0098425 3300046462 Bacteria 2183
264 Ga0495585_0001288 3300046492 Bacteria 19979
265 Ga0495585_0514264 3300046492 Bacteria 568
266 Ga0495606_0007717 3300046507 Bacteria 9530
267 Ga0495606_0009897 3300046507 Bacteria 7986
268 Ga0495616_0145864 3300046513 Bacteria 1074
269 Ga0495631_0020448 3300046518 Bacteria 3093
270 Ga0495631_0038621 3300046518 Bacteria 2122
271 Ga0495632_0157619 3300046519 Bacteria 1047
272 Ga0495643_0291358 3300046522 Bacteria 747
273 Ga0495644_0009355 3300046523 Bacteria 3779
274 Ga0495648_0022072 3300046524 Bacteria 4392
275 Ga0495663_0018537 3300046525 Bacteria 1983
276 Ga0495642_0293193 3300046528 Unclassified 712
277 Ga0495652_0173195 3300046529 Bacteria 1664
278 Ga0495654_0124962 3300046530 Bacteria 1160
279 Ga0495609_0009192 3300046538 Bacteria 4791
280 Ga0495609_0259656 3300046538 Unclassified 714
281 Ga0495633_0000074 3300046558 Bacteria 130197
282 Ga0495668_0000017 3300046616 Bacteria 434025
283 Ga0495668_0118767 3300046616 Bacteria 1446
284 Ga0495625_0000435 3300046660 Bacteria 62758
285 Ga0495625_0000628 3300046660 Bacteria 51089
286 Ga0495625_0018938 3300046660 Bacteria 5358
287 Ga0495661_0053263 3300046665 Bacteria 2434
288 Ga0495661_0172926 3300046665 Bacteria 1150
289 Ga0495669_0128607 3300046684 Bacteria 1191
290 Ga0495670_0175971 3300046691 Unclassified 1128
291 Ga0495600_0111993 3300046809 Bacteria 1777
292 Ga0495687_000879 3300047443 Bacteria 31853
293 Ga0495686_0145010 3300047472 Bacteria 1398
294 Ga0495626_0090182 3300048091 Bacteria 1349
295 Ga0495682_0032684 3300049460 Bacteria 1922
296 Ga0495682_0056767 3300049460 Bacteria 1419
297 Ga0501037_0095487 3300049573 Unclassified 2149
298 Ga0501070_0168409 3300049586 Unclassified 1805
299 Ga0501080_0126330 3300049742 Unclassified 2369
300 Ga0501044_0266806 3300049823 Bacteria 1649
301 nmdc:mga0k408_323_c1 3300050493 Bacteria 26051
302 nmdc:mga0k408_424_c1 3300050493 Bacteria 23079
303 nmdc:mga07m45_76964_c1 3300050496 Bacteria 1902
304 Ga0500635_0003371 3300053080 Bacteria 4012
305 Ga0500635_0011768 3300053080 Bacteria 2496
306 Ga0500644_0530470 3300053088 Bacteria 519
307 Ga0500608_000855 3300053122 Bacteria 10997
308 Ga0500608_041732 3300053122 Bacteria 2201
309 Ga0500614_005801 3300053123 Bacteria 2594
310 Ga0500618_000020 3300053125 Bacteria 161356
311 Ga0500642_0035400 3300053130 Bacteria 2119
312 Ga0500622_0000719 3300053156 Bacteria 28939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100472288 Ga0070682_1004722882 144
2 3300005563 Ga0068855_100621662 Ga0068855_1006216622 146
3 3300009093 Ga0105240_10768962 Ga0105240_107689622 146
4 3300025913 Ga0207695_10420531 Ga0207695_104205312 146
5 3300025949 Ga0207667_10281283 Ga0207667_102812832 146
6 3300003316 rootH1_10156130 rootH1_101561302 147
7 3300003322 rootL2_10023708 rootL2_100237085 147
8 3300003323 rootH1_10323614 rootH1_103236142 147
9 3300004799 Ga0058863_10710440 Ga0058863_107104402 147
10 3300004803 Ga0058862_10935451 Ga0058862_109354511 147
11 3300005336 Ga0070680_100018468 Ga0070680_1000184684 147
12 3300005437 Ga0070710_10680060 Ga0070710_106800601 147
13 3300005458 Ga0070681_10225932 Ga0070681_102259321 147
14 3300005530 Ga0070679_100031284 Ga0070679_1000312846 147
15 3300005614 Ga0068856_100086462 Ga0068856_1000864623 147
16 3300025917 Ga0207660_10018816 Ga0207660_100188162 147
17 3300025921 Ga0207652_10045163 Ga0207652_100451632 147
18 3300026078 Ga0207702_10060442 Ga0207702_100604422 147
19 3300030521 Ga0307511_10046867 Ga0307511_100468673 147
20 3300031730 Ga0307516_10009496 Ga0307516_100094965 147
21 3300005327 Ga0070658_10915098 Ga0070658_109150982 148
22 3300005458 Ga0070681_11015168 Ga0070681_110151682 148
23 3300005530 Ga0070679_100182354 Ga0070679_1001823542 148
24 3300025921 Ga0207652_10301357 Ga0207652_103013572 148
25 3300053080 Ga0500635_0003371 Ga0500635_0003371_1204_1656 148
26 3300053088 Ga0500644_0530470 Ga0500644_0530470_38_490 148
27 3300005614 Ga0068856_100000044 Ga0068856_100000044106 149
28 3300026078 Ga0207702_10000140 Ga0207702_1000014087 149
29 3300046665 Ga0495661_0053263 Ga0495661_0053263_1280_1735 149
30 3300003320 rootH2_10193259 rootH2_101932592 150
31 3300003322 rootL2_10080321 rootL2_100803212 150
32 3300005530 Ga0070679_100960429 Ga0070679_1009604291 150
33 3300006195 Ga0075366_10001232 Ga0075366_100012322 150
34 3300006353 Ga0075370_10258765 Ga0075370_102587652 150
35 3300013104 Ga0157370_11087512 Ga0157370_110875122 150
36 3300013297 Ga0157378_11120394 Ga0157378_111203942 150
37 3300013306 Ga0163162_10356861 Ga0163162_103568612 150
38 3300014969 Ga0157376_12935659 Ga0157376_129356591 150
39 3300028794 Ga0307515_10000790 Ga0307515_1000079021 150
40 3300028794 Ga0307515_10001523 Ga0307515_1000152318 150
41 3300033179 Ga0307507_10000078 Ga0307507_10000078108 150
42 3300046492 Ga0495585_0001288 Ga0495585_0001288_14204_14662 150
43 3300046513 Ga0495616_0145864 Ga0495616_0145864_504_962 150
44 3300046518 Ga0495631_0038621 Ga0495631_0038621_76_534 150
45 3300046522 Ga0495643_0291358 Ga0495643_0291358_273_731 150
46 3300046524 Ga0495648_0022072 Ga0495648_0022072_3459_3917 150
47 3300046525 Ga0495663_0018537 Ga0495663_0018537_130_588 150
48 3300046529 Ga0495652_0173195 Ga0495652_0173195_390_848 150
49 3300046530 Ga0495654_0124962 Ga0495654_0124962_66_524 150
50 3300046538 Ga0495609_0009192 Ga0495609_0009192_2474_2932 150
51 3300046558 Ga0495633_0000074 Ga0495633_0000074_119857_120315 150
52 3300046616 Ga0495668_0000017 Ga0495668_0000017_274311_274769 150
53 3300046660 Ga0495625_0000435 Ga0495625_0000435_12334_12792 150
54 3300046660 Ga0495625_0000628 Ga0495625_0000628_2420_2878 150
55 3300046660 Ga0495625_0018938 Ga0495625_0018938_1836_2294 150
56 3300046809 Ga0495600_0111993 Ga0495600_0111993_551_1009 150
57 3300048091 Ga0495626_0090182 Ga0495626_0090182_418_876 150
58 3300049460 Ga0495682_0032684 Ga0495682_0032684_548_1006 150
59 3300050493 nmdc:mga0k408_424_c1 nmdc:mga0k408_424_c1_11210_11668 150
60 3300053122 Ga0500608_041732 Ga0500608_041732_77_535 150
61 3300053123 Ga0500614_005801 Ga0500614_005801_1670_2128 150
62 3300053125 Ga0500618_000020 Ga0500618_000020_145385_145843 150
63 3300001904 JGI24736J21556_1007438 JGI24736J21556_10074382 151
64 3300002077 JGI24744J21845_10009282 JGI24744J21845_100092822 151
65 3300002772 JGI25164J39214_1002124 JGI25164J39214_10021245 151
66 3300003214 JGI25165J46597_1000957 JGI25165J46597_100095714 151
67 3300003316 rootH1_10103859 rootH1_101038591 151
68 3300003320 rootH2_10005827 rootH2_1000582773 151
69 3300003320 rootH2_10072788 rootH2_100727882 151
70 3300003320 rootH2_10158776 rootH2_101587765 151
71 3300003320 rootH2_10226040 rootH2_102260404 151
72 3300003323 rootH1_10000566 rootH1_10000566147 151
73 3300003323 rootH1_10030244 rootH1_100302448 151
74 3300003323 rootH1_10049995 rootH1_100499952 151
75 3300003323 rootH1_10058394 rootH1_100583947 151
76 3300003323 rootH1_10388244 rootH1_103882442 151
77 3300005327 Ga0070658_10000075 Ga0070658_1000007517 151
78 3300005327 Ga0070658_10053446 Ga0070658_100534464 151
79 3300005327 Ga0070658_10108478 Ga0070658_101084783 151
80 3300005328 Ga0070676_10001405 Ga0070676_1000140511 151
81 3300005329 Ga0070683_100031869 Ga0070683_1000318692 151
82 3300005334 Ga0068869_100211545 Ga0068869_1002115452 151
83 3300005334 Ga0068869_100822979 Ga0068869_1008229791 151
84 3300005337 Ga0070682_100000106 Ga0070682_1000001064 151
85 3300005337 Ga0070682_100080145 Ga0070682_1000801452 151
86 3300005338 Ga0068868_100043902 Ga0068868_1000439025 151
87 3300005338 Ga0068868_100230994 Ga0068868_1002309941 151
88 3300005338 Ga0068868_101538889 Ga0068868_1015388891 151
89 3300005339 Ga0070660_100011254 Ga0070660_1000112542 151
90 3300005339 Ga0070660_100017831 Ga0070660_1000178314 151
91 3300005339 Ga0070660_101218553 Ga0070660_1012185531 151
92 3300005344 Ga0070661_101216536 Ga0070661_1012165362 151
93 3300005355 Ga0070671_100187992 Ga0070671_1001879922 151
94 3300005356 Ga0070674_100120152 Ga0070674_1001201522 151
95 3300005364 Ga0070673_100005899 Ga0070673_1000058994 151
96 3300005364 Ga0070673_100496041 Ga0070673_1004960412 151
97 3300005366 Ga0070659_100001045 Ga0070659_10000104521 151
98 3300005455 Ga0070663_100300588 Ga0070663_1003005882 151
99 3300005456 Ga0070678_100000635 Ga0070678_1000006355 151
100 3300005457 Ga0070662_100000167 Ga0070662_10000016713 151
101 3300005457 Ga0070662_100925921 Ga0070662_1009259212 151
102 3300005459 Ga0068867_100003317 Ga0068867_1000033177 151
103 3300005530 Ga0070679_100785419 Ga0070679_1007854192 151
104 3300005539 Ga0068853_100002213 Ga0068853_10000221314 151
105 3300005539 Ga0068853_100005556 Ga0068853_10000555610 151
106 3300005539 Ga0068853_100333326 Ga0068853_1003333262 151
107 3300005539 Ga0068853_100810600 Ga0068853_1008106001 151
108 3300005543 Ga0070672_100075953 Ga0070672_1000759532 151
109 3300005547 Ga0070693_100445014 Ga0070693_1004450141 151
110 3300005548 Ga0070665_100000284 Ga0070665_10000028454 151
111 3300005563 Ga0068855_100002441 Ga0068855_1000024417 151
112 3300005563 Ga0068855_100009981 Ga0068855_1000099812 151
113 3300005563 Ga0068855_100175440 Ga0068855_1001754402 151
114 3300005563 Ga0068855_100210508 Ga0068855_1002105082 151
115 3300005563 Ga0068855_101878323 Ga0068855_1018783231 151
116 3300005564 Ga0070664_100013917 Ga0070664_1000139177 151
117 3300005578 Ga0068854_100896209 Ga0068854_1008962092 151
118 3300005614 Ga0068856_100003367 Ga0068856_10000336716 151
119 3300005614 Ga0068856_100122556 Ga0068856_1001225564 151
120 3300005614 Ga0068856_100151253 Ga0068856_1001512532 151
121 3300005616 Ga0068852_100018295 Ga0068852_1000182955 151
122 3300005618 Ga0068864_100084569 Ga0068864_1000845692 151
123 3300005718 Ga0068866_10033820 Ga0068866_100338202 151
124 3300005718 Ga0068866_10150989 Ga0068866_101509892 151
125 3300005840 Ga0068870_10177797 Ga0068870_101777972 151
126 3300005841 Ga0068863_100781004 Ga0068863_1007810042 151
127 3300005842 Ga0068858_101208161 Ga0068858_1012081611 151
128 3300005985 Ga0081539_10156423 Ga0081539_101564232 151
129 3300006237 Ga0097621_100000076 Ga0097621_1000000769 151
130 3300006358 Ga0068871_100000070 Ga0068871_10000007034 151
131 3300006881 Ga0068865_100000448 Ga0068865_1000004487 151
132 3300009093 Ga0105240_10004296 Ga0105240_100042968 151
133 3300009093 Ga0105240_10012464 Ga0105240_100124642 151
134 3300009093 Ga0105240_10012579 Ga0105240_1001257911 151
135 3300009093 Ga0105240_10025025 Ga0105240_100250256 151
136 3300009093 Ga0105240_10126145 Ga0105240_101261455 151
137 3300009093 Ga0105240_10721689 Ga0105240_107216892 151
138 3300009093 Ga0105240_10906153 Ga0105240_109061532 151
139 3300009148 Ga0105243_10319055 Ga0105243_103190552 151
140 3300009174 Ga0105241_10003945 Ga0105241_100039452 151
141 3300009174 Ga0105241_10059146 Ga0105241_100591464 151
142 3300009174 Ga0105241_10281944 Ga0105241_102819442 151
143 3300009174 Ga0105241_10479911 Ga0105241_104799112 151
144 3300009174 Ga0105241_10600271 Ga0105241_106002712 151
145 3300009174 Ga0105241_10899990 Ga0105241_108999902 151
146 3300009176 Ga0105242_10533513 Ga0105242_105335132 151
147 3300009545 Ga0105237_10001162 Ga0105237_100011625 151
148 3300009545 Ga0105237_10188471 Ga0105237_101884712 151
149 3300009545 Ga0105237_10465028 Ga0105237_104650282 151
150 3300009551 Ga0105238_10015761 Ga0105238_100157618 151
151 3300009551 Ga0105238_10303852 Ga0105238_103038522 151
152 3300009551 Ga0105238_11164032 Ga0105238_111640322 151
153 3300009551 Ga0105238_11920362 Ga0105238_119203622 151
154 3300009553 Ga0105249_10380360 Ga0105249_103803602 151
155 3300010375 Ga0105239_10000006 Ga0105239_10000006200 151
156 3300010375 Ga0105239_10024262 Ga0105239_100242628 151
157 3300010375 Ga0105239_10073321 Ga0105239_100733215 151
158 3300010375 Ga0105239_10199011 Ga0105239_101990112 151
159 3300010375 Ga0105239_10238006 Ga0105239_102380063 151
160 3300010375 Ga0105239_10878233 Ga0105239_108782332 151
161 3300011119 Ga0105246_10222635 Ga0105246_102226352 151
162 3300013100 Ga0157373_10074927 Ga0157373_100749272 151
163 3300013102 Ga0157371_10115760 Ga0157371_101157602 151
164 3300013104 Ga0157370_10019559 Ga0157370_100195596 151
165 3300013104 Ga0157370_10242593 Ga0157370_102425932 151
166 3300013104 Ga0157370_10778644 Ga0157370_107786442 151
167 3300013104 Ga0157370_10977006 Ga0157370_109770061 151
168 3300013105 Ga0157369_10078749 Ga0157369_100787492 151
169 3300013105 Ga0157369_10568829 Ga0157369_105688292 151
170 3300013296 Ga0157374_10000147 Ga0157374_100001478 151
171 3300013296 Ga0157374_10004549 Ga0157374_100045495 151
172 3300013296 Ga0157374_10004914 Ga0157374_100049149 151
173 3300013296 Ga0157374_10081588 Ga0157374_100815884 151
174 3300013296 Ga0157374_10386641 Ga0157374_103866412 151
175 3300013297 Ga0157378_10016211 Ga0157378_100162114 151
176 3300013297 Ga0157378_10028584 Ga0157378_100285842 151
177 3300013297 Ga0157378_11047079 Ga0157378_110470792 151
178 3300013306 Ga0163162_10000044 Ga0163162_1000004463 151
179 3300013306 Ga0163162_10019758 Ga0163162_100197589 151
180 3300013306 Ga0163162_10094739 Ga0163162_100947394 151
181 3300013307 Ga0157372_10010312 Ga0157372_100103122 151
182 3300013307 Ga0157372_10125026 Ga0157372_101250263 151
183 3300013308 Ga0157375_10010894 Ga0157375_100108944 151
184 3300013308 Ga0157375_10014654 Ga0157375_100146545 151
185 3300013308 Ga0157375_10322294 Ga0157375_103222942 151
186 3300013308 Ga0157375_10736180 Ga0157375_107361802 151
187 3300013308 Ga0157375_11142485 Ga0157375_111424851 151
188 3300014745 Ga0157377_10013567 Ga0157377_100135675 151
189 3300014745 Ga0157377_10568698 Ga0157377_105686981 151
190 3300014969 Ga0157376_10121716 Ga0157376_101217163 151
191 3300014969 Ga0157376_11889926 Ga0157376_118899261 151
192 3300021361 Ga0213872_10043185 Ga0213872_100431852 151
193 3300021384 Ga0213876_10011213 Ga0213876_100112133 151
194 3300025231 Ga0207427_100093 Ga0207427_10009372 151
195 3300025233 Ga0209437_100008 Ga0209437_100008490 151
196 3300025242 Ga0209258_110456 Ga0209258_1104562 151
197 3300025250 Ga0209026_1021849 Ga0209026_10218492 151
198 3300025261 Ga0209233_1000024 Ga0209233_1000024167 151
199 3300025261 Ga0209233_1046334 Ga0209233_10463341 151
200 3300025272 Ga0209455_1005140 Ga0209455_10051402 151
201 3300025899 Ga0207642_10128922 Ga0207642_101289222 151
202 3300025899 Ga0207642_10246488 Ga0207642_102464882 151
203 3300025904 Ga0207647_10000209 Ga0207647_1000020939 151
204 3300025907 Ga0207645_10001060 Ga0207645_1000106015 151
205 3300025909 Ga0207705_10000102 Ga0207705_1000010218 151
206 3300025909 Ga0207705_10084165 Ga0207705_100841652 151
207 3300025909 Ga0207705_11141353 Ga0207705_111413531 151
208 3300025911 Ga0207654_10036834 Ga0207654_100368341 151
209 3300025911 Ga0207654_10138980 Ga0207654_101389802 151
210 3300025911 Ga0207654_10140150 Ga0207654_101401502 151
211 3300025911 Ga0207654_10330321 Ga0207654_103303212 151
212 3300025911 Ga0207654_10516771 Ga0207654_105167712 151
213 3300025911 Ga0207654_10774513 Ga0207654_107745132 151
214 3300025913 Ga0207695_10016425 Ga0207695_100164257 151
215 3300025913 Ga0207695_10032746 Ga0207695_100327463 151
216 3300025913 Ga0207695_10087749 Ga0207695_100877492 151
217 3300025913 Ga0207695_10315499 Ga0207695_103154992 151
218 3300025913 Ga0207695_10552102 Ga0207695_105521022 151
219 3300025914 Ga0207671_10000901 Ga0207671_1000090120 151
220 3300025914 Ga0207671_10002483 Ga0207671_1000248311 151
221 3300025914 Ga0207671_10031097 Ga0207671_100310972 151
222 3300025919 Ga0207657_10055649 Ga0207657_100556492 151
223 3300025919 Ga0207657_10066677 Ga0207657_100666772 151
224 3300025924 Ga0207694_10275289 Ga0207694_102752892 151
225 3300025924 Ga0207694_10878322 Ga0207694_108783222 151
226 3300025927 Ga0207687_11204263 Ga0207687_112042632 151
227 3300025931 Ga0207644_10196593 Ga0207644_101965932 151
228 3300025932 Ga0207690_10000770 Ga0207690_100007705 151
229 3300025933 Ga0207706_10000257 Ga0207706_1000025727 151
230 3300025934 Ga0207686_10145419 Ga0207686_101454192 151
231 3300025935 Ga0207709_10143487 Ga0207709_101434872 151
232 3300025937 Ga0207669_10191093 Ga0207669_101910931 151
233 3300025938 Ga0207704_10000016 Ga0207704_1000001693 151
234 3300025940 Ga0207691_10082920 Ga0207691_100829203 151
235 3300025942 Ga0207689_10182878 Ga0207689_101828782 151
236 3300025949 Ga0207667_10007901 Ga0207667_100079019 151
237 3300025949 Ga0207667_10100674 Ga0207667_101006742 151
238 3300025960 Ga0207651_10023616 Ga0207651_100236162 151
239 3300025981 Ga0207640_11215844 Ga0207640_112158441 151
240 3300026023 Ga0207677_10040686 Ga0207677_100406862 151
241 3300026023 Ga0207677_10089688 Ga0207677_100896882 151
242 3300026023 Ga0207677_10865643 Ga0207677_108656432 151
243 3300026035 Ga0207703_11063402 Ga0207703_110634021 151
244 3300026041 Ga0207639_10004646 Ga0207639_100046462 151
245 3300026041 Ga0207639_10039069 Ga0207639_100390693 151
246 3300026041 Ga0207639_10094960 Ga0207639_100949602 151
247 3300026041 Ga0207639_10392281 Ga0207639_103922812 151
248 3300026041 Ga0207639_11825327 Ga0207639_118253271 151
249 3300026067 Ga0207678_10049791 Ga0207678_100497915 151
250 3300026067 Ga0207678_10434334 Ga0207678_104343342 151
251 3300026078 Ga0207702_10027576 Ga0207702_100275762 151
252 3300026078 Ga0207702_10092895 Ga0207702_100928954 151
253 3300026078 Ga0207702_10207652 Ga0207702_102076522 151
254 3300026089 Ga0207648_10011699 Ga0207648_100116997 151
255 3300026095 Ga0207676_11305186 Ga0207676_113051861 151
256 3300026121 Ga0207683_10003553 Ga0207683_1000355315 151
257 3300026142 Ga0207698_10003621 Ga0207698_1000362110 151
258 3300026142 Ga0207698_10995404 Ga0207698_109954042 151
259 3300026142 Ga0207698_11646716 Ga0207698_116467162 151
260 3300028379 Ga0268266_10000291 Ga0268266_1000029152 151
261 3300028786 Ga0307517_10003309 Ga0307517_100033092 151
262 3300031507 Ga0307509_10183855 Ga0307509_101838552 151
263 3300031507 Ga0307509_10374046 Ga0307509_103740462 151
264 3300033180 Ga0307510_10000612 Ga0307510_1000061224 151
265 3300033180 Ga0307510_10000638 Ga0307510_100006382 151
266 3300035115 Ga0373941_0003172 Ga0373941_0003172_1344_1808 151
267 3300035695 Ga0373927_0083630 Ga0373927_0083630_151_612 151
268 3300037312 Ga0395899_0000001 Ga0395899_0000001_1232176_1232652 151
269 3300037312 Ga0395899_0004840 Ga0395899_0004840_3504_3959 151
270 3300037312 Ga0395899_0027187 Ga0395899_0027187_3481_3945 151
271 3300037418 Ga0395900_0000327 Ga0395900_0000327_32117_32620 151
272 3300037418 Ga0395900_0001751 Ga0395900_0001751_3954_4409 151
273 3300037418 Ga0395900_0012635 Ga0395900_0012635_861_1325 151
274 3300037418 Ga0395900_1234732 Ga0395900_1234732_186_650 151
275 3300037466 Ga0395898_0008234 Ga0395898_0008234_834_1289 151
276 3300037466 Ga0395898_0360963 Ga0395898_0360963_785_1249 151
277 3300037471 Ga0395905_0000461 Ga0395905_0000461_35688_36143 151
278 3300037471 Ga0395905_0001887 Ga0395905_0001887_21093_21557 151
279 3300038443 Ga0395901_0000464 Ga0395901_0000464_30314_30769 151
280 3300038443 Ga0395901_0041539 Ga0395901_0041539_3994_4458 151
281 3300039437 Ga0436365_0548634 Ga0436365_0548634_1064_1534 151
282 3300039447 Ga0436361_0572592 Ga0436361_0572592_842_1297 151
283 3300042005 Ga0439448_0012160 Ga0439448_0012160_949_1404 151
284 3300044735 Ga0466968_0424364 Ga0466968_0424364_19_480 151
285 3300046462 Ga0495651_0098425 Ga0495651_0098425_1047_1562 151
286 3300046492 Ga0495585_0514264 Ga0495585_0514264_62_523 151
287 3300046507 Ga0495606_0007717 Ga0495606_0007717_3373_3882 151
288 3300046507 Ga0495606_0009897 Ga0495606_0009897_1947_2411 151
289 3300046518 Ga0495631_0020448 Ga0495631_0020448_1482_1943 151
290 3300046519 Ga0495632_0157619 Ga0495632_0157619_407_868 151
291 3300046523 Ga0495644_0009355 Ga0495644_0009355_1479_1940 151
292 3300046528 Ga0495642_0293193 Ga0495642_0293193_199_660 151
293 3300046538 Ga0495609_0259656 Ga0495609_0259656_107_568 151
294 3300046616 Ga0495668_0118767 Ga0495668_0118767_207_668 151
295 3300046665 Ga0495661_0172926 Ga0495661_0172926_348_809 151
296 3300046684 Ga0495669_0128607 Ga0495669_0128607_69_530 151
297 3300046691 Ga0495670_0175971 Ga0495670_0175971_504_965 151
298 3300047443 Ga0495687_000879 Ga0495687_000879_28092_28547 151
299 3300047472 Ga0495686_0145010 Ga0495686_0145010_99_560 151
300 3300049460 Ga0495682_0056767 Ga0495682_0056767_816_1277 151
301 3300049573 Ga0501037_0095487 Ga0501037_0095487_869_1336 151
302 3300049586 Ga0501070_0168409 Ga0501070_0168409_811_1278 151
303 3300049742 Ga0501080_0126330 Ga0501080_0126330_1210_1677 151
304 3300049823 Ga0501044_0266806 Ga0501044_0266806_891_1358 151
305 3300050493 nmdc:mga0k408_323_c1 nmdc:mga0k408_323_c1_14567_15031 151
306 3300050496 nmdc:mga07m45_76964_c1 nmdc:mga07m45_76964_c1_476_940 151
307 3300053080 Ga0500635_0011768 Ga0500635_0011768_123_587 151
308 3300053122 Ga0500608_000855 Ga0500608_000855_5979_6440 151
309 3300053130 Ga0500642_0035400 Ga0500642_0035400_449_913 151
310 3300053156 Ga0500622_0000719 Ga0500622_0000719_4753_5259 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

40

165

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ayc-assembly1.cif.gz_A scalindua brodae amxfabz, i69g mutant 0.8899 2 145
7qv0-assembly1.cif.gz_B-2 covalent complex between scalindua brodae amxfabz and amxacp 0.8872 2 144
5buy-assembly1.cif.gz_F crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from francisella tularensis 0.8833 3 143
5buy-assembly1.cif.gz_C crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from francisella tularensis 0.8807 5 145
8ayb-assembly1.cif.gz_A anammox-specific fabz from scalindua brodae 0.8804 2 145
ID Description Score Start End Superfamily
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8833 3 143 3.10.129.10
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8632 3 146 3.10.129.10
4zw0B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8609 9 144 3.10.129.10
2gllA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8547 3 148 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8536 3 144 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7L8ACN7-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.944 3 147 GO:0016829
AF-A0A5C7BFW5-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.941 3 145 GO:0016829
AF-A2TYF3-F1-model_v4 3-hydroxymyristoyl/3-hydroxydecanoyl-(Acyl carrier protein) dehydratase 0.9402 2 147 GO:0016020
GO:0016829
AF-A0A1M5N518-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase 0.9397 3 147 GO:0016829
AF-A0A7C7UBC7-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.935 7 147 GO:0016829

Feature Viewer

pLDDT pTM Quality
87.26 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map