F400784

General Info

Members Datasets Scaffolds Average Seq Length
310 207 620 269

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10113102|Ga0307515_101131022
Length 316
Sequence VHGKYETYSFDTYASTSIIPSSTIGSLTRLKGQNHCTGEEKTLPKTATAQFTNVATRQPMTETGDEPLVSLKKVGLSFGAIEILRDVDLDIRQGEFVCVVGPSGSGKTTLLRLLAGLLSATTGTVSYCGRPHSAPAPEIAIVFQDYANALLPWRTAAGNVSLVLEANGMPRDKREGRIAELLGKVGLSRHAERFPSEMSGGMQQRLQIARCLAQEPAVLLMDEPFGALDAMTRQRLQDEILSIVSETGVTAFFVTHDLEEAIYLGDRIIALEPHPGRIAEVFDVDLQRPRDQLATREMPEFLTLRRQLFDFIRRYE

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
113 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
114 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
115 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
132 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
184 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
185 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
186 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
189 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
190 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
193 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
194 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
195 2643221558 Rhizobium sp. Root149 Isolate Unclassified
196 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
197 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
198 2802429633 Rhizobium anhuiense J3 Isolate Nodule
199 2802429634 Rhizobium anhuiense S10 Isolate Nodule
200 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
201 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
202 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
203 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
204 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
205 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
206 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
207 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.19
Metatranscriptomes 0
Isolates 5.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.9
Nodule 2.26
Rhizoplane 4.52
Rhizosphere 61.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10113102 3300028794 Bacteria 3151
2 JGI24740J21852_10000079 3300001979 Bacteria 32962
3 JGI25162J39368_1000175 3300002737 Bacteria 68975
4 JGI25406J46586_10011602 3300003203 Bacteria 3859
5 JGI25165J46597_1000345 3300003214 Bacteria 53409
6 JGI25153J46596_10030640 3300003215 Bacteria 1826
7 rootH1_10040111 3300003323 Bacteria 22232
8 Ga0055526_1000444 3300003771 Bacteria 32945
9 Ga0055526_1023480 3300003771 Bacteria 2057
10 Ga0055524_1000031 3300003775 Bacteria 187744
11 Ga0055524_1000512 3300003775 Bacteria 29872
12 Ga0055528_1000735 3300003790 Bacteria 22884
13 Ga0055531_10000703 3300003794 Bacteria 28514
14 Ga0065165_1003204 3300005262 Bacteria 11931
15 Ga0070683_100006713 3300005329 Bacteria 9665
16 Ga0068868_100050221 3300005338 Bacteria 3275
17 Ga0070674_100245224 3300005356 Bacteria 1405
18 Ga0070673_100197151 3300005364 Bacteria 1732
19 Ga0070659_100110443 3300005366 Bacteria 2219
20 Ga0070663_100162772 3300005455 Bacteria 1719
21 Ga0070678_100030203 3300005456 Bacteria 3723
22 Ga0070681_10010157 3300005458 Bacteria 9284
23 Ga0068867_100516732 3300005459 Bacteria 1029
24 Ga0070679_100001696 3300005530 Bacteria 19858
25 Ga0070684_100108183 3300005535 Bacteria 2491
26 Ga0070672_100202422 3300005543 Bacteria 1661
27 Ga0070686_100124646 3300005544 Bacteria 1773
28 Ga0070704_100249464 3300005549 Bacteria 1457
29 Ga0068854_100193236 3300005578 Bacteria 1596
30 Ga0068859_100610521 3300005617 Bacteria 1184
31 Ga0068863_100441815 3300005841 Bacteria 1276
32 Ga0081539_10002005 3300005985 Bacteria 30877
33 Ga0075365_10000092 3300006038 Bacteria 26061
34 Ga0075365_10036952 3300006038 Bacteria 3168
35 Ga0075363_100001441 3300006048 Bacteria 9009
36 Ga0075363_100001849 3300006048 Bacteria 8330
37 Ga0075363_100017426 3300006048 Bacteria 3563
38 Ga0075363_100120820 3300006048 Bacteria 1463
39 Ga0075364_10014803 3300006051 Bacteria 4825
40 Ga0075364_10017869 3300006051 Bacteria 4435
41 Ga0075362_10000204 3300006177 Bacteria 16536
42 Ga0075362_10008244 3300006177 Bacteria 3978
43 Ga0075362_10011268 3300006177 Bacteria 3519
44 Ga0075367_10000381 3300006178 Bacteria 16064
45 Ga0075367_10000661 3300006178 Bacteria 13188
46 Ga0075367_10012686 3300006178 Bacteria 4505
47 Ga0075367_10066438 3300006178 Bacteria 2161
48 Ga0075369_10007925 3300006186 Bacteria 4069
49 Ga0075369_10047928 3300006186 Bacteria 1843
50 Ga0075366_10004941 3300006195 Bacteria 7192
51 Ga0075366_10005385 3300006195 Bacteria 6936
52 Ga0075366_10006483 3300006195 Bacteria 6418
53 Ga0097621_100204405 3300006237 Bacteria 1716
54 Ga0075370_10020153 3300006353 Bacteria 3641
55 Ga0068871_100064591 3300006358 Bacteria 2997
56 Ga0097620_100610583 3300006931 Bacteria 1184
57 Ga0105240_10028681 3300009093 Bacteria 7263
58 Ga0111539_10074410 3300009094 Bacteria 4002
59 Ga0105245_10010762 3300009098 Bacteria 7960
60 Ga0105247_10022902 3300009101 Bacteria 3762
61 Ga0105241_10057230 3300009174 Bacteria 2990
62 Ga0105248_10035157 3300009177 Bacteria 5606
63 Ga0105238_10026341 3300009551 Bacteria 5927
64 Ga0157370_10004116 3300013104 Bacteria 16857
65 Ga0157370_10193177 3300013104 Bacteria 1889
66 Ga0157374_10524008 3300013296 Bacteria 1191
67 Ga0157379_10221721 3300014968 Bacteria 1713
68 Ga0157379_10330832 3300014968 Bacteria 1392
69 Ga0157379_10708913 3300014968 Bacteria 945
70 Ga0163161_10060839 3300017792 Bacteria 2749
71 Ga0213876_10008256 3300021384 Bacteria 5634
72 Ga0209437_100300 3300025233 Bacteria 69341
73 Ga0209233_1000314 3300025261 Bacteria 54407
74 Ga0209673_1001789 3300025273 Bacteria 17771
75 Ga0209673_1002857 3300025273 Bacteria 11034
76 Ga0209675_1018249 3300025291 Bacteria 1970
77 Ga0209564_1000135 3300025295 Bacteria 188117
78 Ga0209564_1041136 3300025295 Bacteria 1244
79 Ga0209758_1000329 3300025297 Bacteria 89451
80 Ga0209758_1002975 3300025297 Bacteria 16245
81 Ga0209256_1000107 3300025299 Bacteria 186233
82 Ga0209256_1000902 3300025299 Bacteria 36378
83 Ga0209051_1033563 3300025303 Bacteria 1939
84 Ga0209257_1003720 3300025304 Bacteria 12668
85 Ga0207710_10013411 3300025900 Bacteria 3449
86 Ga0207647_10270360 3300025904 Bacteria 972
87 Ga0207654_10132957 3300025911 Bacteria 1577
88 Ga0207707_10013451 3300025912 Bacteria 7131
89 Ga0207695_10047032 3300025913 Bacteria 4569
90 Ga0207671_10127544 3300025914 Bacteria 1950
91 Ga0207671_10139101 3300025914 Bacteria 1869
92 Ga0207693_10275706 3300025915 Bacteria 1318
93 Ga0207652_10007816 3300025921 Bacteria 8589
94 Ga0207694_10013204 3300025924 Bacteria 6220
95 Ga0207687_10115594 3300025927 Bacteria 1999
96 Ga0207700_10709981 3300025928 Bacteria 898
97 Ga0207690_10514404 3300025932 Bacteria 969
98 Ga0207706_10166548 3300025933 Bacteria 1937
99 Ga0207669_10473278 3300025937 Bacteria 997
100 Ga0207691_10204144 3300025940 Bacteria 1719
101 Ga0207651_10531923 3300025960 Bacteria 1020
102 Ga0207640_10114080 3300025981 Bacteria 1922
103 Ga0207658_10650431 3300025986 Bacteria 950
104 Ga0207677_10070991 3300026023 Bacteria 2456
105 Ga0207703_10345452 3300026035 Bacteria 1369
106 Ga0207678_10176759 3300026067 Bacteria 1823
107 Ga0207676_10304724 3300026095 Bacteria 1456
108 Ga0209981_1001312 3300027378 Bacteria 3151
109 Ga0209999_1000431 3300027543 Bacteria 6466
110 Ga0207428_10186088 3300027907 Bacteria 1567
111 Ga0265334_10021214 3300028573 Bacteria 2653
112 Ga0265318_10000828 3300028577 Bacteria 20419
113 Ga0265318_10000940 3300028577 Bacteria 18811
114 Ga0307517_10009718 3300028786 Bacteria 13592
115 Ga0307512_10075980 3300030522 Bacteria 2453
116 Ga0265320_10086879 3300031240 Bacteria 1453
117 Ga0265325_10019549 3300031241 Bacteria 3741
118 Ga0265331_10046374 3300031250 Bacteria 2094
119 Ga0265327_10008898 3300031251 Bacteria 7372
120 Ga0265327_10047352 3300031251 Bacteria 2269
121 Ga0265327_10053599 3300031251 Bacteria 2092
122 Ga0265316_10004690 3300031344 Bacteria 13543
123 Ga0265316_10102078 3300031344 Bacteria 2179
124 Ga0307509_10054672 3300031507 Bacteria 4248
125 Ga0307509_10262777 3300031507 Bacteria 1500
126 Ga0265313_10001116 3300031595 Bacteria 25640
127 Ga0265313_10008969 3300031595 Bacteria 6560
128 Ga0265314_10014619 3300031711 Bacteria 6267
129 Ga0265342_10047024 3300031712 Bacteria 2591
130 Ga0265342_10161936 3300031712 Bacteria 1236
131 Ga0307516_10010108 3300031730 Bacteria 10431
132 Ga0307507_10128942 3300033179 Bacteria 1988
133 Ga0373935_0291625 3300035692 Bacteria 1151
134 Ga0373947_0113069 3300035725 Bacteria 1718
135 Ga0373925_0157743 3300037068 Bacteria 1786
136 Ga0436365_0054807 3300039437 Bacteria 14219
137 Ga0436365_1125593 3300039437 Bacteria 5412
138 Ga0436360_0637771 3300039438 Bacteria 5186
139 Ga0436361_0402940 3300039447 Bacteria 5105
140 Ga0436361_0492780 3300039447 Bacteria 5401
141 Ga0436362_0509243 3300039453 Bacteria 1690
142 Ga0439439_0015856 3300041406 Bacteria 1842
143 Ga0439449_0000992 3300042007 Bacteria 11152
144 Ga0439462_0010271 3300042015 Bacteria 2371
145 Ga0450902_015588 3300042137 Bacteria 1234
146 Ga0439458_0021647 3300042157 Bacteria 1490
147 Ga0439464_0003963 3300042439 Bacteria 3767
148 Ga0495662_0104969 3300046476 Bacteria 1383
149 Ga0495584_0026108 3300046491 Bacteria 2959
150 Ga0495630_0091932 3300046517 Bacteria 2293
151 Ga0495632_0069181 3300046519 Bacteria 1700
152 Ga0495643_0050303 3300046522 Bacteria 2245
153 Ga0495648_0035602 3300046524 Bacteria 3226
154 Ga0495587_0117504 3300046536 Bacteria 1525
155 Ga0495621_0047503 3300046539 Bacteria 1526
156 Ga0495656_0011916 3300046615 Bacteria 3199
157 Ga0495588_0018538 3300046674 Bacteria 3396
158 Ga0495599_0179948 3300046678 Bacteria 1304
159 Ga0495599_0243383 3300046678 Bacteria 1096
160 Ga0495613_0378642 3300046689 Bacteria 968
161 Ga0495671_0037087 3300046692 Bacteria 2467
162 Ga0495604_0006084 3300047317 Bacteria 9576
163 Ga0495674_0122798 3300047319 Bacteria 2193
164 Ga0495673_0033659 3300047469 Bacteria 2376
165 Ga0495615_0004739 3300048090 Bacteria 2398
166 Ga0495615_0004864 3300048090 Bacteria 2375
167 Ga0496100_0084742 3300048903 Bacteria 2149
168 Ga0496101_0074223 3300048904 Bacteria 2501
169 Ga0496102_0107228 3300048905 Bacteria 2601
170 Ga0496104_0018418 3300048907 Bacteria 6370
171 Ga0496105_0018043 3300048908 Bacteria 5664
172 Ga0496105_0229247 3300048908 Bacteria 1510
173 Ga0496108_0405670 3300048911 Bacteria 1190
174 Ga0496109_0178453 3300048912 Bacteria 1994
175 Ga0496109_0391101 3300048912 Bacteria 1314
176 Ga0496110_0028605 3300048913 Bacteria 4790
177 Ga0496114_0243973 3300048917 Bacteria 1580
178 Ga0496114_0305743 3300048917 Bacteria 1404
179 Ga0496114_0654373 3300048917 Bacteria 924
180 Ga0496115_0209768 3300048918 Bacteria 1609
181 Ga0496116_0094601 3300048919 Bacteria 1806
182 Ga0496116_0187455 3300048919 Bacteria 1099
183 Ga0496119_0010427 3300048922 Bacteria 7820
184 Ga0496119_0084409 3300048922 Bacteria 1821
185 Ga0496121_0004817 3300048924 Bacteria 17772
186 Ga0496122_0003994 3300048925 Bacteria 18811
187 Ga0496123_0000844 3300048926 Bacteria 48995
188 Ga0496125_0000446 3300048928 Bacteria 75321
189 Ga0496126_0050141 3300048929 Bacteria 3806
190 Ga0501031_0001281 3300049568 Bacteria 15401
191 Ga0501031_0011971 3300049568 Bacteria 5656
192 Ga0501031_0040915 3300049568 Bacteria 3025
193 Ga0501032_0004837 3300049569 Bacteria 10094
194 Ga0501032_0006118 3300049569 Bacteria 8865
195 Ga0501032_0136569 3300049569 Bacteria 1616
196 Ga0501032_0251885 3300049569 Bacteria 1146
197 Ga0501033_0000059 3300049570 Bacteria 105311
198 Ga0501033_0000496 3300049570 Bacteria 37079
199 Ga0501033_0004984 3300049570 Bacteria 10557
200 Ga0501033_0013347 3300049570 Bacteria 6260
201 Ga0501033_0018991 3300049570 Bacteria 5196
202 Ga0501033_0069807 3300049570 Bacteria 2582
203 Ga0501034_0003842 3300049571 Bacteria 16928
204 Ga0501034_0102885 3300049571 Bacteria 2850
205 Ga0501034_0136113 3300049571 Bacteria 2437
206 Ga0501034_0277112 3300049571 Bacteria 1617
207 Ga0501034_0367010 3300049571 Bacteria 1366
208 Ga0501036_0000354 3300049572 Bacteria 32340
209 Ga0501036_0038218 3300049572 Bacteria 4062
210 Ga0501037_0000124 3300049573 Bacteria 71522
211 Ga0501037_0073516 3300049573 Bacteria 2486
212 Ga0501037_0108897 3300049573 Bacteria 1996
213 Ga0501038_0001403 3300049574 Bacteria 22046
214 Ga0501038_0015720 3300049574 Bacteria 6878
215 Ga0501038_0179532 3300049574 Bacteria 1709
216 Ga0501039_0000808 3300049575 Bacteria 22572
217 Ga0501043_0000003 3300049579 Bacteria 318844
218 Ga0501043_0001281 3300049579 Bacteria 22063
219 Ga0501046_0088144 3300049580 Bacteria 2390
220 Ga0501047_0001889 3300049581 Bacteria 20137
221 Ga0501047_0093940 3300049581 Bacteria 2878
222 Ga0501047_0152821 3300049581 Bacteria 2183
223 Ga0501047_0176276 3300049581 Bacteria 2005
224 Ga0501067_0159368 3300049583 Bacteria 1257
225 Ga0501069_0000003 3300049585 Bacteria 210301
226 Ga0501070_0000156 3300049586 Bacteria 62807
227 Ga0501070_0001085 3300049586 Bacteria 24426
228 Ga0501070_0013475 3300049586 Bacteria 6893
229 Ga0501070_0053993 3300049586 Bacteria 3332
230 Ga0501070_0298646 3300049586 Bacteria 1312
231 Ga0501071_0011694 3300049587 Bacteria 5924
232 Ga0501073_0080339 3300049589 Bacteria 2269
233 Ga0501073_0130250 3300049589 Bacteria 1743
234 Ga0501074_0000007 3300049590 Bacteria 111136
235 Ga0501074_0249376 3300049590 Bacteria 1262
236 Ga0501074_0283823 3300049590 Bacteria 1177
237 Ga0501080_0000994 3300049742 Bacteria 23239
238 Ga0501080_0001407 3300049742 Bacteria 20159
239 Ga0501080_0002919 3300049742 Bacteria 15021
240 Ga0501080_0254581 3300049742 Bacteria 1601
241 Ga0501080_0314388 3300049742 Bacteria 1419
242 Ga0501080_0359474 3300049742 Bacteria 1314
243 Ga0501083_0000024 3300049744 Bacteria 123029
244 Ga0501035_0000213 3300049822 Bacteria 69670
245 Ga0501035_0000941 3300049822 Bacteria 30729
246 Ga0501035_0001741 3300049822 Bacteria 21987
247 Ga0501035_0005756 3300049822 Bacteria 11686
248 Ga0501035_0007722 3300049822 Bacteria 10045
249 Ga0501035_0013097 3300049822 Bacteria 7654
250 Ga0501035_0088048 3300049822 Bacteria 2736
251 Ga0501035_0310650 3300049822 Bacteria 1326
252 Ga0501044_0000016 3300049823 Bacteria 231626
253 Ga0501044_0002819 3300049823 Bacteria 19810
254 Ga0501044_0013313 3300049823 Bacteria 8904
255 Ga0501044_0016280 3300049823 Bacteria 7989
256 Ga0501044_0022644 3300049823 Bacteria 6691
257 Ga0501044_0132651 3300049823 Bacteria 2484
258 Ga0501044_0172794 3300049823 Bacteria 2131
259 Ga0501044_0418969 3300049823 Bacteria 1249
260 nmdc:mga03683_4351_c1 3300050489 Bacteria 4688
261 nmdc:mga03683_7224_c1 3300050489 Bacteria 3848
262 nmdc:mga03n38_18770_c2 3300050490 Bacteria 2361
263 nmdc:mga03n38_3811_c1 3300050490 Bacteria 4901
264 nmdc:mga00v17_23815_c1 3300050491 Bacteria 3545
265 nmdc:mga00v17_238563_c1 3300050491 Bacteria 1179
266 nmdc:mga00v17_72655_c1 3300050491 Bacteria 2134
267 nmdc:mga0yw44_145950_c1 3300050492 Bacteria 1541
268 nmdc:mga0yw44_40524_c1 3300050492 Bacteria 2768
269 nmdc:mga0k408_4652_c1 3300050493 Bacteria 7272
270 nmdc:mga0k408_85012_c1 3300050493 Bacteria 1857
271 nmdc:mga0k408_9472_c1 3300050493 Bacteria 5250
272 nmdc:mga06z11_21289_c1 3300050494 Bacteria 3012
273 nmdc:mga06z11_343_c1 3300050494 Bacteria 17585
274 nmdc:mga07m45_5417_c1 3300050496 Bacteria 6349
275 nmdc:mga08y16_27366_c1 3300050511 Bacteria 6007
276 nmdc:mga0sz30_10384_c1 3300050516 Bacteria 3568
277 nmdc:mga0sz30_457_c1 3300050516 Bacteria 15437
278 Ga0495601_0093918 3300053077 Bacteria 1933
279 Ga0495619_0022096 3300053085 Bacteria 4067
280 Ga0500651_0006519 3300053093 Bacteria 6735
281 Ga0500593_000539 3300053117 Bacteria 14760
282 Ga0500595_000408 3300053119 Bacteria 27480
283 Ga0500618_009693 3300053125 Bacteria 2619
284 Ga0500652_000086 3300053131 Bacteria 38984
285 Ga0500568_0039265 3300053139 Bacteria 1912
286 Ga0500627_0170117 3300053158 Bacteria 982
287 Ga0500636_0005131 3300053177 Bacteria 7442
288 Ga0500636_0140805 3300053177 Bacteria 1335
289 Ga0500596_006607 3300053735 Bacteria 1950
290 Ga0501082_0018149 3300060353 Bacteria 6058
291 Ga0501082_0104892 3300060353 Bacteria 2446
292 Ga0530510_0231726 3300061734 Bacteria 1374
293 2511175128 2510917026 Bacteria 7046020
294 2511175635 2510917026 Bacteria 7046020
295 2513911806 2513237144 Bacteria 7530820
296 2643814460 2643221558 Bacteria 5460675
297 2643814500 2643221558 Bacteria 5460675
298 2644200616 2643221636 Bacteria 6583769
299 2739038370 2738541333 Bacteria 7106503
300 2806047842 2802429633 Bacteria 7341974
301 2806055480 2802429634 Bacteria 7083200
302 2806061523 2802429635 Bacteria 7650140
303 2806070202 2802429636 Bacteria 7597525
304 2919173847 2919171160 Bacteria 6499771
305 2919176746 2919171160 Bacteria 6499771
306 2919413427 2919408235 Bacteria 6149349
307 2928116676 2928115317 Bacteria 6477646
308 2935987270 2935984226 Bacteria 8302647
309 8005575620 8005570704 Bacteria 6957481
310 8018154716 8018150411 Bacteria 5549903
311 Ga0307515_10113102
312 JGI24740J21852_10000079
313 JGI25162J39368_1000175
314 JGI25406J46586_10011602
315 JGI25165J46597_1000345
316 JGI25153J46596_10030640
317 rootH1_10040111
318 Ga0055526_1000444
319 Ga0055526_1023480
320 Ga0055524_1000031
321 Ga0055524_1000512
322 Ga0055528_1000735
323 Ga0055531_10000703
324 Ga0065165_1003204
325 Ga0070683_100006713
326 Ga0068868_100050221
327 Ga0070674_100245224
328 Ga0070673_100197151
329 Ga0070659_100110443
330 Ga0070663_100162772
331 Ga0070678_100030203
332 Ga0070681_10010157
333 Ga0068867_100516732
334 Ga0070679_100001696
335 Ga0070684_100108183
336 Ga0070672_100202422
337 Ga0070686_100124646
338 Ga0070704_100249464
339 Ga0068854_100193236
340 Ga0068859_100610521
341 Ga0068863_100441815
342 Ga0081539_10002005
343 Ga0075365_10000092
344 Ga0075365_10036952
345 Ga0075363_100001441
346 Ga0075363_100001849
347 Ga0075363_100017426
348 Ga0075363_100120820
349 Ga0075364_10014803
350 Ga0075364_10017869
351 Ga0075362_10000204
352 Ga0075362_10008244
353 Ga0075362_10011268
354 Ga0075367_10000381
355 Ga0075367_10000661
356 Ga0075367_10012686
357 Ga0075367_10066438
358 Ga0075369_10007925
359 Ga0075369_10047928
360 Ga0075366_10004941
361 Ga0075366_10005385
362 Ga0075366_10006483
363 Ga0097621_100204405
364 Ga0075370_10020153
365 Ga0068871_100064591
366 Ga0097620_100610583
367 Ga0105240_10028681
368 Ga0111539_10074410
369 Ga0105245_10010762
370 Ga0105247_10022902
371 Ga0105241_10057230
372 Ga0105248_10035157
373 Ga0105238_10026341
374 Ga0157370_10004116
375 Ga0157370_10193177
376 Ga0157374_10524008
377 Ga0157379_10221721
378 Ga0157379_10330832
379 Ga0157379_10708913
380 Ga0163161_10060839
381 Ga0213876_10008256
382 Ga0209437_100300
383 Ga0209233_1000314
384 Ga0209673_1001789
385 Ga0209673_1002857
386 Ga0209675_1018249
387 Ga0209564_1000135
388 Ga0209564_1041136
389 Ga0209758_1000329
390 Ga0209758_1002975
391 Ga0209256_1000107
392 Ga0209256_1000902
393 Ga0209051_1033563
394 Ga0209257_1003720
395 Ga0207710_10013411
396 Ga0207647_10270360
397 Ga0207654_10132957
398 Ga0207707_10013451
399 Ga0207695_10047032
400 Ga0207671_10127544
401 Ga0207671_10139101
402 Ga0207693_10275706
403 Ga0207652_10007816
404 Ga0207694_10013204
405 Ga0207687_10115594
406 Ga0207700_10709981
407 Ga0207690_10514404
408 Ga0207706_10166548
409 Ga0207669_10473278
410 Ga0207691_10204144
411 Ga0207651_10531923
412 Ga0207640_10114080
413 Ga0207658_10650431
414 Ga0207677_10070991
415 Ga0207703_10345452
416 Ga0207678_10176759
417 Ga0207676_10304724
418 Ga0209981_1001312
419 Ga0209999_1000431
420 Ga0207428_10186088
421 Ga0265334_10021214
422 Ga0265318_10000828
423 Ga0265318_10000940
424 Ga0307517_10009718
425 Ga0307512_10075980
426 Ga0265320_10086879
427 Ga0265325_10019549
428 Ga0265331_10046374
429 Ga0265327_10008898
430 Ga0265327_10047352
431 Ga0265327_10053599
432 Ga0265316_10004690
433 Ga0265316_10102078
434 Ga0307509_10054672
435 Ga0307509_10262777
436 Ga0265313_10001116
437 Ga0265313_10008969
438 Ga0265314_10014619
439 Ga0265342_10047024
440 Ga0265342_10161936
441 Ga0307516_10010108
442 Ga0307507_10128942
443 Ga0373935_0291625
444 Ga0373947_0113069
445 Ga0373925_0157743
446 Ga0436365_0054807
447 Ga0436365_1125593
448 Ga0436360_0637771
449 Ga0436361_0402940
450 Ga0436361_0492780
451 Ga0436362_0509243
452 Ga0439439_0015856
453 Ga0439449_0000992
454 Ga0439462_0010271
455 Ga0450902_015588
456 Ga0439458_0021647
457 Ga0439464_0003963
458 Ga0495662_0104969
459 Ga0495584_0026108
460 Ga0495630_0091932
461 Ga0495632_0069181
462 Ga0495643_0050303
463 Ga0495648_0035602
464 Ga0495587_0117504
465 Ga0495621_0047503
466 Ga0495656_0011916
467 Ga0495588_0018538
468 Ga0495599_0179948
469 Ga0495599_0243383
470 Ga0495613_0378642
471 Ga0495671_0037087
472 Ga0495604_0006084
473 Ga0495674_0122798
474 Ga0495673_0033659
475 Ga0495615_0004739
476 Ga0495615_0004864
477 Ga0496100_0084742
478 Ga0496101_0074223
479 Ga0496102_0107228
480 Ga0496104_0018418
481 Ga0496105_0018043
482 Ga0496105_0229247
483 Ga0496108_0405670
484 Ga0496109_0178453
485 Ga0496109_0391101
486 Ga0496110_0028605
487 Ga0496114_0243973
488 Ga0496114_0305743
489 Ga0496114_0654373
490 Ga0496115_0209768
491 Ga0496116_0094601
492 Ga0496116_0187455
493 Ga0496119_0010427
494 Ga0496119_0084409
495 Ga0496121_0004817
496 Ga0496122_0003994
497 Ga0496123_0000844
498 Ga0496125_0000446
499 Ga0496126_0050141
500 Ga0501031_0001281
501 Ga0501031_0011971
502 Ga0501031_0040915
503 Ga0501032_0004837
504 Ga0501032_0006118
505 Ga0501032_0136569
506 Ga0501032_0251885
507 Ga0501033_0000059
508 Ga0501033_0000496
509 Ga0501033_0004984
510 Ga0501033_0013347
511 Ga0501033_0018991
512 Ga0501033_0069807
513 Ga0501034_0003842
514 Ga0501034_0102885
515 Ga0501034_0136113
516 Ga0501034_0277112
517 Ga0501034_0367010
518 Ga0501036_0000354
519 Ga0501036_0038218
520 Ga0501037_0000124
521 Ga0501037_0073516
522 Ga0501037_0108897
523 Ga0501038_0001403
524 Ga0501038_0015720
525 Ga0501038_0179532
526 Ga0501039_0000808
527 Ga0501043_0000003
528 Ga0501043_0001281
529 Ga0501046_0088144
530 Ga0501047_0001889
531 Ga0501047_0093940
532 Ga0501047_0152821
533 Ga0501047_0176276
534 Ga0501067_0159368
535 Ga0501069_0000003
536 Ga0501070_0000156
537 Ga0501070_0001085
538 Ga0501070_0013475
539 Ga0501070_0053993
540 Ga0501070_0298646
541 Ga0501071_0011694
542 Ga0501073_0080339
543 Ga0501073_0130250
544 Ga0501074_0000007
545 Ga0501074_0249376
546 Ga0501074_0283823
547 Ga0501080_0000994
548 Ga0501080_0001407
549 Ga0501080_0002919
550 Ga0501080_0254581
551 Ga0501080_0314388
552 Ga0501080_0359474
553 Ga0501083_0000024
554 Ga0501035_0000213
555 Ga0501035_0000941
556 Ga0501035_0001741
557 Ga0501035_0005756
558 Ga0501035_0007722
559 Ga0501035_0013097
560 Ga0501035_0088048
561 Ga0501035_0310650
562 Ga0501044_0000016
563 Ga0501044_0002819
564 Ga0501044_0013313
565 Ga0501044_0016280
566 Ga0501044_0022644
567 Ga0501044_0132651
568 Ga0501044_0172794
569 Ga0501044_0418969
570 nmdc:mga03683_4351_c1
571 nmdc:mga03683_7224_c1
572 nmdc:mga03n38_18770_c2
573 nmdc:mga03n38_3811_c1
574 nmdc:mga00v17_23815_c1
575 nmdc:mga00v17_238563_c1
576 nmdc:mga00v17_72655_c1
577 nmdc:mga0yw44_145950_c1
578 nmdc:mga0yw44_40524_c1
579 nmdc:mga0k408_4652_c1
580 nmdc:mga0k408_85012_c1
581 nmdc:mga0k408_9472_c1
582 nmdc:mga06z11_21289_c1
583 nmdc:mga06z11_343_c1
584 nmdc:mga07m45_5417_c1
585 nmdc:mga08y16_27366_c1
586 nmdc:mga0sz30_10384_c1
587 nmdc:mga0sz30_457_c1
588 Ga0495601_0093918
589 Ga0495619_0022096
590 Ga0500651_0006519
591 Ga0500593_000539
592 Ga0500595_000408
593 Ga0500618_009693
594 Ga0500652_000086
595 Ga0500568_0039265
596 Ga0500627_0170117
597 Ga0500636_0005131
598 Ga0500636_0140805
599 Ga0500596_006607
600 Ga0501082_0018149
601 Ga0501082_0104892
602 Ga0530510_0231726
603 2511175128
604 2511175635
605 2513911806
606 2643814460
607 2643814500
608 2644200616
609 2739038370
610 2806047842
611 2806055480
612 2806061523
613 2806070202
614 2919173847
615 2919176746
616 2919413427
617 2928116676
618 2935987270
619 8005575620
620 8018154716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

84

226

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9309 24 240
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9302 26 241
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9296 26 240
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9285 24 240
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9261 22 240
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9449 25 266 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9415 26 258 3.40.50.300
af_Q9VVK6_333_568_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9389 24 241 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9342 22 242 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9335 24 240 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y1TSQ9-F1-model_v4 ABC transporter ATP-binding protein 0.956 94 240 GO:0005524
GO:0016887
GO:0022857
GO:0055052
AF-A0A554JDB6-F1-model_v4 Nitrate/sulfonate/bicarbonate ABC transporter ATPase 0.9398 26 213 GO:0005524
GO:0016887
AF-A0A7V2AJP2-F1-model_v4 ATP-binding cassette domain-containing protein 0.9392 136 240 GO:0005524
GO:0016887
AF-A0A843I023-F1-model_v4 ABC transporter ATP-binding protein 0.9387 62 266 GO:0005524
GO:0016887
AF-A0A350J169-F1-model_v4 ABC transporter 0.9375 107 224 GO:0005524
GO:0016887

Map