F401009

General Info

Members Datasets Scaffolds Average Seq Length
311 245 277 318

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000063|JGI25162J39368_10000635
Length 360
Sequence MSVPALISSTRSNGPRAYPLTEVGADFLWKNLGQTMLAFIIRRILQSLVVLLVMSLLVFVGVHAIGNPVDVLISPDADQIERAKVIVAFGLDKPLWLQYFIFLKNAAGGDLGRSFAYSTPALALIFERMPATLELSSAAILLSVVLGLXXXXLAGLRPNGLVGKTIMAVSILGFSLPTFWVGLMLIMVFAVQLGWLPTSGRGETQMLFGVPVSFLSWDGLRHLLMPAFNLALFNIALVIRLTRSGAQEALMQDYVKFARAKGLRNSRIIGVHVLKNILIPIVTVVALQFGSIIAFSIVTETVFAWPGMGKLIIDSIRVLDRPVIVAYLLLIVTIFILINLVVDMLYSVLDPRVRLAESKG

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
6 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2738543017 Bacillus sp. OV186 Isolate Unclassified
12 2818991436 Collimonas arenae 515 Isolate Unclassified
13 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
14 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
15 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
16 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
17 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
18 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
19 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
20 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
21 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
22 2857586860 Bacillus sp. R-71935 Isolate Unclassified
23 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
24 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
25 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
26 2885198086 Variovorax sp. 679 Isolate Unclassified
27 2885211737 Variovorax sp. 553 Isolate Unclassified
28 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
29 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
30 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
31 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
32 2928070936 Variovorax gossypii 1167 Isolate Unclassified
33 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
34 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
35 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
36 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
37 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
38 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
39 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
40 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
41 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
42 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
43 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
44 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
45 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
46 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
47 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
48 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
49 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
50 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
51 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
54 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
57 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
58 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
59 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
60 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
61 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
65 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
102 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
114 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
116 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
156 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
157 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
160 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
163 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
237 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
238 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
239 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
240 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
241 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
245 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.46
Metatranscriptomes 1.61
Isolates 10.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.12
Nodule 2.57
Rhizoplane 4.82
Rhizosphere 45.98
Stem 0
Stem Tuber 0
Unclassified 13.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007342 3300001979 Bacteria 4487
2 JGI25155J39150_1000196 3300002704 Bacteria 25624
3 JGI25156J39149_1006728 3300002705 Bacteria 3101
4 JGI25162J39368_1000063 3300002737 Bacteria 134747
5 JGI25154J39366_1000261 3300002738 Bacteria 33723
6 JGI25163J39215_1001690 3300002771 Bacteria 3171
7 JGI25152J39213_1001886 3300002773 Bacteria 8421
8 JGI25159J45721_1003163 3300002987 Bacteria 5921
9 JGI25151J46595_10000318 3300003187 Bacteria 52064
10 JGI25151J46595_10000765 3300003187 Bacteria 26116
11 JGI25151J46595_10002247 3300003187 Bacteria 11858
12 JGI25151J46595_10022864 3300003187 Bacteria 2587
13 JGI25151J46595_10022906 3300003187 Bacteria 2583
14 JGI25165J46597_1000069 3300003214 Bacteria 195460
15 JGI25153J46596_10001510 3300003215 Bacteria 13859
16 rootH1_10165852 3300003316 Bacteria 1592
17 rootH2_10065969 3300003320 Bacteria 2796
18 JGI25160J50197_1003371 3300003354 Bacteria 7163
19 JGI25161J50226_1001139 3300003374 Bacteria 8892
20 Ga0055538_1000034 3300003751 Bacteria 195460
21 Ga0055539_1000044 3300003752 Bacteria 195460
22 Ga0055533_1000055 3300003756 Bacteria 195460
23 Ga0055525_1000066 3300003759 Bacteria 195460
24 Ga0055526_1000221 3300003771 Bacteria 49228
25 Ga0055526_1000836 3300003771 Bacteria 23022
26 Ga0055537_1001865 3300003773 Bacteria 7597
27 Ga0055524_1000955 3300003775 Bacteria 18258
28 Ga0055536_1000966 3300003781 Bacteria 18363
29 Ga0055536_1013238 3300003781 Bacteria 2995
30 Ga0055534_1000555 3300003784 Bacteria 19769
31 Ga0055528_1001994 3300003790 Bacteria 11485
32 Ga0055530_10000257 3300003791 Bacteria 47850
33 Ga0055530_10000435 3300003791 Bacteria 37051
34 Ga0055540_1001044 3300003792 Bacteria 17671
35 Ga0055540_1004009 3300003792 Bacteria 6857
36 Ga0055531_10000288 3300003794 Bacteria 50774
37 Ga0055541_1000032 3300003841 Bacteria 195460
38 Ga0055543_1000531 3300004625 Bacteria 21479
39 Ga0065165_1007168 3300005262 Bacteria 5573
40 Ga0065165_1046504 3300005262 Bacteria 1258
41 Ga0070670_100140809 3300005331 Bacteria 2086
42 Ga0070680_100133402 3300005336 Bacteria 2079
43 Ga0070661_100066719 3300005344 Bacteria 2644
44 Ga0070668_100068402 3300005347 Bacteria 2760
45 Ga0070708_100339955 3300005445 Bacteria 1415
46 Ga0070706_100053257 3300005467 Bacteria 3735
47 Ga0070706_100305496 3300005467 Bacteria 1484
48 Ga0070698_100221878 3300005471 Bacteria 1824
49 Ga0070679_100040586 3300005530 Bacteria 4630
50 Ga0070665_100178812 3300005548 Bacteria 2123
51 Ga0070704_100016802 3300005549 Bacteria 4635
52 Ga0068855_100046501 3300005563 Bacteria 5130
53 Ga0068860_100159688 3300005843 Unclassified 2173
54 Ga0081455_10002734 3300005937 Bacteria 20806
55 Ga0081455_10026485 3300005937 Bacteria 5330
56 Ga0081538_10011564 3300005981 Bacteria 7142
57 Ga0081538_10015400 3300005981 Bacteria 5921
58 Ga0081538_10059692 3300005981 Bacteria 2201
59 Ga0081540_1020950 3300005983 Bacteria 3913
60 Ga0081539_10012353 3300005985 Bacteria 6596
61 Ga0075363_100002668 3300006048 Bacteria 7368
62 Ga0075363_100028789 3300006048 Bacteria 2861
63 Ga0075364_10054324 3300006051 Bacteria 2619
64 Ga0075367_10002232 3300006178 Bacteria 8747
65 Ga0075367_10045016 3300006178 Bacteria 2589
66 Ga0075369_10096400 3300006186 Bacteria 1324
67 Ga0075366_10004775 3300006195 Bacteria 7305
68 Ga0075370_10005869 3300006353 Bacteria 6136
69 Ga0075370_10071106 3300006353 Bacteria 1990
70 Ga0075428_100227905 3300006844 Bacteria 2011
71 Ga0075434_100254222 3300006871 Bacteria 1776
72 Ga0105240_10001823 3300009093 Bacteria 35764
73 Ga0105240_10013542 3300009093 Bacteria 11194
74 Ga0105240_10192201 3300009093 Bacteria 2399
75 Ga0114129_10489111 3300009147 Bacteria 1609
76 Ga0157370_10230308 3300013104 Bacteria 1715
77 Ga0163162_10267017 3300013306 Bacteria 1843
78 Ga0157379_10025995 3300014968 Bacteria 5207
79 Ga0182006_1015341 3300015261 Bacteria 3285
80 Ga0182006_1052713 3300015261 Bacteria 1562
81 Ga0182007_10005215 3300015262 Bacteria 5744
82 Ga0182005_1000680 3300015265 Bacteria 15928
83 Ga0163161_10063934 3300017792 Bacteria 2683
84 Ga0197907_10318692 3300020069 Bacteria 1916
85 Ga0206350_10725852 3300020080 Bacteria 1906
86 Ga0213876_10126150 3300021384 Bacteria 1359
87 Ga0224712_10008235 3300022467 Bacteria 3078
88 Ga0224712_10043929 3300022467 Bacteria 1702
89 Ga0209435_100106 3300025206 Bacteria 32841
90 Ga0209760_100910 3300025207 Bacteria 3690
91 Ga0209436_100642 3300025208 Bacteria 14889
92 Ga0209784_100049 3300025224 Bacteria 195512
93 Ga0209566_100061 3300025225 Bacteria 195512
94 Ga0209674_100069 3300025226 Bacteria 243948
95 Ga0209672_105536 3300025228 Bacteria 2152
96 Ga0209563_100083 3300025230 Bacteria 195512
97 Ga0207427_101746 3300025231 Bacteria 7108
98 Ga0209437_100091 3300025233 Bacteria 243344
99 Ga0209437_100611 3300025233 Bacteria 21911
100 Ga0207425_1000547 3300025245 Bacteria 22417
101 Ga0209646_1000186 3300025246 Bacteria 77615
102 Ga0209026_1001244 3300025250 Bacteria 11663
103 Ga0209677_100039 3300025253 Bacteria 243974
104 Ga0209759_1000765 3300025256 Bacteria 27365
105 Ga0209129_1000153 3300025258 Bacteria 110699
106 Ga0209129_1002754 3300025258 Bacteria 8217
107 Ga0209233_1000115 3300025261 Bacteria 243344
108 Ga0209565_1000738 3300025263 Bacteria 19451
109 Ga0209673_1000610 3300025273 Bacteria 54743
110 Ga0209130_1000253 3300025284 Bacteria 67426
111 Ga0209130_1001190 3300025284 Bacteria 18542
112 Ga0209130_1014672 3300025284 Bacteria 1958
113 Ga0209675_1000757 3300025291 Bacteria 21688
114 Ga0209676_1000005 3300025292 Bacteria 1076001
115 Ga0209676_1000940 3300025292 Bacteria 35862
116 Ga0209676_1007491 3300025292 Bacteria 5104
117 Ga0209025_1000041 3300025294 Bacteria 373694
118 Ga0209025_1000429 3300025294 Bacteria 83306
119 Ga0209025_1002800 3300025294 Bacteria 17567
120 Ga0209025_1005204 3300025294 Bacteria 10733
121 Ga0209025_1008299 3300025294 Bacteria 7496
122 Ga0209564_1000426 3300025295 Bacteria 74234
123 Ga0209564_1000632 3300025295 Bacteria 53684
124 Ga0209758_1000153 3300025297 Bacteria 161668
125 Ga0209758_1002010 3300025297 Bacteria 21870
126 Ga0209758_1018870 3300025297 Bacteria 3356
127 Ga0209050_1000007 3300025298 Bacteria 1187891
128 Ga0209050_1000394 3300025298 Bacteria 81992
129 Ga0209256_1000038 3300025299 Bacteria 375225
130 Ga0207426_1000085 3300025302 Bacteria 293171
131 Ga0207426_1000090 3300025302 Bacteria 280662
132 Ga0207426_1000390 3300025302 Bacteria 74933
133 Ga0207426_1000526 3300025302 Bacteria 55544
134 Ga0209051_1000009 3300025303 Bacteria 706778
135 Ga0209051_1001213 3300025303 Bacteria 23197
136 Ga0209257_1000011 3300025304 Bacteria 1112630
137 Ga0207713_1079525 3300025735 Bacteria 1183
138 Ga0207645_10104670 3300025907 Bacteria 1828
139 Ga0207684_10050667 3300025910 Bacteria 3522
140 Ga0207684_10078784 3300025910 Bacteria 2803
141 Ga0207695_10001901 3300025913 Bacteria 32585
142 Ga0207695_10024057 3300025913 Bacteria 6865
143 Ga0207649_10162855 3300025920 Bacteria 1547
144 Ga0207694_10218338 3300025924 Bacteria 1554
145 Ga0207670_10258131 3300025936 Bacteria 1350
146 Ga0207665_10270613 3300025939 Bacteria 1261
147 Ga0207691_10090305 3300025940 Bacteria 2746
148 Ga0207691_10318612 3300025940 Bacteria 1333
149 Ga0207667_10006267 3300025949 Bacteria 14437
150 Ga0209813_10019253 3300027866 Bacteria 1895
151 Ga0307511_10000816 3300030521 Bacteria 33250
152 Ga0265327_10010001 3300031251 Bacteria 6750
153 Ga0307408_100095043 3300031548 Bacteria 2258
154 Ga0307412_10008003 3300031911 Bacteria 6028
155 Ga0307416_100129323 3300032002 Bacteria 2269
156 Ga0307414_10222671 3300032004 Bacteria 1550
157 Ga0307411_10042858 3300032005 Bacteria 2892
158 Ga0307411_10200758 3300032005 Bacteria 1531
159 Ga0316593_10076930 3300032168 Bacteria 1160
160 Ga0373937_0245663 3300036401 Bacteria 1687
161 Ga0395900_0082706 3300037418 Bacteria 3299
162 Ga0395900_0180588 3300037418 Bacteria 2145
163 Ga0395905_0003185 3300037471 Bacteria 17666
164 Ga0395905_0004557 3300037471 Bacteria 14348
165 Ga0395905_0024920 3300037471 Bacteria 5645
166 Ga0395905_0247937 3300037471 Bacteria 1664
167 Ga0395901_0018952 3300038443 Bacteria 7036
168 Ga0436365_0467216 3300039437 Bacteria 32491
169 Ga0439436_0000850 3300041404 Bacteria 8334
170 Ga0439453_0015672 3300041408 Bacteria 1314
171 Ga0439432_014065 3300042006 Bacteria 2711
172 Ga0439449_0001019 3300042007 Bacteria 11049
173 Ga0439452_007622 3300042010 Bacteria 3308
174 Ga0439457_008685 3300042014 Bacteria 2386
175 Ga0439462_0000359 3300042015 Bacteria 8656
176 Ga0450898_017631 3300042134 Bacteria 1230
177 Ga0450908_006825 3300042184 Bacteria 2160
178 Ga0466972_0000037 3300044658 Bacteria 137184
179 Ga0466972_0059448 3300044658 Bacteria 1835
180 Ga0466965_0030546 3300044683 Bacteria 2626
181 Ga0466965_0049678 3300044683 Bacteria 2079
182 Ga0466966_0015022 3300044684 Bacteria 5121
183 Ga0466966_0015260 3300044684 Bacteria 5080
184 Ga0466963_0074704 3300044694 Bacteria 2287
185 Ga0466970_0030420 3300044765 Bacteria 2847
186 Ga0466959_0015382 3300045049 Bacteria 5572
187 Ga0466959_0285069 3300045049 Bacteria 1133
188 Ga0466967_0261149 3300045976 Bacteria 1657
189 Ga0495592_0016678 3300046454 Bacteria 5574
190 Ga0495651_0012936 3300046462 Bacteria 6448
191 Ga0495653_0008408 3300046463 Bacteria 8464
192 Ga0495650_0000097 3300046471 Bacteria 216051
193 Ga0495650_0099503 3300046471 Bacteria 1094
194 Ga0495606_0000935 3300046507 Bacteria 43005
195 Ga0495606_0164297 3300046507 Bacteria 1293
196 Ga0495608_0055909 3300046511 Bacteria 2607
197 Ga0495608_0064629 3300046511 Bacteria 2398
198 Ga0495618_0006209 3300046514 Bacteria 7250
199 Ga0495628_0002638 3300046516 Bacteria 16080
200 Ga0495628_0008325 3300046516 Bacteria 8907
201 Ga0495643_0005212 3300046522 Bacteria 8855
202 Ga0495663_0003090 3300046525 Bacteria 4863
203 Ga0495642_0026635 3300046528 Bacteria 2297
204 Ga0495652_0004311 3300046529 Bacteria 13631
205 Ga0495652_0016943 3300046529 Bacteria 6510
206 Ga0495597_0008157 3300046542 Bacteria 5267
207 Ga0495645_0175243 3300046543 Bacteria 1473
208 Ga0495622_0000170 3300046557 Bacteria 53452
209 Ga0495625_0001268 3300046660 Bacteria 31730
210 Ga0495625_0001669 3300046660 Bacteria 25981
211 Ga0495661_0001050 3300046665 Bacteria 24497
212 Ga0495588_0120004 3300046674 Bacteria 1386
213 Ga0495599_0009230 3300046678 Bacteria 6019
214 Ga0495623_0005096 3300046679 Bacteria 8622
215 Ga0495623_0009176 3300046679 Bacteria 6417
216 Ga0495646_0001273 3300046680 Bacteria 14827
217 Ga0495646_0174112 3300046680 Bacteria 1184
218 Ga0495624_0067684 3300046690 Bacteria 2227
219 Ga0495600_0002154 3300046809 Bacteria 11161
220 Ga0495604_0027616 3300047317 Bacteria 4512
221 Ga0495636_0001425 3300047318 Bacteria 9043
222 Ga0495687_004270 3300047443 Bacteria 9773
223 Ga0495685_005567 3300047447 Bacteria 4115
224 Ga0495602_0089567 3300048088 Bacteria 2558
225 Ga0495602_0117852 3300048088 Bacteria 2142
226 Ga0495615_0025638 3300048090 Bacteria 1370
227 Ga0496100_0040052 3300048903 Bacteria 2979
228 Ga0496101_0148251 3300048904 Bacteria 1793
229 Ga0496102_0157022 3300048905 Bacteria 2138
230 Ga0496107_0077032 3300048910 Bacteria 2429
231 Ga0496108_0033552 3300048911 Bacteria 4264
232 Ga0496109_0507600 3300048912 Bacteria 1138
233 Ga0496110_0050269 3300048913 Bacteria 3660
234 Ga0496111_0038306 3300048914 Bacteria 3435
235 Ga0496111_0224069 3300048914 Bacteria 1397
236 Ga0496112_0010091 3300048915 Bacteria 8553
237 Ga0496113_0102317 3300048916 Bacteria 2221
238 Ga0496114_0161042 3300048917 Bacteria 1951
239 Ga0496116_0014455 3300048919 Bacteria 6302
240 Ga0496117_0079070 3300048920 Bacteria 2168
241 Ga0496118_0025199 3300048921 Bacteria 5109
242 Ga0496121_0061917 3300048924 Bacteria 3068
243 Ga0496121_0261063 3300048924 Bacteria 1196
244 Ga0496122_0000757 3300048925 Bacteria 62588
245 Ga0496123_0000523 3300048926 Bacteria 66280
246 Ga0496123_0090444 3300048926 Bacteria 1820
247 Ga0496124_0448143 3300048927 Bacteria 881
248 Ga0496125_0000313 3300048928 Bacteria 95423
249 Ga0496125_0003263 3300048928 Bacteria 19972
250 Ga0496125_0010403 3300048928 Bacteria 9412
251 Ga0501038_0137857 3300049574 Bacteria 1998
252 Ga0501042_0004566 3300049578 Bacteria 8835
253 Ga0501071_0234812 3300049587 Bacteria 1382
254 Ga0501072_0012224 3300049588 Bacteria 6561
255 Ga0501075_0037968 3300049591 Bacteria 3600
256 Ga0501076_0117113 3300049592 Bacteria 2156
257 Ga0501076_0440407 3300049592 Bacteria 1073
258 Ga0501080_0184791 3300049742 Bacteria 1917
259 Ga0501081_0139456 3300049743 Bacteria 1737
260 Ga0501045_0063103 3300049824 Bacteria 2718
261 nmdc:mga03683_25258_c1 3300050489 Bacteria 2332
262 nmdc:mga03n38_18191_c1 3300050490 Bacteria 2769
263 nmdc:mga03n38_59209_c1 3300050490 Bacteria 1738
264 nmdc:mga0k408_20610_c1 3300050493 Bacteria 3696
265 nmdc:mga06z11_18985_c1 3300050494 Bacteria 3152
266 nmdc:mga04h51_19805_c1 3300050495 Bacteria 2000
267 nmdc:mga07m45_30448_c1 3300050496 Bacteria 2989
268 nmdc:mga05p37_397720_c1 3300050507 Bacteria 1609
269 nmdc:mga0sz30_34519_c1 3300050516 Bacteria 2106
270 Ga0500646_0001291 3300053090 Bacteria 6703
271 Ga0500593_043055 3300053117 Bacteria 2016
272 Ga0500559_0006126 3300053136 Bacteria 5444
273 Ga0500574_000275 3300053141 Bacteria 6300
274 Ga0500604_0009339 3300053151 Bacteria 2613
275 Ga0500619_000706 3300053154 Bacteria 5720
276 Ga0501084_0050553 3300054114 Bacteria 3479
277 Ga0501082_0237800 3300060353 Bacteria 1585

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0448143 Ga0496124_0448143_62_862 240
2 3300025936 Ga0207670_10258131 Ga0207670_102581311 274
3 3300021384 Ga0213876_10126150 Ga0213876_101261502 282
4 3300039437 Ga0436365_0467216 Ga0436365_0467216_453_1367 282
5 3300044684 Ga0466966_0015260 Ga0466966_0015260_693_1628 289
6 3300020069 Ga0197907_10318692 Ga0197907_103186922 290
7 3300022467 Ga0224712_10043929 Ga0224712_100439292 290
8 3300037418 Ga0395900_0082706 Ga0395900_0082706_1258_2235 291
9 3300037471 Ga0395905_0004557 Ga0395905_0004557_5597_6586 294
10 3300020080 Ga0206350_10725852 Ga0206350_107258522 295
11 3300022467 Ga0224712_10008235 Ga0224712_100082351 295
12 3300031251 Ga0265327_10010001 Ga0265327_100100013 295
13 3300046543 Ga0495645_0175243 Ga0495645_0175243_526_1449 295
14 3300044765 Ga0466970_0030420 Ga0466970_0030420_1711_2688 297
15 3300045049 Ga0466959_0015382 Ga0466959_0015382_3965_4942 297
16 3300048924 Ga0496121_0061917 Ga0496121_0061917_143_1078 297
17 3300006178 Ga0075367_10002232 Ga0075367_100022326 298
18 3300050494 nmdc:mga06z11_18985_c1 nmdc:mga06z11_18985_c1_1431_2396 298
19 3300005548 Ga0070665_100178812 Ga0070665_1001788122 299
20 3300038443 Ga0395901_0018952 Ga0395901_0018952_2239_3192 299
21 3300048913 Ga0496110_0050269 Ga0496110_0050269_123_1100 299
22 3300044683 Ga0466965_0030546 Ga0466965_0030546_1407_2384 300
23 3300006048 Ga0075363_100028789 Ga0075363_1000287892 301
24 3300050490 nmdc:mga03n38_18191_c1 nmdc:mga03n38_18191_c1_1536_2501 301
25 3300046680 Ga0495646_0174112 Ga0495646_0174112_10_945 303
26 3300005347 Ga0070668_100068402 Ga0070668_1000684023 304
27 3300013306 Ga0163162_10267017 Ga0163162_102670172 304
28 3300025907 Ga0207645_10104670 Ga0207645_101046702 304
29 3300025939 Ga0207665_10270613 Ga0207665_102706131 304
30 3300025940 Ga0207691_10318612 Ga0207691_103186122 304
31 3300046674 Ga0495588_0120004 Ga0495588_0120004_424_1374 304
32 3300003316 rootH1_10165852 rootH1_101658522 305
33 3300003771 Ga0055526_1000836 Ga0055526_10008365 305
34 3300005467 Ga0070706_100305496 Ga0070706_1003054962 305
35 3300005471 Ga0070698_100221878 Ga0070698_1002218782 305
36 3300005937 Ga0081455_10002734 Ga0081455_1000273423 305
37 3300025295 Ga0209564_1000632 Ga0209564_100063231 305
38 3300025910 Ga0207684_10078784 Ga0207684_100787842 305
39 3300046525 Ga0495663_0003090 Ga0495663_0003090_1173_2150 305
40 3300046528 Ga0495642_0026635 Ga0495642_0026635_227_1204 305
41 3300047318 Ga0495636_0001425 Ga0495636_0001425_4056_5033 305
42 3300047447 Ga0495685_005567 Ga0495685_005567_778_1755 305
43 3300002704 JGI25155J39150_1000196 JGI25155J39150_10001967 306
44 3300002705 JGI25156J39149_1006728 JGI25156J39149_10067282 306
45 3300002738 JGI25154J39366_1000261 JGI25154J39366_100026110 306
46 3300009093 Ga0105240_10013542 Ga0105240_100135425 306
47 3300025206 Ga0209435_100106 Ga0209435_1001069 306
48 3300025246 Ga0209646_1000186 Ga0209646_100018659 306
49 3300025250 Ga0209026_1001244 Ga0209026_10012445 306
50 3300025256 Ga0209759_1000765 Ga0209759_100076518 306
51 3300025913 Ga0207695_10024057 Ga0207695_100240577 306
52 3300045976 Ga0466967_0261149 Ga0466967_0261149_157_1134 306
53 3300048903 Ga0496100_0040052 Ga0496100_0040052_1547_2563 306
54 3300048904 Ga0496101_0148251 Ga0496101_0148251_70_1086 306
55 3300031548 Ga0307408_100095043 Ga0307408_1000950432 307
56 3300032002 Ga0307416_100129323 Ga0307416_1001293232 307
57 3300032005 Ga0307411_10042858 Ga0307411_100428582 307
58 3300041408 Ga0439453_0015672 Ga0439453_0015672_25_1002 307
59 3300042006 Ga0439432_014065 Ga0439432_014065_690_1667 307
60 3300042010 Ga0439452_007622 Ga0439452_007622_47_1024 307
61 3300042014 Ga0439457_008685 Ga0439457_008685_363_1340 307
62 3300042015 Ga0439462_0000359 Ga0439462_0000359_4670_5647 307
63 3300042134 Ga0450898_017631 Ga0450898_017631_231_1208 307
64 3300042184 Ga0450908_006825 Ga0450908_006825_755_1732 307
65 3300046511 Ga0495608_0055909 Ga0495608_0055909_10_933 307
66 iso_pu_bacteria 2884836552 2884841394 307
67 iso_pu_bacteria 2884852848 2884856268 307
68 iso_pu_bacteria 2896154374 2896156806 307
69 3300005336 Ga0070680_100133402 Ga0070680_1001334022 308
70 3300005549 Ga0070704_100016802 Ga0070704_1000168023 308
71 3300025940 Ga0207691_10090305 Ga0207691_100903052 308
72 3300046471 Ga0495650_0000097 Ga0495650_0000097_104272_105252 308
73 3300046507 Ga0495606_0000935 Ga0495606_0000935_32798_33778 308
74 3300005563 Ga0068855_100046501 Ga0068855_1000465012 309
75 3300015261 Ga0182006_1015341 Ga0182006_10153413 309
76 3300025233 Ga0209437_100611 Ga0209437_1006117 309
77 3300025949 Ga0207667_10006267 Ga0207667_1000626712 309
78 3300037471 Ga0395905_0247937 Ga0395905_0247937_148_1122 309
79 3300046660 Ga0495625_0001669 Ga0495625_0001669_17971_18990 309
80 3300048912 Ga0496109_0507600 Ga0496109_0507600_133_1110 310
81 3300048915 Ga0496112_0010091 Ga0496112_0010091_3408_4385 310
82 3300048916 Ga0496113_0102317 Ga0496113_0102317_295_1272 310
83 3300003320 rootH2_10065969 rootH2_100659692 311
84 3300005983 Ga0081540_1020950 Ga0081540_10209502 311
85 3300025284 Ga0209130_1001190 Ga0209130_10011902 311
86 3300025302 Ga0207426_1000085 Ga0207426_1000085191 311
87 3300042007 Ga0439449_0001019 Ga0439449_0001019_7443_8420 311
88 3300048928 Ga0496125_0003263 Ga0496125_0003263_11702_12679 311
89 3300005331 Ga0070670_100140809 Ga0070670_1001408092 312
90 3300009093 Ga0105240_10001823 Ga0105240_1000182327 312
91 3300017792 Ga0163161_10063934 Ga0163161_100639342 312
92 3300025228 Ga0209672_105536 Ga0209672_1055362 312
93 3300025735 Ga0207713_1079525 Ga0207713_10795251 312
94 3300025913 Ga0207695_10001901 Ga0207695_100019016 312
95 3300025924 Ga0207694_10218338 Ga0207694_102183382 312
96 3300048090 Ga0495615_0025638 Ga0495615_0025638_91_1065 312
97 3300048905 Ga0496102_0157022 Ga0496102_0157022_405_1379 312
98 3300048910 Ga0496107_0077032 Ga0496107_0077032_467_1441 312
99 3300048911 Ga0496108_0033552 Ga0496108_0033552_1732_2706 312
100 3300048914 Ga0496111_0038306 Ga0496111_0038306_1968_2942 312
101 3300048919 Ga0496116_0014455 Ga0496116_0014455_3895_4872 312
102 3300048925 Ga0496122_0000757 Ga0496122_0000757_7131_8108 312
103 3300048926 Ga0496123_0000523 Ga0496123_0000523_57666_58643 312
104 3300049592 Ga0501076_0440407 Ga0501076_0440407_55_999 312
105 3300006871 Ga0075434_100254222 Ga0075434_1002542221 313
106 3300009147 Ga0114129_10489111 Ga0114129_104891112 313
107 3300046507 Ga0495606_0164297 Ga0495606_0164297_190_1167 313
108 3300046529 Ga0495652_0016943 Ga0495652_0016943_1867_2844 313
109 3300046680 Ga0495646_0001273 Ga0495646_0001273_10211_11188 313
110 3300050507 nmdc:mga05p37_397720_c1 nmdc:mga05p37_397720_c1_247_1227 313
111 iso_pu_bacteria 2738543017 2739270084 313
112 iso_pu_bacteria 2857586860 2857587459 313
113 3300037471 Ga0395905_0024920 Ga0395905_0024920_2472_3524 314
114 3300005445 Ga0070708_100339955 Ga0070708_1003399552 315
115 3300005467 Ga0070706_100053257 Ga0070706_1000532572 315
116 3300005843 Ga0068860_100159688 Ga0068860_1001596882 315
117 3300005937 Ga0081455_10026485 Ga0081455_100264854 315
118 3300005981 Ga0081538_10011564 Ga0081538_100115649 315
119 3300005981 Ga0081538_10015400 Ga0081538_100154006 315
120 3300005981 Ga0081538_10059692 Ga0081538_100596922 315
121 3300005985 Ga0081539_10012353 Ga0081539_100123534 315
122 3300006844 Ga0075428_100227905 Ga0075428_1002279052 315
123 3300014968 Ga0157379_10025995 Ga0157379_100259952 315
124 3300025910 Ga0207684_10050667 Ga0207684_100506673 315
125 3300044694 Ga0466963_0074704 Ga0466963_0074704_1115_2074 315
126 3300049574 Ga0501038_0137857 Ga0501038_0137857_852_1811 315
127 3300049578 Ga0501042_0004566 Ga0501042_0004566_832_1791 315
128 3300049587 Ga0501071_0234812 Ga0501071_0234812_353_1312 315
129 3300049588 Ga0501072_0012224 Ga0501072_0012224_5348_6307 315
130 3300049591 Ga0501075_0037968 Ga0501075_0037968_2333_3292 315
131 3300049592 Ga0501076_0117113 Ga0501076_0117113_1019_1978 315
132 3300049742 Ga0501080_0184791 Ga0501080_0184791_107_1066 315
133 3300049743 Ga0501081_0139456 Ga0501081_0139456_193_1152 315
134 3300049824 Ga0501045_0063103 Ga0501045_0063103_1190_2149 315
135 3300054114 Ga0501084_0050553 Ga0501084_0050553_465_1424 315
136 3300060353 Ga0501082_0237800 Ga0501082_0237800_574_1533 315
137 iso_pu_bacteria 2842333319 2842337192 315
138 3300046557 Ga0495622_0000170 Ga0495622_0000170_2157_3137 316
139 3300048917 Ga0496114_0161042 Ga0496114_0161042_152_1129 316
140 3300048928 Ga0496125_0000313 Ga0496125_0000313_5692_6669 316
141 3300003187 JGI25151J46595_10000765 JGI25151J46595_100007658 317
142 3300003187 JGI25151J46595_10022864 JGI25151J46595_100228642 317
143 3300003187 JGI25151J46595_10022906 JGI25151J46595_100229062 317
144 3300003781 Ga0055536_1013238 Ga0055536_10132382 317
145 3300025292 Ga0209676_1000940 Ga0209676_100094026 317
146 3300025294 Ga0209025_1000041 Ga0209025_1000041373 317
147 3300025294 Ga0209025_1005204 Ga0209025_10052049 317
148 3300025294 Ga0209025_1008299 Ga0209025_10082992 317
149 3300046462 Ga0495651_0012936 Ga0495651_0012936_1863_2840 317
150 3300046511 Ga0495608_0064629 Ga0495608_0064629_1064_2041 317
151 3300046516 Ga0495628_0002638 Ga0495628_0002638_10146_11123 317
152 3300046529 Ga0495652_0004311 Ga0495652_0004311_12428_13405 317
153 3300046660 Ga0495625_0001268 Ga0495625_0001268_17316_18293 317
154 3300046679 Ga0495623_0005096 Ga0495623_0005096_5399_6376 317
155 3300048088 Ga0495602_0089567 Ga0495602_0089567_845_1822 317
156 3300003187 JGI25151J46595_10000318 JGI25151J46595_100003182 318
157 3300025294 Ga0209025_1000429 Ga0209025_100042976 318
158 3300025297 Ga0209758_1002010 Ga0209758_10020102 318
159 3300032004 Ga0307414_10222671 Ga0307414_102226712 319
160 3300032005 Ga0307411_10200758 Ga0307411_102007582 319
161 iso_pu_bacteria 2821443989 2821450968 319
162 iso_pu_bacteria 2844533157 2844535067 319
163 3300005530 Ga0070679_100040586 Ga0070679_1000405863 320
164 iso_pu_bacteria 2510917026 2511172747 320
165 iso_pu_bacteria 2585427633 2585998197 320
166 iso_pu_bacteria 2585427634 2586002774 320
167 iso_pu_bacteria 2854896431 2854899696 320
168 iso_pu_bacteria 2854916844 2854921079 320
169 iso_pu_bacteria 2899803654 2899806874 320
170 iso_pu_bacteria 2919171160 2919172715 320
171 3300032168 Ga0316593_10076930 Ga0316593_100769301 321
172 3300048914 Ga0496111_0224069 Ga0496111_0224069_132_1097 321
173 iso_pu_bacteria 2511231003 2511248831 321
174 iso_pu_bacteria 2513237150 2513954183 321
175 iso_pu_bacteria 2513237165 2514045943 321
176 iso_pu_bacteria 2599185214 2599625256 321
177 iso_pu_bacteria 2599185226 2599673292 321
178 iso_pu_bacteria 2599185227 2599682962 321
179 iso_pu_bacteria 2599185229 2599694900 321
180 iso_pu_bacteria 2818991436 2819543549 321
181 iso_pu_bacteria 2818991445 2819595416 321
182 iso_pu_bacteria 2831265667 2831270545 321
183 iso_pu_bacteria 2834641062 2834642986 321
184 iso_pu_bacteria 2838054893 2838056769 321
185 iso_pu_bacteria 2858688981 2858689009 321
186 iso_pu_bacteria 2885198086 2885198278 321
187 iso_pu_bacteria 2885211737 2885212342 321
188 iso_pu_bacteria 2901300506 2901313064 321
189 iso_pu_bacteria 2928070936 2928077752 321
190 iso_pu_bacteria 644736347 644749068 321
191 iso_pu_bacteria 8003400568 8003400940 321
192 3300005262 Ga0065165_1046504 Ga0065165_10465042 324
193 3300005344 Ga0070661_100066719 Ga0070661_1000667192 324
194 3300025258 Ga0209129_1000153 Ga0209129_100015339 324
195 3300025284 Ga0209130_1014672 Ga0209130_10146723 324
196 3300025297 Ga0209758_1000153 Ga0209758_100015395 324
197 3300025302 Ga0207426_1000390 Ga0207426_100039036 324
198 3300025920 Ga0207649_10162855 Ga0207649_101628551 324
199 3300037418 Ga0395900_0180588 Ga0395900_0180588_499_1473 324
200 3300037471 Ga0395905_0003185 Ga0395905_0003185_14888_15862 324
201 3300046522 Ga0495643_0005212 Ga0495643_0005212_5073_6047 324
202 3300046542 Ga0495597_0008157 Ga0495597_0008157_1295_2269 324
203 3300046665 Ga0495661_0001050 Ga0495661_0001050_10538_11512 324
204 3300047443 Ga0495687_004270 Ga0495687_004270_5575_6549 324
205 3300048924 Ga0496121_0261063 Ga0496121_0261063_123_1097 324
206 3300001979 JGI24740J21852_10007342 JGI24740J21852_100073424 325
207 3300002737 JGI25162J39368_1000063 JGI25162J39368_10000635 325
208 3300002771 JGI25163J39215_1001690 JGI25163J39215_10016902 325
209 3300002773 JGI25152J39213_1001886 JGI25152J39213_10018863 325
210 3300002987 JGI25159J45721_1003163 JGI25159J45721_10031634 325
211 3300003187 JGI25151J46595_10002247 JGI25151J46595_100022475 325
212 3300003214 JGI25165J46597_1000069 JGI25165J46597_10000695 325
213 3300003215 JGI25153J46596_10001510 JGI25153J46596_100015106 325
214 3300003354 JGI25160J50197_1003371 JGI25160J50197_10033714 325
215 3300003374 JGI25161J50226_1001139 JGI25161J50226_10011395 325
216 3300003751 Ga0055538_1000034 Ga0055538_10000344 325
217 3300003752 Ga0055539_1000044 Ga0055539_10000444 325
218 3300003756 Ga0055533_1000055 Ga0055533_10000554 325
219 3300003759 Ga0055525_1000066 Ga0055525_1000066178 325
220 3300003771 Ga0055526_1000221 Ga0055526_100022111 325
221 3300003773 Ga0055537_1001865 Ga0055537_10018655 325
222 3300003775 Ga0055524_1000955 Ga0055524_100095511 325
223 3300003781 Ga0055536_1000966 Ga0055536_10009665 325
224 3300003784 Ga0055534_1000555 Ga0055534_10005556 325
225 3300003790 Ga0055528_1001994 Ga0055528_10019945 325
226 3300003791 Ga0055530_10000257 Ga0055530_100002579 325
227 3300003791 Ga0055530_10000435 Ga0055530_100004352 325
228 3300003792 Ga0055540_1001044 Ga0055540_10010448 325
229 3300003792 Ga0055540_1004009 Ga0055540_10040095 325
230 3300003794 Ga0055531_10000288 Ga0055531_1000028812 325
231 3300003841 Ga0055541_1000032 Ga0055541_1000032179 325
232 3300004625 Ga0055543_1000531 Ga0055543_10005316 325
233 3300005262 Ga0065165_1007168 Ga0065165_10071684 325
234 3300006048 Ga0075363_100002668 Ga0075363_1000026682 325
235 3300006051 Ga0075364_10054324 Ga0075364_100543243 325
236 3300006178 Ga0075367_10045016 Ga0075367_100450163 325
237 3300006186 Ga0075369_10096400 Ga0075369_100964001 325
238 3300006195 Ga0075366_10004775 Ga0075366_100047753 325
239 3300006353 Ga0075370_10005869 Ga0075370_100058693 325
240 3300006353 Ga0075370_10071106 Ga0075370_100711062 325
241 3300009093 Ga0105240_10192201 Ga0105240_101922013 325
242 3300013104 Ga0157370_10230308 Ga0157370_102303082 325
243 3300015261 Ga0182006_1052713 Ga0182006_10527132 325
244 3300015262 Ga0182007_10005215 Ga0182007_100052153 325
245 3300015265 Ga0182005_1000680 Ga0182005_100068010 325
246 3300025207 Ga0209760_100910 Ga0209760_1009102 325
247 3300025208 Ga0209436_100642 Ga0209436_1006425 325
248 3300025224 Ga0209784_100049 Ga0209784_100049178 325
249 3300025225 Ga0209566_100061 Ga0209566_100061178 325
250 3300025226 Ga0209674_100069 Ga0209674_100069227 325
251 3300025230 Ga0209563_100083 Ga0209563_100083178 325
252 3300025231 Ga0207427_101746 Ga0207427_1017466 325
253 3300025233 Ga0209437_100091 Ga0209437_100091226 325
254 3300025245 Ga0207425_1000547 Ga0207425_100054710 325
255 3300025253 Ga0209677_100039 Ga0209677_100039227 325
256 3300025258 Ga0209129_1002754 Ga0209129_10027546 325
257 3300025261 Ga0209233_1000115 Ga0209233_1000115226 325
258 3300025263 Ga0209565_1000738 Ga0209565_100073812 325
259 3300025273 Ga0209673_1000610 Ga0209673_100061017 325
260 3300025284 Ga0209130_1000253 Ga0209130_100025332 325
261 3300025291 Ga0209675_1000757 Ga0209675_10007573 325
262 3300025292 Ga0209676_1000005 Ga0209676_1000005378 325
263 3300025292 Ga0209676_1007491 Ga0209676_10074912 325
264 3300025294 Ga0209025_1002800 Ga0209025_10028005 325
265 3300025295 Ga0209564_1000426 Ga0209564_100042635 325
266 3300025297 Ga0209758_1018870 Ga0209758_10188701 325
267 3300025298 Ga0209050_1000007 Ga0209050_1000007719 325
268 3300025298 Ga0209050_1000394 Ga0209050_100039439 325
269 3300025299 Ga0209256_1000038 Ga0209256_1000038244 325
270 3300025302 Ga0207426_1000090 Ga0207426_1000090195 325
271 3300025302 Ga0207426_1000526 Ga0207426_100052617 325
272 3300025303 Ga0209051_1000009 Ga0209051_1000009378 325
273 3300025303 Ga0209051_1001213 Ga0209051_10012135 325
274 3300025304 Ga0209257_1000011 Ga0209257_1000011352 325
275 3300027866 Ga0209813_10019253 Ga0209813_100192532 325
276 3300030521 Ga0307511_10000816 Ga0307511_1000081616 325
277 3300031911 Ga0307412_10008003 Ga0307412_100080033 325
278 3300036401 Ga0373937_0245663 Ga0373937_0245663_176_1153 325
279 3300041404 Ga0439436_0000850 Ga0439436_0000850_3243_4220 325
280 3300044658 Ga0466972_0000037 Ga0466972_0000037_68010_68987 325
281 3300044658 Ga0466972_0059448 Ga0466972_0059448_204_1181 325
282 3300044683 Ga0466965_0049678 Ga0466965_0049678_952_1929 325
283 3300044684 Ga0466966_0015022 Ga0466966_0015022_908_1885 325
284 3300045049 Ga0466959_0285069 Ga0466959_0285069_130_1107 325
285 3300046454 Ga0495592_0016678 Ga0495592_0016678_1160_2137 325
286 3300046463 Ga0495653_0008408 Ga0495653_0008408_2520_3497 325
287 3300046471 Ga0495650_0099503 Ga0495650_0099503_12_989 325
288 3300046514 Ga0495618_0006209 Ga0495618_0006209_5012_5989 325
289 3300046516 Ga0495628_0008325 Ga0495628_0008325_4159_5136 325
290 3300046678 Ga0495599_0009230 Ga0495599_0009230_4861_5838 325
291 3300046679 Ga0495623_0009176 Ga0495623_0009176_2700_3677 325
292 3300046690 Ga0495624_0067684 Ga0495624_0067684_992_1969 325
293 3300046809 Ga0495600_0002154 Ga0495600_0002154_4980_5957 325
294 3300047317 Ga0495604_0027616 Ga0495604_0027616_3341_4318 325
295 3300048088 Ga0495602_0117852 Ga0495602_0117852_565_1542 325
296 3300048920 Ga0496117_0079070 Ga0496117_0079070_747_1724 325
297 3300048921 Ga0496118_0025199 Ga0496118_0025199_3916_4893 325
298 3300048926 Ga0496123_0090444 Ga0496123_0090444_135_1112 325
299 3300048928 Ga0496125_0010403 Ga0496125_0010403_1167_2144 325
300 3300050489 nmdc:mga03683_25258_c1 nmdc:mga03683_25258_c1_142_1122 325
301 3300050490 nmdc:mga03n38_59209_c1 nmdc:mga03n38_59209_c1_525_1505 325
302 3300050493 nmdc:mga0k408_20610_c1 nmdc:mga0k408_20610_c1_2230_3210 325
303 3300050495 nmdc:mga04h51_19805_c1 nmdc:mga04h51_19805_c1_163_1143 325
304 3300050496 nmdc:mga07m45_30448_c1 nmdc:mga07m45_30448_c1_1468_2448 325
305 3300050516 nmdc:mga0sz30_34519_c1 nmdc:mga0sz30_34519_c1_983_1960 325
306 3300053090 Ga0500646_0001291 Ga0500646_0001291_4571_5551 325
307 3300053117 Ga0500593_043055 Ga0500593_043055_219_1196 325
308 3300053136 Ga0500559_0006126 Ga0500559_0006126_699_1676 325
309 3300053141 Ga0500574_000275 Ga0500574_000275_254_1231 325
310 3300053151 Ga0500604_0009339 Ga0500604_0009339_1350_2330 325
311 3300053154 Ga0500619_000706 Ga0500619_000706_2722_3699 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

139

355

0.96

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

36

136

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8318 89 313
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.8224 96 308
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.8172 89 304
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7931 89 313
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7928 87 313
ID Description Score Start End Superfamily
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9619 85 313 1.10.3720.10
af_Q2FVE8_90_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9601 85 310 1.10.3720.10
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9592 88 315 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.955 88 315 1.10.3720.10
af_I6YGV9_86_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9493 85 315 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0B8QAX9-F1-model_v4 deleted 0.9847 74 316
AF-A0A0D1GIU4-F1-model_v4 deleted 0.9781 1 320
AF-A0A0S4TUS1-F1-model_v4 Dipeptide transport protein 1 (ABC superfamily, membrane component) 0.977 90 323 GO:0005886
GO:0055085
AF-A0A1W2DYA2-F1-model_v4 Peptide/nickel transport system permease protein 0.9769 1 317 GO:0005886
GO:0055085
AF-A0A812UGB3-F1-model_v4 deleted 0.9762 20 316

Feature Viewer

pLDDT pTM Quality
87.58 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map