F401022
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 311 | 200 | 622 | 520 |
Family's Representative Sequence
| Representative Sequence | 3300003773|Ga0055537_1000760|Ga0055537_10007604 |
| Length | 510 |
| Sequence | MSTEPLRFDNRFIRDLPGDDETGPRVREVRGAAWSAVMPTPVAAPRLLAYSPELAEQLGLGQDLLDSPDFARVFGGNALYDGMQPWAANYGGHQFGHWAGQLGDGRAISLGELLAPEGARWELQLKGAGRTPYSRGADGRAVLRSSIREFLCSEAMHHLGVPTTRALSLVATGDSVVRDMFYDGHPEAEPGAVVCRVAPSFLRFGSFELPASRGDVTLLRQLVNLCIARDFPELATGGQQPYAAWFAQVCERTAVLVAHWMRVGFVHGVMNTDNLSILGLTIDYGPYGWVDDYDPDWTPNTTDAQGRRYRFGTQPQVAYWNLTRLAQALAPLFRFQAVHARCERDDIAAKLGLAECQDADLALMADWLTLLHDGEMDMTLAFRGLIDLDPQAPRLAVLEEAFYSEARRDAVLPALQQWLHRYAARLQADALDPVQRRERMAAANPLYVLRNWLAQEAIELAGEGDLSGVHTLQEVLRRPYEVQPGREHYAAKRPEWARNKAGCSMLSCSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 27 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 33 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 39 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 40 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 41 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 42 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 43 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 49 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 50 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 51 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 53 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 84 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 85 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 86 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 87 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 88 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 89 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 90 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 91 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 92 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 93 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 94 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 95 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 96 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 97 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 98 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 99 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 100 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 101 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 102 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 103 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 104 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 117 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 118 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 119 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 120 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 121 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 122 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 123 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 124 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 125 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 126 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 127 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 128 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 129 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 130 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 149 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 150 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 151 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 154 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 155 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 156 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 157 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 158 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 159 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 160 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 161 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 162 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 163 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 164 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 165 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 166 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 167 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 168 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 169 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 170 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 171 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 172 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 173 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 174 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 175 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 176 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 177 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 178 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 179 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 180 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 181 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 182 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 183 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 184 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 185 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 186 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 187 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 188 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 189 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 190 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 191 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 192 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 193 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 194 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 195 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 196 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 197 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 198 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 199 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 200 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.89 |
| Metatranscriptomes | 0 |
| Isolates | 15.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.32 |
| Bulb | 0 |
| Endosphere | 18.97 |
| Nodule | 0.32 |
| Rhizoplane | 1.61 |
| Rhizosphere | 50.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055537_1000760 | 3300003773 | Bacteria | 16494 |
| 2 | JGI25156J39149_1000214 | 3300002705 | Bacteria | 40310 |
| 3 | JGI25164J39214_1000310 | 3300002772 | Bacteria | 32075 |
| 4 | JGI25152J39213_1000931 | 3300002773 | Bacteria | 14347 |
| 5 | JGI25150J39212_1001048 | 3300002774 | Bacteria | 8442 |
| 6 | JGI25151J46595_10000178 | 3300003187 | Bacteria | 80734 |
| 7 | JGI25165J46597_1000580 | 3300003214 | Bacteria | 32075 |
| 8 | JGI25153J46596_10000131 | 3300003215 | Bacteria | 80734 |
| 9 | rootH2_10006484 | 3300003320 | Bacteria | 5108 |
| 10 | Ga0055535_1000457 | 3300003761 | Bacteria | 37713 |
| 11 | Ga0055542_1000496 | 3300003762 | Bacteria | 36150 |
| 12 | Ga0055524_1000174 | 3300003775 | Bacteria | 73269 |
| 13 | Ga0055536_1004959 | 3300003781 | Bacteria | 6628 |
| 14 | Ga0055534_1000084 | 3300003784 | Bacteria | 73269 |
| 15 | Ga0055534_1000364 | 3300003784 | Bacteria | 28397 |
| 16 | Ga0055528_1000016 | 3300003790 | Bacteria | 158479 |
| 17 | Ga0055528_1000453 | 3300003790 | Bacteria | 32772 |
| 18 | Ga0055530_10002975 | 3300003791 | Bacteria | 10192 |
| 19 | Ga0055530_10004909 | 3300003791 | Bacteria | 6632 |
| 20 | Ga0055531_10006497 | 3300003794 | Bacteria | 6628 |
| 21 | Ga0055531_10008331 | 3300003794 | Bacteria | 5492 |
| 22 | Ga0055531_10010320 | 3300003794 | Bacteria | 4656 |
| 23 | Ga0055531_10024400 | 3300003794 | Bacteria | 2233 |
| 24 | Ga0058692_1000002 | 3300003856 | Bacteria | 508401 |
| 25 | Ga0058692_1000018 | 3300003856 | Bacteria | 264544 |
| 26 | Ga0065704_10070659 | 3300005289 | Bacteria | 18211 |
| 27 | Ga0065704_10077530 | 3300005289 | Bacteria | 4704 |
| 28 | Ga0070670_100007556 | 3300005331 | Bacteria | 9226 |
| 29 | Ga0070659_100007528 | 3300005366 | Bacteria | 7912 |
| 30 | Ga0070681_10005351 | 3300005458 | Bacteria | 12391 |
| 31 | Ga0070665_100045164 | 3300005548 | Bacteria | 4424 |
| 32 | Ga0068857_100015568 | 3300005577 | Bacteria | 6643 |
| 33 | Ga0068856_100000116 | 3300005614 | Bacteria | 79220 |
| 34 | Ga0075364_10000145 | 3300006051 | Bacteria | 31120 |
| 35 | Ga0105251_10000048 | 3300009011 | Bacteria | 110218 |
| 36 | Ga0105240_10003022 | 3300009093 | Bacteria | 26452 |
| 37 | Ga0105243_10010881 | 3300009148 | Bacteria | 6882 |
| 38 | Ga0105237_10000105 | 3300009545 | Bacteria | 118218 |
| 39 | Ga0105238_10053844 | 3300009551 | Bacteria | 4043 |
| 40 | Ga0105029_100212 | 3300009984 | Bacteria | 2982 |
| 41 | Ga0157373_10038157 | 3300013100 | Bacteria | 3443 |
| 42 | Ga0157373_10046232 | 3300013100 | Bacteria | 3106 |
| 43 | Ga0157373_10100722 | 3300013100 | Bacteria | 2033 |
| 44 | Ga0157371_10000337 | 3300013102 | Bacteria | 60433 |
| 45 | Ga0157371_10019239 | 3300013102 | Bacteria | 5038 |
| 46 | Ga0157371_10044930 | 3300013102 | Bacteria | 3145 |
| 47 | Ga0157370_10021892 | 3300013104 | Bacteria | 6366 |
| 48 | Ga0157370_10061408 | 3300013104 | Bacteria | 3567 |
| 49 | Ga0157369_10197253 | 3300013105 | Bacteria | 2113 |
| 50 | Ga0157372_10053481 | 3300013307 | Bacteria | 4501 |
| 51 | Ga0157372_10114021 | 3300013307 | Bacteria | 3098 |
| 52 | Ga0182008_10000115 | 3300014497 | Bacteria | 61294 |
| 53 | Ga0182006_1013417 | 3300015261 | Bacteria | 3556 |
| 54 | Ga0182007_10000103 | 3300015262 | Bacteria | 59975 |
| 55 | Ga0182005_1000251 | 3300015265 | Bacteria | 34134 |
| 56 | Ga0182005_1004923 | 3300015265 | Bacteria | 4233 |
| 57 | Ga0183369_1006 | 3300015685 | Bacteria | 449058 |
| 58 | Ga0163161_10029834 | 3300017792 | Bacteria | 3877 |
| 59 | Ga0163161_10031141 | 3300017792 | Bacteria | 3799 |
| 60 | Ga0163161_10048719 | 3300017792 | Bacteria | 3060 |
| 61 | Ga0209672_100045 | 3300025228 | Bacteria | 264926 |
| 62 | Ga0207427_100139 | 3300025231 | Bacteria | 84807 |
| 63 | Ga0209437_100462 | 3300025233 | Bacteria | 32102 |
| 64 | Ga0209258_100200 | 3300025242 | Bacteria | 123379 |
| 65 | Ga0207425_1000899 | 3300025245 | Bacteria | 14378 |
| 66 | Ga0209646_1000431 | 3300025246 | Bacteria | 23248 |
| 67 | Ga0209026_1000111 | 3300025250 | Bacteria | 140599 |
| 68 | Ga0209026_1000737 | 3300025250 | Bacteria | 18882 |
| 69 | Ga0209148_1000045 | 3300025254 | Bacteria | 448076 |
| 70 | Ga0209759_1000247 | 3300025256 | Bacteria | 80850 |
| 71 | Ga0209129_1000178 | 3300025258 | Bacteria | 92006 |
| 72 | Ga0209233_1000251 | 3300025261 | Bacteria | 84807 |
| 73 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 74 | Ga0209565_1000014 | 3300025263 | Bacteria | 530302 |
| 75 | Ga0209455_1000035 | 3300025272 | Bacteria | 479071 |
| 76 | Ga0209455_1000211 | 3300025272 | Bacteria | 82660 |
| 77 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 78 | Ga0209673_1000065 | 3300025273 | Bacteria | 252799 |
| 79 | Ga0209130_1004802 | 3300025284 | Bacteria | 4963 |
| 80 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 81 | Ga0209675_1000011 | 3300025291 | Bacteria | 520597 |
| 82 | Ga0209676_1000079 | 3300025292 | Bacteria | 290447 |
| 83 | Ga0209676_1000086 | 3300025292 | Bacteria | 264155 |
| 84 | Ga0209676_1000324 | 3300025292 | Bacteria | 92019 |
| 85 | Ga0209676_1001686 | 3300025292 | Bacteria | 19134 |
| 86 | Ga0209025_1000012 | 3300025294 | Bacteria | 924362 |
| 87 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 88 | Ga0209564_1000221 | 3300025295 | Bacteria | 129537 |
| 89 | Ga0209758_1000018 | 3300025297 | Bacteria | 753320 |
| 90 | Ga0209050_1000689 | 3300025298 | Bacteria | 50775 |
| 91 | Ga0209050_1006230 | 3300025298 | Bacteria | 7148 |
| 92 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 93 | Ga0209051_1006051 | 3300025303 | Bacteria | 6906 |
| 94 | Ga0209257_1000081 | 3300025304 | Bacteria | 306577 |
| 95 | Ga0209257_1000251 | 3300025304 | Bacteria | 123796 |
| 96 | Ga0209257_1006196 | 3300025304 | Bacteria | 7853 |
| 97 | Ga0209257_1008000 | 3300025304 | Bacteria | 6173 |
| 98 | Ga0207713_1000276 | 3300025735 | Bacteria | 61303 |
| 99 | Ga0207647_10013404 | 3300025904 | Bacteria | 5683 |
| 100 | Ga0207707_10004791 | 3300025912 | Bacteria | 11869 |
| 101 | Ga0207707_10015313 | 3300025912 | Bacteria | 6676 |
| 102 | Ga0207695_10001526 | 3300025913 | Bacteria | 38277 |
| 103 | Ga0207695_10001623 | 3300025913 | Bacteria | 36467 |
| 104 | Ga0207695_10010557 | 3300025913 | Bacteria | 11294 |
| 105 | Ga0207671_10004557 | 3300025914 | Bacteria | 13165 |
| 106 | Ga0207657_10068945 | 3300025919 | Bacteria | 3003 |
| 107 | Ga0207650_10043001 | 3300025925 | Bacteria | 3314 |
| 108 | Ga0207690_10005024 | 3300025932 | Bacteria | 7814 |
| 109 | Ga0207690_10070329 | 3300025932 | Bacteria | 2410 |
| 110 | Ga0207709_10002852 | 3300025935 | Bacteria | 10599 |
| 111 | Ga0207709_10010431 | 3300025935 | Bacteria | 5114 |
| 112 | Ga0207667_10014869 | 3300025949 | Bacteria | 8851 |
| 113 | Ga0207678_10006028 | 3300026067 | Bacteria | 10782 |
| 114 | Ga0207702_10000170 | 3300026078 | Bacteria | 77504 |
| 115 | Ga0207674_10054542 | 3300026116 | Bacteria | 4069 |
| 116 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 117 | Ga0209371_1000011 | 3300027312 | Bacteria | 848456 |
| 118 | Ga0209971_1000868 | 3300027682 | Bacteria | 7800 |
| 119 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 120 | Ga0268256_1000011 | 3300030500 | Bacteria | 848625 |
| 121 | Ga0307413_10005607 | 3300031824 | Bacteria | 5626 |
| 122 | Ga0307406_10001269 | 3300031901 | Bacteria | 14134 |
| 123 | Ga0307412_10035295 | 3300031911 | Bacteria | 3193 |
| 124 | Ga0307414_10006364 | 3300032004 | Bacteria | 6578 |
| 125 | Ga0307414_10012548 | 3300032004 | Bacteria | 5015 |
| 126 | Ga0395898_0025758 | 3300037466 | Bacteria | 5923 |
| 127 | Ga0395898_0086080 | 3300037466 | Bacteria | 3029 |
| 128 | Ga0395901_0000832 | 3300038443 | Bacteria | 34003 |
| 129 | Ga0395901_0006085 | 3300038443 | Bacteria | 12223 |
| 130 | Ga0237819_00775 | 3300038705 | Bacteria | 10226 |
| 131 | Ga0237819_02445 | 3300038705 | Bacteria | 3737 |
| 132 | Ga0439439_0005812 | 3300041406 | Bacteria | 2834 |
| 133 | Ga0439465_0005458 | 3300041413 | Bacteria | 4059 |
| 134 | Ga0451800_0623110 | 3300041459 | Bacteria | 3299 |
| 135 | Ga0451807_0289573 | 3300041486 | Bacteria | 2889 |
| 136 | Ga0439445_0000818 | 3300042004 | Bacteria | 6572 |
| 137 | Ga0439449_0005171 | 3300042007 | Bacteria | 5010 |
| 138 | Ga0450911_000201 | 3300042115 | Bacteria | 23369 |
| 139 | Ga0451577_0009269 | 3300042876 | Bacteria | 9486 |
| 140 | Ga0466989_0047582 | 3300044663 | Bacteria | 2616 |
| 141 | Ga0466966_0003802 | 3300044684 | Bacteria | 9957 |
| 142 | Ga0466961_0026381 | 3300044693 | Bacteria | 3735 |
| 143 | Ga0466971_0016463 | 3300044719 | Bacteria | 3264 |
| 144 | Ga0466959_0003832 | 3300045049 | Bacteria | 9976 |
| 145 | Ga0495627_002650 | 3300046453 | Bacteria | 8410 |
| 146 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 147 | Ga0495638_0002984 | 3300046460 | Bacteria | 13503 |
| 148 | Ga0495638_0042287 | 3300046460 | Bacteria | 2879 |
| 149 | Ga0495610_0004353 | 3300046512 | Bacteria | 10509 |
| 150 | Ga0495610_0054043 | 3300046512 | Bacteria | 1942 |
| 151 | Ga0495631_0012989 | 3300046518 | Bacteria | 4054 |
| 152 | Ga0495643_0005007 | 3300046522 | Bacteria | 9084 |
| 153 | Ga0495663_0000254 | 3300046525 | Bacteria | 20648 |
| 154 | Ga0495663_0000667 | 3300046525 | Bacteria | 11844 |
| 155 | Ga0495663_0002186 | 3300046525 | Bacteria | 5959 |
| 156 | Ga0495663_0009512 | 3300046525 | Bacteria | 2698 |
| 157 | Ga0495633_0002737 | 3300046558 | Bacteria | 12205 |
| 158 | Ga0495633_0008750 | 3300046558 | Bacteria | 5668 |
| 159 | Ga0495633_0021283 | 3300046558 | Bacteria | 3245 |
| 160 | Ga0495633_0026251 | 3300046558 | Bacteria | 2859 |
| 161 | Ga0495625_0036621 | 3300046660 | Bacteria | 3605 |
| 162 | Ga0495671_0008423 | 3300046692 | Bacteria | 5802 |
| 163 | Ga0495636_0000021 | 3300047318 | Bacteria | 72964 |
| 164 | Ga0495672_0000596 | 3300047320 | Bacteria | 40742 |
| 165 | Ga0495686_0051118 | 3300047472 | Bacteria | 2594 |
| 166 | Ga0496105_0021887 | 3300048908 | Bacteria | 5175 |
| 167 | Ga0496113_0101420 | 3300048916 | Bacteria | 2231 |
| 168 | Ga0496114_0001100 | 3300048917 | Bacteria | 20414 |
| 169 | Ga0496116_0000978 | 3300048919 | Bacteria | 35089 |
| 170 | Ga0496116_0011500 | 3300048919 | Bacteria | 7316 |
| 171 | Ga0496117_0000810 | 3300048920 | Bacteria | 48467 |
| 172 | Ga0496117_0001291 | 3300048920 | Bacteria | 36931 |
| 173 | Ga0496117_0001357 | 3300048920 | Bacteria | 35796 |
| 174 | Ga0496117_0003022 | 3300048920 | Bacteria | 20187 |
| 175 | Ga0496117_0017844 | 3300048920 | Bacteria | 5914 |
| 176 | Ga0496117_0093855 | 3300048920 | Bacteria | 1923 |
| 177 | Ga0496118_0000579 | 3300048921 | Bacteria | 60445 |
| 178 | Ga0496118_0003511 | 3300048921 | Bacteria | 19659 |
| 179 | Ga0496118_0005968 | 3300048921 | Bacteria | 13587 |
| 180 | Ga0496118_0010286 | 3300048921 | Bacteria | 9280 |
| 181 | Ga0496118_0011790 | 3300048921 | Bacteria | 8488 |
| 182 | Ga0496118_0071065 | 3300048921 | Bacteria | 2508 |
| 183 | Ga0496118_0097615 | 3300048921 | Bacteria | 1998 |
| 184 | Ga0496119_0001017 | 3300048922 | Bacteria | 35895 |
| 185 | Ga0496119_0001260 | 3300048922 | Bacteria | 31474 |
| 186 | Ga0496119_0003751 | 3300048922 | Bacteria | 15551 |
| 187 | Ga0496119_0066635 | 3300048922 | Bacteria | 2126 |
| 188 | Ga0496120_0000335 | 3300048923 | Bacteria | 78595 |
| 189 | Ga0496120_0000511 | 3300048923 | Bacteria | 60526 |
| 190 | Ga0496120_0000885 | 3300048923 | Bacteria | 42196 |
| 191 | Ga0496121_0003167 | 3300048924 | Bacteria | 23721 |
| 192 | Ga0496121_0009571 | 3300048924 | Bacteria | 11103 |
| 193 | Ga0496121_0044710 | 3300048924 | Bacteria | 3815 |
| 194 | Ga0496122_0001198 | 3300048925 | Bacteria | 44276 |
| 195 | Ga0496122_0004262 | 3300048925 | Bacteria | 17939 |
| 196 | Ga0496122_0043293 | 3300048925 | Bacteria | 3529 |
| 197 | Ga0496122_0050522 | 3300048925 | Bacteria | 3170 |
| 198 | Ga0496122_0050523 | 3300048925 | Bacteria | 3170 |
| 199 | Ga0496123_0000101 | 3300048926 | Bacteria | 169939 |
| 200 | Ga0496123_0002081 | 3300048926 | Bacteria | 25765 |
| 201 | Ga0496123_0003760 | 3300048926 | Bacteria | 16647 |
| 202 | Ga0496123_0006472 | 3300048926 | Bacteria | 11333 |
| 203 | Ga0496123_0061314 | 3300048926 | Bacteria | 2418 |
| 204 | Ga0496124_0000932 | 3300048927 | Bacteria | 47111 |
| 205 | Ga0496124_0001594 | 3300048927 | Bacteria | 32654 |
| 206 | Ga0496124_0003368 | 3300048927 | Bacteria | 19637 |
| 207 | Ga0496124_0005461 | 3300048927 | Bacteria | 14287 |
| 208 | Ga0496124_0007341 | 3300048927 | Bacteria | 11740 |
| 209 | Ga0496124_0008353 | 3300048927 | Bacteria | 10841 |
| 210 | Ga0496124_0070030 | 3300048927 | Bacteria | 2910 |
| 211 | Ga0496125_0001775 | 3300048928 | Bacteria | 29811 |
| 212 | Ga0496125_0002225 | 3300048928 | Bacteria | 25834 |
| 213 | Ga0496125_0004974 | 3300048928 | Bacteria | 15028 |
| 214 | Ga0496125_0013252 | 3300048928 | Bacteria | 8116 |
| 215 | Ga0496126_0001534 | 3300048929 | Bacteria | 35571 |
| 216 | Ga0496126_0006254 | 3300048929 | Bacteria | 13310 |
| 217 | Ga0496126_0007181 | 3300048929 | Bacteria | 12261 |
| 218 | Ga0496126_0037935 | 3300048929 | Bacteria | 4487 |
| 219 | Ga0496126_0045256 | 3300048929 | Bacteria | 4046 |
| 220 | Ga0496126_0079192 | 3300048929 | Bacteria | 2909 |
| 221 | Ga0501031_0068313 | 3300049568 | Bacteria | 2315 |
| 222 | Ga0501032_0091694 | 3300049569 | Bacteria | 2015 |
| 223 | Ga0501033_0006265 | 3300049570 | Bacteria | 9324 |
| 224 | Ga0501033_0025173 | 3300049570 | Bacteria | 4483 |
| 225 | Ga0501033_0084267 | 3300049570 | Bacteria | 2329 |
| 226 | Ga0501034_0000083 | 3300049571 | Bacteria | 169656 |
| 227 | Ga0501034_0000578 | 3300049571 | Bacteria | 57983 |
| 228 | Ga0501034_0040668 | 3300049571 | Bacteria | 4705 |
| 229 | Ga0501034_0050861 | 3300049571 | Bacteria | 4178 |
| 230 | Ga0501034_0116649 | 3300049571 | Bacteria | 2658 |
| 231 | Ga0501036_0037580 | 3300049572 | Bacteria | 4096 |
| 232 | Ga0501036_0080507 | 3300049572 | Bacteria | 2753 |
| 233 | Ga0501036_0099582 | 3300049572 | Bacteria | 2458 |
| 234 | Ga0501036_0117003 | 3300049572 | Bacteria | 2251 |
| 235 | Ga0501037_0006309 | 3300049573 | Bacteria | 8673 |
| 236 | Ga0501038_0022587 | 3300049574 | Bacteria | 5634 |
| 237 | Ga0501038_0034297 | 3300049574 | Bacteria | 4463 |
| 238 | Ga0501039_0052905 | 3300049575 | Bacteria | 3141 |
| 239 | Ga0501043_0014742 | 3300049579 | Bacteria | 6120 |
| 240 | Ga0501043_0051895 | 3300049579 | Bacteria | 3222 |
| 241 | Ga0501043_0099382 | 3300049579 | Bacteria | 2287 |
| 242 | Ga0501046_0134168 | 3300049580 | Bacteria | 1876 |
| 243 | Ga0501047_0005868 | 3300049581 | Bacteria | 11556 |
| 244 | Ga0501047_0041493 | 3300049581 | Bacteria | 4446 |
| 245 | Ga0501047_0160062 | 3300049581 | Bacteria | 2123 |
| 246 | Ga0501073_0001203 | 3300049589 | Bacteria | 18872 |
| 247 | Ga0501073_0049252 | 3300049589 | Bacteria | 2955 |
| 248 | Ga0501074_0029452 | 3300049590 | Bacteria | 3977 |
| 249 | Ga0501079_0112211 | 3300049741 | Bacteria | 2119 |
| 250 | Ga0501080_0010669 | 3300049742 | Bacteria | 8407 |
| 251 | Ga0501080_0093111 | 3300049742 | Bacteria | 2798 |
| 252 | Ga0501080_0116546 | 3300049742 | Bacteria | 2476 |
| 253 | Ga0501083_0016678 | 3300049744 | Bacteria | 5133 |
| 254 | Ga0501035_0006165 | 3300049822 | Bacteria | 11284 |
| 255 | Ga0501035_0071938 | 3300049822 | Bacteria | 3061 |
| 256 | Ga0501044_0009464 | 3300049823 | Bacteria | 10608 |
| 257 | Ga0501044_0066546 | 3300049823 | Bacteria | 3673 |
| 258 | nmdc:mga00v17_1971_c1 | 3300050491 | Bacteria | 10615 |
| 259 | nmdc:mga00v17_50924_c1 | 3300050491 | Bacteria | 2518 |
| 260 | Ga0500651_0002872 | 3300053093 | Bacteria | 9254 |
| 261 | Ga0500634_0000171 | 3300053161 | Bacteria | 21519 |
| 262 | Ga0501084_0052309 | 3300054114 | Bacteria | 3418 |
| 263 | Ga0501082_0139835 | 3300060353 | Bacteria | 2101 |
| 264 | Ga0466962_0010854 | 3300061719 | Bacteria | 4380 |
| 265 | 2572254058 | 2571042365 | Bacteria | 3289345 |
| 266 | 2578458666 | 2576861471 | Bacteria | 4648976 |
| 267 | 2643817501 | 2643221559 | Bacteria | 4424915 |
| 268 | 2643878697 | 2643221573 | Bacteria | 4784121 |
| 269 | 2643940155 | 2643221586 | Bacteria | 4446529 |
| 270 | 2643974230 | 2643221593 | Bacteria | 6296053 |
| 271 | 2644079283 | 2643221612 | Bacteria | 4361984 |
| 272 | 2644660013 | 2643221720 | Bacteria | 4694283 |
| 273 | 2644694727 | 2643221727 | Bacteria | 4415595 |
| 274 | 2644697316 | 2643221728 | Bacteria | 4797149 |
| 275 | 2747948221 | 2747842428 | Bacteria | 4689383 |
| 276 | 2748016001 | 2747842501 | Bacteria | 5293829 |
| 277 | 2765578714 | 2765235840 | Bacteria | 4663337 |
| 278 | 2816516788 | 2816332141 | Bacteria | 4436036 |
| 279 | 2819662902 | 2818991457 | Bacteria | 5323295 |
| 280 | 2842395024 | 2842391507 | Bacteria | 4486072 |
| 281 | 2842758372 | 2842757796 | Bacteria | 3981385 |
| 282 | 2852651041 | 2852649853 | Bacteria | 4036942 |
| 283 | 2852686107 | 2852684882 | Bacteria | 5463342 |
| 284 | 2857445995 | 2857442823 | Bacteria | 4562550 |
| 285 | 2874221342 | 2874220319 | Bacteria | 4594709 |
| 286 | 2895515691 | 2895511927 | Bacteria | 6802080 |
| 287 | 2895523522 | 2895522137 | Bacteria | 3284416 |
| 288 | 2895526313 | 2895525241 | Bacteria | 3388457 |
| 289 | 2919091847 | 2919089067 | Bacteria | 4560942 |
| 290 | 2919133646 | 2919130084 | Bacteria | 5301837 |
| 291 | 2919138020 | 2919134579 | Bacteria | 4480386 |
| 292 | 2919514900 | 2919513703 | Bacteria | 3844312 |
| 293 | 2919677314 | 2919675420 | Bacteria | 3969095 |
| 294 | 2923518576 | 2923516293 | Bacteria | 3716336 |
| 295 | 2928496311 | 2928496128 | Bacteria | 4631123 |
| 296 | 2929197299 | 2929195423 | Bacteria | 5325372 |
| 297 | 2931381004 | 2931380184 | Bacteria | 4455911 |
| 298 | 2937612163 | 2937610967 | Bacteria | 4618818 |
| 299 | 2939590801 | 2939589442 | Bacteria | 4214238 |
| 300 | 2939622989 | 2939622612 | Bacteria | 4698046 |
| 301 | 2939629748 | 2939626828 | Bacteria | 4695272 |
| 302 | 2941478082 | 2941475908 | Bacteria | 4145589 |
| 303 | 2941493772 | 2941489479 | Bacteria | 6313767 |
| 304 | 2961048108 | 2961047084 | Bacteria | 4594415 |
| 305 | 2961065125 | 2961064222 | Bacteria | 4749990 |
| 306 | 2974309170 | 2974307012 | Bacteria | 4172388 |
| 307 | 2977249888 | 2977247770 | Bacteria | 4160543 |
| 308 | 2984515622 | 2984514374 | Bacteria | 4172479 |
| 309 | 2995951108 | 2995948881 | Bacteria | 6358104 |
| 310 | 8021626420 | 8021622325 | Bacteria | 4844743 |
| 311 | 8021629430 | 8021626552 | Bacteria | 4665214 |
| 312 | Ga0055537_1000760 | |||
| 313 | JGI25156J39149_1000214 | |||
| 314 | JGI25164J39214_1000310 | |||
| 315 | JGI25152J39213_1000931 | |||
| 316 | JGI25150J39212_1001048 | |||
| 317 | JGI25151J46595_10000178 | |||
| 318 | JGI25165J46597_1000580 | |||
| 319 | JGI25153J46596_10000131 | |||
| 320 | rootH2_10006484 | |||
| 321 | Ga0055535_1000457 | |||
| 322 | Ga0055542_1000496 | |||
| 323 | Ga0055524_1000174 | |||
| 324 | Ga0055536_1004959 | |||
| 325 | Ga0055534_1000084 | |||
| 326 | Ga0055534_1000364 | |||
| 327 | Ga0055528_1000016 | |||
| 328 | Ga0055528_1000453 | |||
| 329 | Ga0055530_10002975 | |||
| 330 | Ga0055530_10004909 | |||
| 331 | Ga0055531_10006497 | |||
| 332 | Ga0055531_10008331 | |||
| 333 | Ga0055531_10010320 | |||
| 334 | Ga0055531_10024400 | |||
| 335 | Ga0058692_1000002 | |||
| 336 | Ga0058692_1000018 | |||
| 337 | Ga0065704_10070659 | |||
| 338 | Ga0065704_10077530 | |||
| 339 | Ga0070670_100007556 | |||
| 340 | Ga0070659_100007528 | |||
| 341 | Ga0070681_10005351 | |||
| 342 | Ga0070665_100045164 | |||
| 343 | Ga0068857_100015568 | |||
| 344 | Ga0068856_100000116 | |||
| 345 | Ga0075364_10000145 | |||
| 346 | Ga0105251_10000048 | |||
| 347 | Ga0105240_10003022 | |||
| 348 | Ga0105243_10010881 | |||
| 349 | Ga0105237_10000105 | |||
| 350 | Ga0105238_10053844 | |||
| 351 | Ga0105029_100212 | |||
| 352 | Ga0157373_10038157 | |||
| 353 | Ga0157373_10046232 | |||
| 354 | Ga0157373_10100722 | |||
| 355 | Ga0157371_10000337 | |||
| 356 | Ga0157371_10019239 | |||
| 357 | Ga0157371_10044930 | |||
| 358 | Ga0157370_10021892 | |||
| 359 | Ga0157370_10061408 | |||
| 360 | Ga0157369_10197253 | |||
| 361 | Ga0157372_10053481 | |||
| 362 | Ga0157372_10114021 | |||
| 363 | Ga0182008_10000115 | |||
| 364 | Ga0182006_1013417 | |||
| 365 | Ga0182007_10000103 | |||
| 366 | Ga0182005_1000251 | |||
| 367 | Ga0182005_1004923 | |||
| 368 | Ga0183369_1006 | |||
| 369 | Ga0163161_10029834 | |||
| 370 | Ga0163161_10031141 | |||
| 371 | Ga0163161_10048719 | |||
| 372 | Ga0209672_100045 | |||
| 373 | Ga0207427_100139 | |||
| 374 | Ga0209437_100462 | |||
| 375 | Ga0209258_100200 | |||
| 376 | Ga0207425_1000899 | |||
| 377 | Ga0209646_1000431 | |||
| 378 | Ga0209026_1000111 | |||
| 379 | Ga0209026_1000737 | |||
| 380 | Ga0209148_1000045 | |||
| 381 | Ga0209759_1000247 | |||
| 382 | Ga0209129_1000178 | |||
| 383 | Ga0209233_1000251 | |||
| 384 | Ga0209565_1000001 | |||
| 385 | Ga0209565_1000014 | |||
| 386 | Ga0209455_1000035 | |||
| 387 | Ga0209455_1000211 | |||
| 388 | Ga0209673_1000001 | |||
| 389 | Ga0209673_1000065 | |||
| 390 | Ga0209130_1004802 | |||
| 391 | Ga0209675_1000001 | |||
| 392 | Ga0209675_1000011 | |||
| 393 | Ga0209676_1000079 | |||
| 394 | Ga0209676_1000086 | |||
| 395 | Ga0209676_1000324 | |||
| 396 | Ga0209676_1001686 | |||
| 397 | Ga0209025_1000012 | |||
| 398 | Ga0209564_1000001 | |||
| 399 | Ga0209564_1000221 | |||
| 400 | Ga0209758_1000018 | |||
| 401 | Ga0209050_1000689 | |||
| 402 | Ga0209050_1006230 | |||
| 403 | Ga0209256_1000002 | |||
| 404 | Ga0209051_1006051 | |||
| 405 | Ga0209257_1000081 | |||
| 406 | Ga0209257_1000251 | |||
| 407 | Ga0209257_1006196 | |||
| 408 | Ga0209257_1008000 | |||
| 409 | Ga0207713_1000276 | |||
| 410 | Ga0207647_10013404 | |||
| 411 | Ga0207707_10004791 | |||
| 412 | Ga0207707_10015313 | |||
| 413 | Ga0207695_10001526 | |||
| 414 | Ga0207695_10001623 | |||
| 415 | Ga0207695_10010557 | |||
| 416 | Ga0207671_10004557 | |||
| 417 | Ga0207657_10068945 | |||
| 418 | Ga0207650_10043001 | |||
| 419 | Ga0207690_10005024 | |||
| 420 | Ga0207690_10070329 | |||
| 421 | Ga0207709_10002852 | |||
| 422 | Ga0207709_10010431 | |||
| 423 | Ga0207667_10014869 | |||
| 424 | Ga0207678_10006028 | |||
| 425 | Ga0207702_10000170 | |||
| 426 | Ga0207674_10054542 | |||
| 427 | Ga0209371_1000004 | |||
| 428 | Ga0209371_1000011 | |||
| 429 | Ga0209971_1000868 | |||
| 430 | Ga0268256_1000005 | |||
| 431 | Ga0268256_1000011 | |||
| 432 | Ga0307413_10005607 | |||
| 433 | Ga0307406_10001269 | |||
| 434 | Ga0307412_10035295 | |||
| 435 | Ga0307414_10006364 | |||
| 436 | Ga0307414_10012548 | |||
| 437 | Ga0395898_0025758 | |||
| 438 | Ga0395898_0086080 | |||
| 439 | Ga0395901_0000832 | |||
| 440 | Ga0395901_0006085 | |||
| 441 | Ga0237819_00775 | |||
| 442 | Ga0237819_02445 | |||
| 443 | Ga0439439_0005812 | |||
| 444 | Ga0439465_0005458 | |||
| 445 | Ga0451800_0623110 | |||
| 446 | Ga0451807_0289573 | |||
| 447 | Ga0439445_0000818 | |||
| 448 | Ga0439449_0005171 | |||
| 449 | Ga0450911_000201 | |||
| 450 | Ga0451577_0009269 | |||
| 451 | Ga0466989_0047582 | |||
| 452 | Ga0466966_0003802 | |||
| 453 | Ga0466961_0026381 | |||
| 454 | Ga0466971_0016463 | |||
| 455 | Ga0466959_0003832 | |||
| 456 | Ga0495627_002650 | |||
| 457 | Ga0495638_0000007 | |||
| 458 | Ga0495638_0002984 | |||
| 459 | Ga0495638_0042287 | |||
| 460 | Ga0495610_0004353 | |||
| 461 | Ga0495610_0054043 | |||
| 462 | Ga0495631_0012989 | |||
| 463 | Ga0495643_0005007 | |||
| 464 | Ga0495663_0000254 | |||
| 465 | Ga0495663_0000667 | |||
| 466 | Ga0495663_0002186 | |||
| 467 | Ga0495663_0009512 | |||
| 468 | Ga0495633_0002737 | |||
| 469 | Ga0495633_0008750 | |||
| 470 | Ga0495633_0021283 | |||
| 471 | Ga0495633_0026251 | |||
| 472 | Ga0495625_0036621 | |||
| 473 | Ga0495671_0008423 | |||
| 474 | Ga0495636_0000021 | |||
| 475 | Ga0495672_0000596 | |||
| 476 | Ga0495686_0051118 | |||
| 477 | Ga0496105_0021887 | |||
| 478 | Ga0496113_0101420 | |||
| 479 | Ga0496114_0001100 | |||
| 480 | Ga0496116_0000978 | |||
| 481 | Ga0496116_0011500 | |||
| 482 | Ga0496117_0000810 | |||
| 483 | Ga0496117_0001291 | |||
| 484 | Ga0496117_0001357 | |||
| 485 | Ga0496117_0003022 | |||
| 486 | Ga0496117_0017844 | |||
| 487 | Ga0496117_0093855 | |||
| 488 | Ga0496118_0000579 | |||
| 489 | Ga0496118_0003511 | |||
| 490 | Ga0496118_0005968 | |||
| 491 | Ga0496118_0010286 | |||
| 492 | Ga0496118_0011790 | |||
| 493 | Ga0496118_0071065 | |||
| 494 | Ga0496118_0097615 | |||
| 495 | Ga0496119_0001017 | |||
| 496 | Ga0496119_0001260 | |||
| 497 | Ga0496119_0003751 | |||
| 498 | Ga0496119_0066635 | |||
| 499 | Ga0496120_0000335 | |||
| 500 | Ga0496120_0000511 | |||
| 501 | Ga0496120_0000885 | |||
| 502 | Ga0496121_0003167 | |||
| 503 | Ga0496121_0009571 | |||
| 504 | Ga0496121_0044710 | |||
| 505 | Ga0496122_0001198 | |||
| 506 | Ga0496122_0004262 | |||
| 507 | Ga0496122_0043293 | |||
| 508 | Ga0496122_0050522 | |||
| 509 | Ga0496122_0050523 | |||
| 510 | Ga0496123_0000101 | |||
| 511 | Ga0496123_0002081 | |||
| 512 | Ga0496123_0003760 | |||
| 513 | Ga0496123_0006472 | |||
| 514 | Ga0496123_0061314 | |||
| 515 | Ga0496124_0000932 | |||
| 516 | Ga0496124_0001594 | |||
| 517 | Ga0496124_0003368 | |||
| 518 | Ga0496124_0005461 | |||
| 519 | Ga0496124_0007341 | |||
| 520 | Ga0496124_0008353 | |||
| 521 | Ga0496124_0070030 | |||
| 522 | Ga0496125_0001775 | |||
| 523 | Ga0496125_0002225 | |||
| 524 | Ga0496125_0004974 | |||
| 525 | Ga0496125_0013252 | |||
| 526 | Ga0496126_0001534 | |||
| 527 | Ga0496126_0006254 | |||
| 528 | Ga0496126_0007181 | |||
| 529 | Ga0496126_0037935 | |||
| 530 | Ga0496126_0045256 | |||
| 531 | Ga0496126_0079192 | |||
| 532 | Ga0501031_0068313 | |||
| 533 | Ga0501032_0091694 | |||
| 534 | Ga0501033_0006265 | |||
| 535 | Ga0501033_0025173 | |||
| 536 | Ga0501033_0084267 | |||
| 537 | Ga0501034_0000083 | |||
| 538 | Ga0501034_0000578 | |||
| 539 | Ga0501034_0040668 | |||
| 540 | Ga0501034_0050861 | |||
| 541 | Ga0501034_0116649 | |||
| 542 | Ga0501036_0037580 | |||
| 543 | Ga0501036_0080507 | |||
| 544 | Ga0501036_0099582 | |||
| 545 | Ga0501036_0117003 | |||
| 546 | Ga0501037_0006309 | |||
| 547 | Ga0501038_0022587 | |||
| 548 | Ga0501038_0034297 | |||
| 549 | Ga0501039_0052905 | |||
| 550 | Ga0501043_0014742 | |||
| 551 | Ga0501043_0051895 | |||
| 552 | Ga0501043_0099382 | |||
| 553 | Ga0501046_0134168 | |||
| 554 | Ga0501047_0005868 | |||
| 555 | Ga0501047_0041493 | |||
| 556 | Ga0501047_0160062 | |||
| 557 | Ga0501073_0001203 | |||
| 558 | Ga0501073_0049252 | |||
| 559 | Ga0501074_0029452 | |||
| 560 | Ga0501079_0112211 | |||
| 561 | Ga0501080_0010669 | |||
| 562 | Ga0501080_0093111 | |||
| 563 | Ga0501080_0116546 | |||
| 564 | Ga0501083_0016678 | |||
| 565 | Ga0501035_0006165 | |||
| 566 | Ga0501035_0071938 | |||
| 567 | Ga0501044_0009464 | |||
| 568 | Ga0501044_0066546 | |||
| 569 | nmdc:mga00v17_1971_c1 | |||
| 570 | nmdc:mga00v17_50924_c1 | |||
| 571 | Ga0500651_0002872 | |||
| 572 | Ga0500634_0000171 | |||
| 573 | Ga0501084_0052309 | |||
| 574 | Ga0501082_0139835 | |||
| 575 | Ga0466962_0010854 | |||
| 576 | 2572254058 | |||
| 577 | 2578458666 | |||
| 578 | 2643817501 | |||
| 579 | 2643878697 | |||
| 580 | 2643940155 | |||
| 581 | 2643974230 | |||
| 582 | 2644079283 | |||
| 583 | 2644660013 | |||
| 584 | 2644694727 | |||
| 585 | 2644697316 | |||
| 586 | 2747948221 | |||
| 587 | 2748016001 | |||
| 588 | 2765578714 | |||
| 589 | 2816516788 | |||
| 590 | 2819662902 | |||
| 591 | 2842395024 | |||
| 592 | 2842758372 | |||
| 593 | 2852651041 | |||
| 594 | 2852686107 | |||
| 595 | 2857445995 | |||
| 596 | 2874221342 | |||
| 597 | 2895515691 | |||
| 598 | 2895523522 | |||
| 599 | 2895526313 | |||
| 600 | 2919091847 | |||
| 601 | 2919133646 | |||
| 602 | 2919138020 | |||
| 603 | 2919514900 | |||
| 604 | 2919677314 | |||
| 605 | 2923518576 | |||
| 606 | 2928496311 | |||
| 607 | 2929197299 | |||
| 608 | 2931381004 | |||
| 609 | 2937612163 | |||
| 610 | 2939590801 | |||
| 611 | 2939622989 | |||
| 612 | 2939629748 | |||
| 613 | 2941478082 | |||
| 614 | 2941493772 | |||
| 615 | 2961048108 | |||
| 616 | 2961065125 | |||
| 617 | 2974309170 | |||
| 618 | 2977249888 | |||
| 619 | 2984515622 | |||
| 620 | 2995951108 | |||
| 621 | 8021626420 | |||
| 622 | 8021629430 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6iny-assembly1.cif.gz_A | crystal structure of an uncharacterized protein | 0.9255 | 5 | 506 |
| 6iny-assembly1.cif.gz_A | crystal structure of an uncharacterized protein | 0.9236 | 5 | 506 |
| 6k20-assembly1.cif.gz_A | structure of apo ydiu | 0.9227 | 5 | 506 |
| 6k20-assembly1.cif.gz_A | structure of apo ydiu | 0.9208 | 5 | 506 |
| 6lna-assembly2.cif.gz_B | ydiu complex with ampnpp and mn2+ | 0.9167 | 5 | 506 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A8WFT6_1_122_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.5342 | 107 | 198 | 3.30.200.20 |
| af_Q2FW70_430_654_1.10.510.40 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1; | 0.5217 | 239 | 376 | 1.10.510.40 |
| af_Q54B07_491_726_1.10.510.40 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1; | 0.4439 | 220 | 388 | 1.10.510.40 |
| af_A0A1D6FR55_119_251_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.4416 | 235 | 380 | 1.10.510.10 |
| af_A0A1D6FR55_119_251_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.4309 | 235 | 380 | 1.10.510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X5SC73-F1-model_v4 | Selenoprotein O | 0.9585 | 118 | 227 |
GO:0005524
GO:0046872 GO:0070733 |
| AF-A0A3S0DP80-F1-model_v4 | Selenoprotein O | 0.9488 | 3 | 283 |
GO:0005524
GO:0046872 GO:0070733 |
| AF-A0A351RBP6-F1-model_v4 | Selenoprotein O | 0.9455 | 391 | 521 |
GO:0005524
GO:0046872 GO:0070733 |
| AF-A0A3S0DP80-F1-model_v4 | Selenoprotein O | 0.9455 | 3 | 283 |
GO:0005524
GO:0046872 GO:0070733 |
| AF-A0A4Q6G632-F1-model_v4 | YdiU family protein | 0.9448 | 58 | 521 |
GO:0005524
GO:0046872 GO:0070733 |