F401084

General Info

Members Datasets Scaffolds Average Seq Length
311 168 622 213

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100223263|Ga0070714_1002232633
Length 247
Sequence VKGCEVVMFWTGTTLPLNVVAGAHSACKCNVALMALNLSVDELLTTTRSVRKRLDFDKPVSREVLMECLDLALQAPTGSNSQGWQWVFIEDADEKKAIGEIYLDNARGYLKSPAQEYADGDTRGERMPAVRDSATYLAEHIHEAPVLMIPCIEGREDKQPMGGAGYWASLHPAVWSFCLALRSRGLGTCWTTLHLIRGGEEKVADIVGIPYEKYSQGGLFPIAYTKGTDFKPAKRLPAEQLTHWNTW

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
86 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
87 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
88 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
91 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
92 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
93 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
161 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
162 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
163 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
166 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
167 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
168 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.04
Nodule 0
Rhizoplane 14.47
Rhizosphere 50.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100223263 3300005435 Bacteria 1732
2 rootH2_10089003 3300003320 Bacteria 2771
3 Ga0055540_1001481 3300003792 Bacteria 13973
4 Ga0055540_1002635 3300003792 Bacteria 9303
5 Ga0055540_1004493 3300003792 Bacteria 6260
6 Ga0070683_100098269 3300005329 Bacteria 2755
7 Ga0070682_100072852 3300005337 Bacteria 2202
8 Ga0068868_100234855 3300005338 Bacteria 1539
9 Ga0070669_100013274 3300005353 Bacteria 5855
10 Ga0070671_100452879 3300005355 Bacteria 1101
11 Ga0070671_100678628 3300005355 Bacteria 893
12 Ga0070674_100162238 3300005356 Bacteria 1697
13 Ga0070667_100000722 3300005367 Bacteria 31740
14 Ga0070667_100386501 3300005367 Bacteria 1272
15 Ga0070714_100455523 3300005435 Bacteria 1216
16 Ga0070714_100805088 3300005435 Bacteria 910
17 Ga0070713_100193545 3300005436 Bacteria 1834
18 Ga0070710_10326383 3300005437 Bacteria 1009
19 Ga0070708_100364683 3300005445 Bacteria 1361
20 Ga0070663_100108884 3300005455 Bacteria 2079
21 Ga0070663_100319067 3300005455 Bacteria 1249
22 Ga0070678_100851326 3300005456 Bacteria 831
23 Ga0070685_10010167 3300005466 Bacteria 4885
24 Ga0068853_100064787 3300005539 Bacteria 3170
25 Ga0070686_100140209 3300005544 Bacteria 1682
26 Ga0070693_100061368 3300005547 Bacteria 2185
27 Ga0068852_100469245 3300005616 Bacteria 1249
28 Ga0068859_100251673 3300005617 Bacteria 1857
29 Ga0068858_100230455 3300005842 Bacteria 1756
30 Ga0068860_100607725 3300005843 Bacteria 1099
31 Ga0081455_10347756 3300005937 Bacteria 1047
32 Ga0075365_10000705 3300006038 Bacteria 13444
33 Ga0075365_10210822 3300006038 Bacteria 1362
34 Ga0075365_10342326 3300006038 Bacteria 1054
35 Ga0075368_10015011 3300006042 Bacteria 2868
36 Ga0075363_100001263 3300006048 Bacteria 9407
37 Ga0075363_100003824 3300006048 Bacteria 6490
38 Ga0075363_100006656 3300006048 Bacteria 5268
39 Ga0075363_100016444 3300006048 Bacteria 3654
40 Ga0075363_100393589 3300006048 Bacteria 814
41 Ga0075364_10008785 3300006051 Bacteria 6046
42 Ga0075364_10048009 3300006051 Bacteria 2781
43 Ga0075364_10077092 3300006051 Bacteria 2200
44 Ga0075364_10393140 3300006051 Bacteria 946
45 Ga0070715_10249332 3300006163 Bacteria 927
46 Ga0075362_10006082 3300006177 Bacteria 4470
47 Ga0075362_10018252 3300006177 Bacteria 2900
48 Ga0075369_10001847 3300006186 Bacteria 7394
49 Ga0075369_10044745 3300006186 Bacteria 1902
50 Ga0075369_10094727 3300006186 Bacteria 1335
51 Ga0075369_10141566 3300006186 Bacteria 1097
52 Ga0075366_10187437 3300006195 Bacteria 1257
53 Ga0075370_10006823 3300006353 Bacteria 5772
54 Ga0075370_10026962 3300006353 Bacteria 3185
55 Ga0075370_10028984 3300006353 Bacteria 3080
56 Ga0075370_10091166 3300006353 Bacteria 1758
57 Ga0068865_100672742 3300006881 Bacteria 882
58 Ga0097620_100251680 3300006931 Bacteria 1857
59 Ga0105240_10837634 3300009093 Bacteria 994
60 Ga0111539_10080732 3300009094 Bacteria 3825
61 Ga0111539_10561421 3300009094 Bacteria 1329
62 Ga0105245_10886119 3300009098 Bacteria 934
63 Ga0105248_10043695 3300009177 Bacteria 5025
64 Ga0105248_11135472 3300009177 Bacteria 883
65 Ga0105237_10245229 3300009545 Bacteria 1793
66 Ga0105239_10840641 3300010375 Bacteria 1052
67 Ga0157369_10086659 3300013105 Bacteria 3344
68 Ga0163162_10119227 3300013306 Bacteria 2741
69 Ga0157375_10222070 3300013308 Bacteria 2048
70 Ga0163163_10189240 3300014325 Bacteria 2107
71 Ga0163163_10247511 3300014325 Bacteria 1833
72 Ga0157377_10069783 3300014745 Bacteria 2028
73 Ga0157379_10273565 3300014968 Bacteria 1536
74 Ga0163161_10503383 3300017792 Bacteria 987
75 Ga0213872_10069523 3300021361 Bacteria 1588
76 Ga0213874_10049398 3300021377 Bacteria 1286
77 Ga0213874_10191124 3300021377 Bacteria 732
78 Ga0213876_10002857 3300021384 Bacteria 10036
79 Ga0213876_10006130 3300021384 Bacteria 6571
80 Ga0213876_10019073 3300021384 Bacteria 3622
81 Ga0213875_10005317 3300021388 Bacteria 6925
82 Ga0213875_10012643 3300021388 Bacteria 4159
83 Ga0209673_1022649 3300025273 Bacteria 2161
84 Ga0209051_1001752 3300025303 Bacteria 17263
85 Ga0209051_1002102 3300025303 Bacteria 14961
86 Ga0209051_1002406 3300025303 Bacteria 13458
87 Ga0209051_1012294 3300025303 Bacteria 4150
88 Ga0207642_10078364 3300025899 Bacteria 1597
89 Ga0207695_10664131 3300025913 Bacteria 923
90 Ga0207671_10236827 3300025914 Bacteria 1433
91 Ga0207700_10087887 3300025928 Bacteria 2445
92 Ga0207664_10108065 3300025929 Bacteria 2309
93 Ga0207664_10463158 3300025929 Bacteria 1132
94 Ga0207664_10652443 3300025929 Bacteria 946
95 Ga0207664_11117723 3300025929 Bacteria 704
96 Ga0207644_10120252 3300025931 Bacteria 1999
97 Ga0207644_10620349 3300025931 Bacteria 899
98 Ga0207669_10047865 3300025937 Bacteria 2536
99 Ga0207665_10143705 3300025939 Bacteria 1704
100 Ga0207711_10069330 3300025941 Bacteria 3056
101 Ga0207640_10556045 3300025981 Bacteria 965
102 Ga0207658_10004559 3300025986 Bacteria 9611
103 Ga0207703_10651718 3300026035 Bacteria 999
104 Ga0207703_10765159 3300026035 Bacteria 921
105 Ga0207639_10044745 3300026041 Bacteria 3330
106 Ga0207678_10017171 3300026067 Bacteria 6353
107 Ga0207678_10379179 3300026067 Bacteria 1222
108 Ga0207675_100424964 3300026118 Bacteria 1313
109 Ga0207698_10799750 3300026142 Bacteria 945
110 Ga0268264_10429591 3300028381 Bacteria 1275
111 Ga0307405_10498364 3300031731 Bacteria 976
112 Ga0307413_10360921 3300031824 Bacteria 1125
113 Ga0307410_10249609 3300031852 Bacteria 1379
114 Ga0307412_10371347 3300031911 Bacteria 1155
115 Ga0307409_100294101 3300031995 Bacteria 1507
116 Ga0307409_100489484 3300031995 Bacteria 1195
117 Ga0307416_100052549 3300032002 Bacteria 3263
118 Ga0307416_100557948 3300032002 Bacteria 1220
119 Ga0307414_10170606 3300032004 Bacteria 1739
120 Ga0307415_100278018 3300032126 Bacteria 1375
121 Ga0436364_0178326 3300037853 Bacteria 9377
122 Ga0436364_0303129 3300037853 Bacteria 102080
123 Ga0436364_0529249 3300037853 Bacteria 39037
124 Ga0436364_1366244 3300037853 Bacteria 1288
125 Ga0436365_0133306 3300039437 Bacteria 59687
126 Ga0436365_0393632 3300039437 Bacteria 30038
127 Ga0436365_0500692 3300039437 Bacteria 1202
128 Ga0436365_0842203 3300039437 Bacteria 27860
129 Ga0436365_1111318 3300039437 Bacteria 2109
130 Ga0436365_1406222 3300039437 Bacteria 3063
131 Ga0436361_1162518 3300039447 Bacteria 1476
132 Ga0436363_0391372 3300039450 Bacteria 3640
133 Ga0436363_0691693 3300039450 Bacteria 2361
134 Ga0436363_1112948 3300039450 Bacteria 1440
135 Ga0436362_0963953 3300039453 Bacteria 992
136 Ga0439466_0008319 3300041411 Bacteria 3910
137 Ga0439465_0026879 3300041413 Bacteria 1821
138 Ga0451793_0140214 3300041452 Bacteria 3381
139 Ga0451843_0719068 3300041509 Bacteria 1190
140 Ga0451853_0432786 3300041512 Bacteria 1137
141 Ga0439431_0022522 3300041997 Bacteria 1519
142 Ga0439442_130724 3300042002 Bacteria 552
143 Ga0439445_0038468 3300042004 Bacteria 1265
144 Ga0466969_0009264 3300044656 Bacteria 5220
145 Ga0466969_0151791 3300044656 Bacteria 1067
146 Ga0466972_0028748 3300044658 Bacteria 2740
147 Ga0466965_0012053 3300044683 Bacteria 4060
148 Ga0466965_0042751 3300044683 Bacteria 2236
149 Ga0466966_0013686 3300044684 Bacteria 5368
150 Ga0466966_0061593 3300044684 Bacteria 2366
151 Ga0466966_0175981 3300044684 Bacteria 1299
152 Ga0466961_0002938 3300044693 Bacteria 10582
153 Ga0466963_0007103 3300044694 Bacteria 6671
154 Ga0466963_0046163 3300044694 Bacteria 2871
155 Ga0466963_0233252 3300044694 Bacteria 1290
156 Ga0466963_0438687 3300044694 Bacteria 921
157 Ga0453684_0214238 3300044712 Bacteria 2236
158 Ga0453684_0328250 3300044712 Bacteria 1731
159 Ga0466971_0215619 3300044719 Bacteria 909
160 Ga0466968_0014952 3300044735 Bacteria 3073
161 Ga0466970_0002489 3300044765 Bacteria 8895
162 Ga0466970_0029435 3300044765 Bacteria 2891
163 Ga0466957_0021395 3300044842 Bacteria 3810
164 Ga0466960_0001475 3300044901 Bacteria 8577
165 Ga0466960_0012164 3300044901 Bacteria 3623
166 Ga0466960_0108526 3300044901 Bacteria 1439
167 Ga0466959_0001602 3300045049 Bacteria 13955
168 Ga0466959_0007515 3300045049 Bacteria 7653
169 Ga0466958_0008215 3300045836 Bacteria 5781
170 Ga0466958_0044365 3300045836 Bacteria 2680
171 Ga0466958_0307382 3300045836 Bacteria 1018
172 Ga0466967_0001096 3300045976 Bacteria 14982
173 Ga0466967_0023199 3300045976 Bacteria 5081
174 Ga0495606_0040835 3300046507 Bacteria 3115
175 Ga0495606_0279307 3300046507 Bacteria 914
176 Ga0495628_0416903 3300046516 Bacteria 979
177 Ga0495686_0002701 3300047472 Bacteria 16248
178 Ga0495686_0023810 3300047472 Bacteria 4031
179 Ga0495686_0379326 3300047472 Bacteria 763
180 Ga0496100_0000225 3300048903 Bacteria 30548
181 Ga0496100_0001287 3300048903 Bacteria 12243
182 Ga0496100_0010237 3300048903 Bacteria 5303
183 Ga0496101_0000002 3300048904 Bacteria 410971
184 Ga0496101_0000118 3300048904 Bacteria 77684
185 Ga0496101_0000933 3300048904 Bacteria 17243
186 Ga0496102_0000003 3300048905 Bacteria 592263
187 Ga0496102_0022017 3300048905 Bacteria 5645
188 Ga0496102_0102925 3300048905 Bacteria 2655
189 Ga0496102_0109481 3300048905 Bacteria 2574
190 Ga0496102_0257664 3300048905 Bacteria 1645
191 Ga0496103_0000014 3300048906 Bacteria 290397
192 Ga0496103_0002879 3300048906 Bacteria 10677
193 Ga0496103_0132003 3300048906 Bacteria 1595
194 Ga0496103_0133805 3300048906 Bacteria 1584
195 Ga0496104_0026925 3300048907 Bacteria 5315
196 Ga0496104_0743854 3300048907 Bacteria 888
197 Ga0496105_0009653 3300048908 Bacteria 7555
198 Ga0496106_0006137 3300048909 Bacteria 8888
199 Ga0496106_0090879 3300048909 Bacteria 2356
200 Ga0496106_0137313 3300048909 Bacteria 1921
201 Ga0496107_0000106 3300048910 Bacteria 40710
202 Ga0496107_0001748 3300048910 Bacteria 13670
203 Ga0496107_0011142 3300048910 Bacteria 6256
204 Ga0496107_0309402 3300048910 Bacteria 1176
205 Ga0496108_0005477 3300048911 Bacteria 10264
206 Ga0496109_0000077 3300048912 Bacteria 103492
207 Ga0496109_0011451 3300048912 Bacteria 7626
208 Ga0496109_0585190 3300048912 Bacteria 1052
209 Ga0496110_0000645 3300048913 Bacteria 23879
210 Ga0496110_0075435 3300048913 Bacteria 2996
211 Ga0496110_0499034 3300048913 Bacteria 1108
212 Ga0496111_0000485 3300048914 Bacteria 20417
213 Ga0496111_0231279 3300048914 Bacteria 1373
214 Ga0496112_0008288 3300048915 Bacteria 9300
215 Ga0496112_0168499 3300048915 Bacteria 2156
216 Ga0496112_0194414 3300048915 Bacteria 1990
217 Ga0496113_0294586 3300048916 Bacteria 1299
218 Ga0496113_0656117 3300048916 Bacteria 839
219 Ga0496114_0000712 3300048917 Bacteria 24721
220 Ga0496114_0000880 3300048917 Bacteria 22492
221 Ga0496114_0736154 3300048917 Bacteria 863
222 Ga0496115_0006185 3300048918 Bacteria 8757
223 Ga0496115_0016508 3300048918 Bacteria 5624
224 Ga0496116_0000071 3300048919 Bacteria 244521
225 Ga0496116_0005986 3300048919 Bacteria 11154
226 Ga0496117_0000003 3300048920 Bacteria 1881097
227 Ga0496117_0007608 3300048920 Bacteria 10525
228 Ga0496117_0086444 3300048920 Bacteria 2037
229 Ga0496118_0000001 3300048921 Bacteria 1881100
230 Ga0496118_0000604 3300048921 Bacteria 59356
231 Ga0496118_0005885 3300048921 Bacteria 13737
232 Ga0496119_0002123 3300048922 Bacteria 22312
233 Ga0496119_0003282 3300048922 Bacteria 16914
234 Ga0496119_0017731 3300048922 Bacteria 5340
235 Ga0496119_0060564 3300048922 Bacteria 2265
236 Ga0496120_0000157 3300048923 Bacteria 112786
237 Ga0496120_0004585 3300048923 Bacteria 11506
238 Ga0496120_0043131 3300048923 Bacteria 2630
239 Ga0496121_0000002 3300048924 Bacteria 1494588
240 Ga0496121_0000019 3300048924 Bacteria 499976
241 Ga0496121_0008006 3300048924 Bacteria 12613
242 Ga0496121_0176379 3300048924 Bacteria 1547
243 Ga0496122_0000051 3300048925 Bacteria 265104
244 Ga0496123_0022676 3300048926 Bacteria 4830
245 Ga0496124_0000002 3300048927 Bacteria 1494588
246 Ga0496124_0218427 3300048927 Bacteria 1436
247 Ga0496124_0479528 3300048927 Bacteria 840
248 Ga0496125_0000002 3300048928 Bacteria 1480920
249 Ga0496126_0000011 3300048929 Bacteria 744275
250 Ga0496126_0000186 3300048929 Bacteria 140016
251 Ga0496126_0041051 3300048929 Bacteria 4286
252 Ga0496126_0265730 3300048929 Bacteria 1425
253 Ga0501032_0004162 3300049569 Bacteria 10961
254 Ga0501032_0107653 3300049569 Bacteria 1846
255 Ga0501033_0008684 3300049570 Bacteria 7860
256 Ga0501033_0118148 3300049570 Bacteria 1926
257 Ga0501034_0001377 3300049571 Bacteria 32679
258 Ga0501034_0160426 3300049571 Bacteria 2220
259 Ga0501034_0319895 3300049571 Bacteria 1485
260 Ga0501036_0089796 3300049572 Bacteria 2596
261 Ga0501037_0002295 3300049573 Bacteria 13802
262 Ga0501043_0023762 3300049579 Bacteria 4808
263 Ga0501043_0258775 3300049579 Bacteria 1339
264 Ga0501046_0003003 3300049580 Bacteria 15591
265 Ga0501046_0470870 3300049580 Bacteria 902
266 Ga0501047_0005540 3300049581 Bacteria 11880
267 Ga0501047_0031165 3300049581 Bacteria 5143
268 Ga0501047_0576470 3300049581 Bacteria 948
269 Ga0501048_0010853 3300049582 Bacteria 6791
270 Ga0501069_0014837 3300049585 Bacteria 4171
271 Ga0501069_0132457 3300049585 Bacteria 1428
272 Ga0501070_0001697 3300049586 Bacteria 19506
273 Ga0501070_0259638 3300049586 Bacteria 1420
274 Ga0501070_0317730 3300049586 Bacteria 1267
275 Ga0501073_0011218 3300049589 Bacteria 6554
276 Ga0501073_0091966 3300049589 Bacteria 2109
277 Ga0501080_0008174 3300049742 Bacteria 9478
278 Ga0501080_0119704 3300049742 Bacteria 2441
279 Ga0501080_0448152 3300049742 Bacteria 1157
280 Ga0501035_0001307 3300049822 Bacteria 25758
281 Ga0501035_0008131 3300049822 Bacteria 9777
282 Ga0501035_0378256 3300049822 Bacteria 1181
283 Ga0501044_0017914 3300049823 Bacteria 7595
284 Ga0501044_0019276 3300049823 Bacteria 7300
285 nmdc:mga03n38_161210_c1 3300050490 Bacteria 1136
286 nmdc:mga03n38_25276_c1 3300050490 Bacteria 2437
287 nmdc:mga03n38_4282_c1 3300050490 Bacteria 4702
288 nmdc:mga03n38_944_c1 3300050490 Bacteria 7862
289 nmdc:mga00v17_21127_c1 3300050491 Bacteria 3739
290 nmdc:mga00v17_44398_c1 3300050491 Bacteria 2680
291 nmdc:mga00v17_920_c1 3300050491 Bacteria 15828
292 nmdc:mga0yw44_14727_c1 3300050492 Bacteria 4163
293 nmdc:mga0yw44_206296_c1 3300050492 Bacteria 1299
294 nmdc:mga0yw44_852_c1 3300050492 Bacteria 11429
295 nmdc:mga0k408_169775_c1 3300050493 Bacteria 1300
296 nmdc:mga07m45_286677_c1 3300050496 Bacteria 958
297 nmdc:mga07m45_763_c1 3300050496 Bacteria 13819
298 nmdc:mga07m45_79869_c1 3300050496 Bacteria 1867
299 nmdc:mga07m45_89818_c1 3300050496 Bacteria 1759
300 nmdc:mga08y16_64344_c1 3300050511 Bacteria 3829
301 nmdc:mga0sz30_63200_c1 3300050516 Bacteria 1584
302 nmdc:mga0sz30_94811_c1 3300050516 Bacteria 1301
303 Ga0500646_0069566 3300053090 Bacteria 1053
304 Ga0500628_049549 3300053129 Bacteria 992
305 Ga0500642_0192174 3300053130 Bacteria 952
306 Ga0500652_001182 3300053131 Bacteria 8321
307 Ga0466962_0046837 3300061719 Bacteria 2066
308 2644489929 2643221687 Bacteria 6500351
309 2902793296 2902792274 Bacteria 7270173
310 2902841554 2902837492 Bacteria 6697721
311 2929213987 2929212328 Bacteria 7708288
312 Ga0070714_100223263
313 rootH2_10089003
314 Ga0055540_1001481
315 Ga0055540_1002635
316 Ga0055540_1004493
317 Ga0070683_100098269
318 Ga0070682_100072852
319 Ga0068868_100234855
320 Ga0070669_100013274
321 Ga0070671_100452879
322 Ga0070671_100678628
323 Ga0070674_100162238
324 Ga0070667_100000722
325 Ga0070667_100386501
326 Ga0070714_100455523
327 Ga0070714_100805088
328 Ga0070713_100193545
329 Ga0070710_10326383
330 Ga0070708_100364683
331 Ga0070663_100108884
332 Ga0070663_100319067
333 Ga0070678_100851326
334 Ga0070685_10010167
335 Ga0068853_100064787
336 Ga0070686_100140209
337 Ga0070693_100061368
338 Ga0068852_100469245
339 Ga0068859_100251673
340 Ga0068858_100230455
341 Ga0068860_100607725
342 Ga0081455_10347756
343 Ga0075365_10000705
344 Ga0075365_10210822
345 Ga0075365_10342326
346 Ga0075368_10015011
347 Ga0075363_100001263
348 Ga0075363_100003824
349 Ga0075363_100006656
350 Ga0075363_100016444
351 Ga0075363_100393589
352 Ga0075364_10008785
353 Ga0075364_10048009
354 Ga0075364_10077092
355 Ga0075364_10393140
356 Ga0070715_10249332
357 Ga0075362_10006082
358 Ga0075362_10018252
359 Ga0075369_10001847
360 Ga0075369_10044745
361 Ga0075369_10094727
362 Ga0075369_10141566
363 Ga0075366_10187437
364 Ga0075370_10006823
365 Ga0075370_10026962
366 Ga0075370_10028984
367 Ga0075370_10091166
368 Ga0068865_100672742
369 Ga0097620_100251680
370 Ga0105240_10837634
371 Ga0111539_10080732
372 Ga0111539_10561421
373 Ga0105245_10886119
374 Ga0105248_10043695
375 Ga0105248_11135472
376 Ga0105237_10245229
377 Ga0105239_10840641
378 Ga0157369_10086659
379 Ga0163162_10119227
380 Ga0157375_10222070
381 Ga0163163_10189240
382 Ga0163163_10247511
383 Ga0157377_10069783
384 Ga0157379_10273565
385 Ga0163161_10503383
386 Ga0213872_10069523
387 Ga0213874_10049398
388 Ga0213874_10191124
389 Ga0213876_10002857
390 Ga0213876_10006130
391 Ga0213876_10019073
392 Ga0213875_10005317
393 Ga0213875_10012643
394 Ga0209673_1022649
395 Ga0209051_1001752
396 Ga0209051_1002102
397 Ga0209051_1002406
398 Ga0209051_1012294
399 Ga0207642_10078364
400 Ga0207695_10664131
401 Ga0207671_10236827
402 Ga0207700_10087887
403 Ga0207664_10108065
404 Ga0207664_10463158
405 Ga0207664_10652443
406 Ga0207664_11117723
407 Ga0207644_10120252
408 Ga0207644_10620349
409 Ga0207669_10047865
410 Ga0207665_10143705
411 Ga0207711_10069330
412 Ga0207640_10556045
413 Ga0207658_10004559
414 Ga0207703_10651718
415 Ga0207703_10765159
416 Ga0207639_10044745
417 Ga0207678_10017171
418 Ga0207678_10379179
419 Ga0207675_100424964
420 Ga0207698_10799750
421 Ga0268264_10429591
422 Ga0307405_10498364
423 Ga0307413_10360921
424 Ga0307410_10249609
425 Ga0307412_10371347
426 Ga0307409_100294101
427 Ga0307409_100489484
428 Ga0307416_100052549
429 Ga0307416_100557948
430 Ga0307414_10170606
431 Ga0307415_100278018
432 Ga0436364_0178326
433 Ga0436364_0303129
434 Ga0436364_0529249
435 Ga0436364_1366244
436 Ga0436365_0133306
437 Ga0436365_0393632
438 Ga0436365_0500692
439 Ga0436365_0842203
440 Ga0436365_1111318
441 Ga0436365_1406222
442 Ga0436361_1162518
443 Ga0436363_0391372
444 Ga0436363_0691693
445 Ga0436363_1112948
446 Ga0436362_0963953
447 Ga0439466_0008319
448 Ga0439465_0026879
449 Ga0451793_0140214
450 Ga0451843_0719068
451 Ga0451853_0432786
452 Ga0439431_0022522
453 Ga0439442_130724
454 Ga0439445_0038468
455 Ga0466969_0009264
456 Ga0466969_0151791
457 Ga0466972_0028748
458 Ga0466965_0012053
459 Ga0466965_0042751
460 Ga0466966_0013686
461 Ga0466966_0061593
462 Ga0466966_0175981
463 Ga0466961_0002938
464 Ga0466963_0007103
465 Ga0466963_0046163
466 Ga0466963_0233252
467 Ga0466963_0438687
468 Ga0453684_0214238
469 Ga0453684_0328250
470 Ga0466971_0215619
471 Ga0466968_0014952
472 Ga0466970_0002489
473 Ga0466970_0029435
474 Ga0466957_0021395
475 Ga0466960_0001475
476 Ga0466960_0012164
477 Ga0466960_0108526
478 Ga0466959_0001602
479 Ga0466959_0007515
480 Ga0466958_0008215
481 Ga0466958_0044365
482 Ga0466958_0307382
483 Ga0466967_0001096
484 Ga0466967_0023199
485 Ga0495606_0040835
486 Ga0495606_0279307
487 Ga0495628_0416903
488 Ga0495686_0002701
489 Ga0495686_0023810
490 Ga0495686_0379326
491 Ga0496100_0000225
492 Ga0496100_0001287
493 Ga0496100_0010237
494 Ga0496101_0000002
495 Ga0496101_0000118
496 Ga0496101_0000933
497 Ga0496102_0000003
498 Ga0496102_0022017
499 Ga0496102_0102925
500 Ga0496102_0109481
501 Ga0496102_0257664
502 Ga0496103_0000014
503 Ga0496103_0002879
504 Ga0496103_0132003
505 Ga0496103_0133805
506 Ga0496104_0026925
507 Ga0496104_0743854
508 Ga0496105_0009653
509 Ga0496106_0006137
510 Ga0496106_0090879
511 Ga0496106_0137313
512 Ga0496107_0000106
513 Ga0496107_0001748
514 Ga0496107_0011142
515 Ga0496107_0309402
516 Ga0496108_0005477
517 Ga0496109_0000077
518 Ga0496109_0011451
519 Ga0496109_0585190
520 Ga0496110_0000645
521 Ga0496110_0075435
522 Ga0496110_0499034
523 Ga0496111_0000485
524 Ga0496111_0231279
525 Ga0496112_0008288
526 Ga0496112_0168499
527 Ga0496112_0194414
528 Ga0496113_0294586
529 Ga0496113_0656117
530 Ga0496114_0000712
531 Ga0496114_0000880
532 Ga0496114_0736154
533 Ga0496115_0006185
534 Ga0496115_0016508
535 Ga0496116_0000071
536 Ga0496116_0005986
537 Ga0496117_0000003
538 Ga0496117_0007608
539 Ga0496117_0086444
540 Ga0496118_0000001
541 Ga0496118_0000604
542 Ga0496118_0005885
543 Ga0496119_0002123
544 Ga0496119_0003282
545 Ga0496119_0017731
546 Ga0496119_0060564
547 Ga0496120_0000157
548 Ga0496120_0004585
549 Ga0496120_0043131
550 Ga0496121_0000002
551 Ga0496121_0000019
552 Ga0496121_0008006
553 Ga0496121_0176379
554 Ga0496122_0000051
555 Ga0496123_0022676
556 Ga0496124_0000002
557 Ga0496124_0218427
558 Ga0496124_0479528
559 Ga0496125_0000002
560 Ga0496126_0000011
561 Ga0496126_0000186
562 Ga0496126_0041051
563 Ga0496126_0265730
564 Ga0501032_0004162
565 Ga0501032_0107653
566 Ga0501033_0008684
567 Ga0501033_0118148
568 Ga0501034_0001377
569 Ga0501034_0160426
570 Ga0501034_0319895
571 Ga0501036_0089796
572 Ga0501037_0002295
573 Ga0501043_0023762
574 Ga0501043_0258775
575 Ga0501046_0003003
576 Ga0501046_0470870
577 Ga0501047_0005540
578 Ga0501047_0031165
579 Ga0501047_0576470
580 Ga0501048_0010853
581 Ga0501069_0014837
582 Ga0501069_0132457
583 Ga0501070_0001697
584 Ga0501070_0259638
585 Ga0501070_0317730
586 Ga0501073_0011218
587 Ga0501073_0091966
588 Ga0501080_0008174
589 Ga0501080_0119704
590 Ga0501080_0448152
591 Ga0501035_0001307
592 Ga0501035_0008131
593 Ga0501035_0378256
594 Ga0501044_0017914
595 Ga0501044_0019276
596 nmdc:mga03n38_161210_c1
597 nmdc:mga03n38_25276_c1
598 nmdc:mga03n38_4282_c1
599 nmdc:mga03n38_944_c1
600 nmdc:mga00v17_21127_c1
601 nmdc:mga00v17_44398_c1
602 nmdc:mga00v17_920_c1
603 nmdc:mga0yw44_14727_c1
604 nmdc:mga0yw44_206296_c1
605 nmdc:mga0yw44_852_c1
606 nmdc:mga0k408_169775_c1
607 nmdc:mga07m45_286677_c1
608 nmdc:mga07m45_763_c1
609 nmdc:mga07m45_79869_c1
610 nmdc:mga07m45_89818_c1
611 nmdc:mga08y16_64344_c1
612 nmdc:mga0sz30_63200_c1
613 nmdc:mga0sz30_94811_c1
614 Ga0500646_0069566
615 Ga0500628_049549
616 Ga0500642_0192174
617 Ga0500652_001182
618 Ga0466962_0046837
619 2644489929
620 2902793296
621 2902841554
622 2929213987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

44

224

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g14-assembly1.cif.gz_A crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8258 5 193
3m5k-assembly1.cif.gz_B crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (bdi_1728) from parabacteroides distasonis atcc 8503 at 1.86 a resolution 0.8037 7 214
3kwk-assembly1.cif.gz_A-2 crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (np_809094.1) from bacteroides thetaiotaomicron vpi-5482 at 1.54 a resolution 0.8015 7 214
6q1l-assembly1.cif.gz_B crystal structure of oxidized iodotyrosine deiodinase (iyd) bound to fmn and 3-iodo-l-tyrosine 0.7972 11 214
3to0-assembly1.cif.gz_A crystal structure of mus musculus iodotyrosine deiodinase (iyd) c217a, c239a bound to fmn 0.791 19 211
ID Description Score Start End Superfamily
af_O50397_6_212_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9634 6 212 3.40.109.10
af_O50397_6_212_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9588 6 212 3.40.109.10
3gb5A00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7855 9 211 3.40.109.10
3m5kB00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7706 7 214 3.40.109.10
3e10B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7655 10 214 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A655ATK2-F1-model_v4 Oxidoreductase (EC 1.-.-.-) 0.9704 97 214 GO:0016491
AF-A0A1T3WA41-F1-model_v4 Nitroreductase 0.9497 68 214 GO:0016491
AF-A0A3B8XC35-F1-model_v4 Nitroreductase 0.9436 27 214 GO:0016491
AF-A0A4P5RC31-F1-model_v4 Oxidoreductase 0.9427 4 214 GO:0016491
AF-A0A1A2NNC3-F1-model_v4 Nitroreductase 0.9427 1 177 GO:0016491

Map