F401155

General Info

Members Datasets Scaffolds Average Seq Length
311 230 304 181

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_100287204|Ga0068865_1002872042
Length 202
Sequence MDMTPGMAAVNTVVYGTLSQGGNMGDQLSAQDWLDQGLKTLAKAGFTALKAEPLAKAMGVSRGSFYWHFTDISAFHAAILKHWREIAAEQIIAGVEAAAGTENALAVLLRRVFGERLTLERAVRIWASVDPAARAAVQAIDRRRLGYVESLMMQSGLSTEVARARAQILYWAFLGFALSDQPLPKAQQKAVLDEMLRIAAAR

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
3 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
4 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
5 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
212 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
216 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
217 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
218 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
219 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
220 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
223 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
224 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
225 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
226 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
227 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
228 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
229 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
230 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.29
Nodule 1.29
Rhizoplane 9
Rhizosphere 74.28
Stem 0
Stem Tuber 0
Unclassified 5.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000241 3300003203 Bacteria 24433
2 Ga0070658_10711391 3300005327 Bacteria 872
3 Ga0070683_100238241 3300005329 Bacteria 1730
4 Ga0070683_100360672 3300005329 Bacteria 1384
5 Ga0070680_100192358 3300005336 Bacteria 1719
6 Ga0070682_100142227 3300005337 Bacteria 1637
7 Ga0070660_100084704 3300005339 Bacteria 2492
8 Ga0070674_100113207 3300005356 Bacteria 1996
9 Ga0070659_100120592 3300005366 Bacteria 2124
10 Ga0070667_100886878 3300005367 Bacteria 830
11 Ga0070714_100014889 3300005435 Bacteria 6252
12 Ga0070713_100011227 3300005436 Bacteria 6514
13 Ga0070713_100183236 3300005436 Bacteria 1883
14 Ga0070710_10240839 3300005437 Bacteria 1159
15 Ga0070681_10025289 3300005458 Bacteria 5972
16 Ga0070681_10653421 3300005458 Bacteria 966
17 Ga0070698_100207347 3300005471 Bacteria 1895
18 Ga0070679_100041560 3300005530 Bacteria 4576
19 Ga0070679_100446984 3300005530 Bacteria 1237
20 Ga0070684_100003873 3300005535 Bacteria 11324
21 Ga0070684_100661010 3300005535 Bacteria 973
22 Ga0068853_100400850 3300005539 Bacteria 1284
23 Ga0068853_100618054 3300005539 Bacteria 1030
24 Ga0068853_100760083 3300005539 Bacteria 926
25 Ga0070665_100171749 3300005548 Bacteria 2169
26 Ga0070665_100699544 3300005548 Bacteria 1027
27 Ga0068855_100012000 3300005563 Bacteria 10475
28 Ga0068855_100068036 3300005563 Bacteria 4147
29 Ga0068855_100173071 3300005563 Bacteria 2444
30 Ga0068855_100536719 3300005563 Bacteria 1268
31 Ga0068857_100352322 3300005577 Bacteria 1363
32 Ga0068854_100213553 3300005578 Bacteria 1523
33 Ga0068856_100034770 3300005614 Bacteria 4937
34 Ga0070702_100132317 3300005615 Bacteria 1577
35 Ga0068852_101113365 3300005616 Bacteria 810
36 Ga0068863_100591181 3300005841 Bacteria 1098
37 Ga0068858_100315460 3300005842 Bacteria 1493
38 Ga0081540_1125292 3300005983 Bacteria 1058
39 Ga0081539_10000064 3300005985 Bacteria 247020
40 Ga0070717_10000379 3300006028 Bacteria 28424
41 Ga0070717_10055197 3300006028 Bacteria 3277
42 Ga0070717_10241264 3300006028 Bacteria 1594
43 Ga0075365_10173366 3300006038 Bacteria 1506
44 Ga0075368_10363188 3300006042 Bacteria 632
45 Ga0075363_100174873 3300006048 Bacteria 1220
46 Ga0075363_100234742 3300006048 Bacteria 1053
47 Ga0075364_10113200 3300006051 Bacteria 1812
48 Ga0075364_10305862 3300006051 Bacteria 1082
49 Ga0070715_10451334 3300006163 Bacteria 726
50 Ga0070712_100306209 3300006175 Bacteria 1287
51 Ga0070712_100372455 3300006175 Bacteria 1174
52 Ga0075362_10081240 3300006177 Bacteria 1494
53 Ga0075367_10095224 3300006178 Bacteria 1816
54 Ga0075369_10316950 3300006186 Bacteria 729
55 Ga0068865_100287204 3300006881 Bacteria 1312
56 Ga0099794_10028463 3300007265 Bacteria 2599
57 Ga0099794_10154127 3300007265 Bacteria 1167
58 Ga0099795_10187680 3300007788 Bacteria 866
59 Ga0105240_10125559 3300009093 Bacteria 3084
60 Ga0105240_10203637 3300009093 Bacteria 2318
61 Ga0114129_10305906 3300009147 Bacteria 2117
62 Ga0105248_10055781 3300009177 Bacteria 4433
63 Ga0105237_10044076 3300009545 Bacteria 4492
64 Ga0105237_10077922 3300009545 Bacteria 3304
65 Ga0105237_10387507 3300009545 Bacteria 1402
66 Ga0105238_10044634 3300009551 Bacteria 4480
67 Ga0105238_10913782 3300009551 Bacteria 896
68 Ga0099796_10248760 3300010159 Bacteria 737
69 Ga0105239_10024102 3300010375 Bacteria 6702
70 Ga0105239_10033520 3300010375 Bacteria 5639
71 Ga0105246_10408964 3300011119 Bacteria 1129
72 Ga0105246_10424703 3300011119 Bacteria 1110
73 Ga0105246_10674866 3300011119 Bacteria 902
74 Ga0157370_10021676 3300013104 Bacteria 6401
75 Ga0157370_10296214 3300013104 Bacteria 1494
76 Ga0157370_10406477 3300013104 Bacteria 1253
77 Ga0157369_10003844 3300013105 Bacteria 17843
78 Ga0157369_10191388 3300013105 Bacteria 2150
79 Ga0157369_10761692 3300013105 Bacteria 996
80 Ga0157374_10016889 3300013296 Bacteria 6423
81 Ga0157372_10789194 3300013307 Bacteria 1104
82 Ga0157372_10884244 3300013307 Bacteria 1037
83 Ga0157375_10703638 3300013308 Bacteria 1164
84 Ga0157375_10707182 3300013308 Bacteria 1161
85 Ga0157379_10807011 3300014968 Bacteria 886
86 Ga0157376_10289179 3300014969 Bacteria 1547
87 Ga0163161_10346575 3300017792 Bacteria 1179
88 Ga0163161_10529816 3300017792 Bacteria 963
89 Ga0213876_10349176 3300021384 Bacteria 787
90 Ga0207692_10221167 3300025898 Bacteria 1122
91 Ga0207642_10218542 3300025899 Bacteria 1064
92 Ga0207684_10135442 3300025910 Bacteria 2115
93 Ga0207707_10017137 3300025912 Bacteria 6312
94 Ga0207707_10034744 3300025912 Bacteria 4410
95 Ga0207695_10025261 3300025913 Bacteria 6656
96 Ga0207671_10182080 3300025914 Bacteria 1635
97 Ga0207671_10281500 3300025914 Bacteria 1312
98 Ga0207671_10820691 3300025914 Bacteria 737
99 Ga0207652_10189913 3300025921 Bacteria 1848
100 Ga0207646_10025654 3300025922 Bacteria 5390
101 Ga0207694_10143530 3300025924 Bacteria 1921
102 Ga0207664_10286802 3300025929 Bacteria 1446
103 Ga0207686_10254055 3300025934 Bacteria 1286
104 Ga0207709_10392149 3300025935 Bacteria 1059
105 Ga0207669_10258410 3300025937 Bacteria 1301
106 Ga0207704_10148508 3300025938 Bacteria 1651
107 Ga0207691_10466149 3300025940 Bacteria 1074
108 Ga0207689_10327251 3300025942 Bacteria 1272
109 Ga0207661_10009246 3300025944 Bacteria 7060
110 Ga0207661_10166393 3300025944 Bacteria 1916
111 Ga0207661_10259415 3300025944 Bacteria 1548
112 Ga0207661_11245917 3300025944 Bacteria 684
113 Ga0207667_10009829 3300025949 Bacteria 11241
114 Ga0207667_10140474 3300025949 Bacteria 2487
115 Ga0207667_10258040 3300025949 Bacteria 1782
116 Ga0207667_10454306 3300025949 Bacteria 1301
117 Ga0207667_10513888 3300025949 Bacteria 1214
118 Ga0207658_10360275 3300025986 Bacteria 1269
119 Ga0207703_10499354 3300026035 Bacteria 1142
120 Ga0207639_10058606 3300026041 Bacteria 2963
121 Ga0207639_10141735 3300026041 Bacteria 2003
122 Ga0207639_10550564 3300026041 Bacteria 1059
123 Ga0207702_10281704 3300026078 Bacteria 1572
124 Ga0207641_10792429 3300026088 Bacteria 937
125 Ga0207674_10050875 3300026116 Bacteria 4230
126 Ga0207698_10179992 3300026142 Bacteria 1872
127 Ga0207698_10875817 3300026142 Bacteria 904
128 Ga0209179_1022922 3300027512 Bacteria 1229
129 Ga0209588_1002567 3300027671 Bacteria 4932
130 Ga0209588_1008910 3300027671 Bacteria 2986
131 Ga0209813_10293570 3300027866 Bacteria 629
132 Ga0265334_10038192 3300028573 Bacteria 1890
133 Ga0307517_10000942 3300028786 Bacteria 49547
134 Ga0265332_10022336 3300031238 Bacteria 2792
135 Ga0265328_10166685 3300031239 Bacteria 831
136 Ga0265340_10151160 3300031247 Bacteria 1058
137 Ga0265339_10023050 3300031249 Bacteria 3602
138 Ga0307513_10057565 3300031456 Bacteria 4139
139 Ga0307513_10074689 3300031456 Bacteria 3524
140 Ga0307508_10286682 3300031616 Bacteria 1240
141 Ga0265314_10220788 3300031711 Bacteria 1106
142 Ga0265342_10073722 3300031712 Bacteria 1985
143 Ga0307413_10093609 3300031824 Bacteria 1965
144 Ga0307410_10266214 3300031852 Bacteria 1339
145 Ga0307406_10694260 3300031901 Bacteria 849
146 Ga0307412_10727562 3300031911 Bacteria 854
147 Ga0307409_101093847 3300031995 Bacteria 818
148 Ga0307416_100220974 3300032002 Bacteria 1817
149 Ga0307411_11155221 3300032005 Bacteria 700
150 Ga0307415_100576469 3300032126 Bacteria 997
151 Ga0373929_0059339 3300035085 Bacteria 892
152 Ga0373934_0016035 3300035086 Bacteria 2846
153 Ga0373934_0202310 3300035086 Bacteria 818
154 Ga0373944_0131852 3300035089 Bacteria 869
155 Ga0373923_0000670 3300035111 Bacteria 8700
156 Ga0373953_0000650 3300035117 Bacteria 9650
157 Ga0373954_0001234 3300035118 Bacteria 10292
158 Ga0373956_0000627 3300035119 Bacteria 14473
159 Ga0373957_0004833 3300035120 Bacteria 4129
160 Ga0373960_0036594 3300035121 Bacteria 1399
161 Ga0373943_0024574 3300035170 Bacteria 2810
162 Ga0373943_0108280 3300035170 Bacteria 1462
163 Ga0373946_0404867 3300035171 Bacteria 689
164 Ga0373955_0005992 3300035172 Bacteria 5513
165 Ga0373924_0006901 3300035410 Bacteria 4085
166 Ga0373931_0001051 3300035691 Bacteria 11687
167 Ga0373935_0129540 3300035692 Bacteria 1694
168 Ga0373927_0024530 3300035695 Bacteria 3943
169 Ga0373927_0049150 3300035695 Bacteria 2728
170 Ga0373927_0063268 3300035695 Bacteria 2393
171 Ga0373933_0000487 3300035724 Bacteria 24768
172 Ga0373947_0022175 3300035725 Bacteria 3680
173 Ga0373947_0263293 3300035725 Bacteria 1143
174 Ga0373937_0013907 3300036401 Bacteria 7095
175 Ga0373925_0029293 3300037068 Bacteria 4039
176 Ga0373925_0050219 3300037068 Bacteria 3111
177 Ga0373925_0145744 3300037068 Bacteria 1856
178 Ga0373925_0758889 3300037068 Bacteria 800
179 Ga0395900_0017110 3300037418 Bacteria 7402
180 Ga0395898_0013931 3300037466 Bacteria 8263
181 Ga0395898_0159263 3300037466 Bacteria 2159
182 Ga0436364_1328077 3300037853 Bacteria 2488
183 Ga0395901_0045549 3300038443 Bacteria 4553
184 Ga0395901_0770841 3300038443 Bacteria 953
185 Ga0436365_0064588 3300039437 Bacteria 1605
186 Ga0436365_0074035 3300039437 Bacteria 2195
187 Ga0436365_1235034 3300039437 Bacteria 820
188 Ga0436360_0763726 3300039438 Bacteria 1141
189 Ga0436361_0653875 3300039447 Bacteria 718
190 Ga0436362_1077866 3300039453 Bacteria 1050
191 Ga0439465_0188987 3300041413 Bacteria 747
192 Ga0466963_0034728 3300044694 Bacteria 3282
193 Ga0466967_0482491 3300045976 Bacteria 1215
194 Ga0495592_0000610 3300046454 Bacteria 25275
195 Ga0495603_0005317 3300046455 Bacteria 7679
196 Ga0495603_0043428 3300046455 Bacteria 2684
197 Ga0495629_0000124 3300046459 Bacteria 68796
198 Ga0495629_0341735 3300046459 Bacteria 1022
199 Ga0495638_0206697 3300046460 Bacteria 1105
200 Ga0495651_0002831 3300046462 Bacteria 13439
201 Ga0495653_0000465 3300046463 Bacteria 31535
202 Ga0495580_0832782 3300046472 Bacteria 596
203 Ga0495662_0094479 3300046476 Bacteria 1460
204 Ga0495664_0091304 3300046477 Bacteria 1831
205 Ga0495664_0646669 3300046477 Bacteria 627
206 Ga0495594_0109858 3300046499 Bacteria 1555
207 Ga0495596_0070407 3300046500 Bacteria 1359
208 Ga0495606_0001721 3300046507 Bacteria 28133
209 Ga0495606_0241619 3300046507 Bacteria 1007
210 Ga0495608_0021426 3300046511 Bacteria 4435
211 Ga0495618_0045470 3300046514 Bacteria 2769
212 Ga0495628_0005485 3300046516 Bacteria 11108
213 Ga0495652_0070013 3300046529 Bacteria 2934
214 Ga0495640_0044960 3300046533 Bacteria 3066
215 Ga0495587_0004810 3300046536 Bacteria 8865
216 Ga0495598_0251881 3300046537 Bacteria 654
217 Ga0495645_0007013 3300046543 Bacteria 7837
218 Ga0495667_0000551 3300046559 Bacteria 23946
219 Ga0495667_0455794 3300046559 Bacteria 803
220 Ga0495656_0013251 3300046615 Bacteria 3063
221 Ga0495634_0019074 3300046642 Bacteria 4875
222 Ga0495635_0000786 3300046663 Bacteria 20681
223 Ga0495659_0389345 3300046664 Bacteria 600
224 Ga0495661_0264860 3300046665 Bacteria 872
225 Ga0495657_0039048 3300046675 Bacteria 3263
226 Ga0495599_0000556 3300046678 Bacteria 21265
227 Ga0495646_0002174 3300046680 Bacteria 11940
228 Ga0495613_0071685 3300046689 Bacteria 2525
229 Ga0495600_0036164 3300046809 Bacteria 3208
230 Ga0495581_0187038 3300047315 Bacteria 1211
231 Ga0495604_0004036 3300047317 Bacteria 11668
232 Ga0495674_0003198 3300047319 Bacteria 15908
233 Ga0495672_0029184 3300047320 Bacteria 3477
234 Ga0495680_0001556 3300047322 Bacteria 24553
235 Ga0495675_0036474 3300047444 Bacteria 3135
236 Ga0495684_0000169 3300047471 Bacteria 49164
237 Ga0495593_0002450 3300047673 Bacteria 11166
238 Ga0495602_0007192 3300048088 Bacteria 11665
239 Ga0496102_0499315 3300048905 Bacteria 1139
240 Ga0496102_0540954 3300048905 Bacteria 1087
241 Ga0496103_0727179 3300048906 Bacteria 628
242 Ga0496104_0130231 3300048907 Bacteria 2417
243 Ga0496104_0239528 3300048907 Bacteria 1726
244 Ga0496104_0887139 3300048907 Bacteria 797
245 Ga0496105_0007450 3300048908 Bacteria 8472
246 Ga0496106_0032680 3300048909 Bacteria 3880
247 Ga0496106_0532543 3300048909 Bacteria 943
248 Ga0496107_0187031 3300048910 Bacteria 1538
249 Ga0496108_0452219 3300048911 Bacteria 1122
250 Ga0496109_0126530 3300048912 Bacteria 2383
251 Ga0496109_0329980 3300048912 Bacteria 1440
252 Ga0496109_0426249 3300048912 Bacteria 1253
253 Ga0496110_0060804 3300048913 Bacteria 3333
254 Ga0496110_0648571 3300048913 Bacteria 955
255 Ga0496111_0067901 3300048914 Bacteria 2591
256 Ga0496111_0149689 3300048914 Bacteria 1731
257 Ga0496111_0446388 3300048914 Bacteria 954
258 Ga0496112_0029550 3300048915 Bacteria 5300
259 Ga0496112_0550312 3300048915 Bacteria 1088
260 Ga0496113_0067416 3300048916 Bacteria 2713
261 Ga0496114_0084218 3300048917 Bacteria 2692
262 Ga0496114_0103930 3300048917 Bacteria 2428
263 Ga0496115_0024110 3300048918 Bacteria 4726
264 Ga0496115_0186789 3300048918 Bacteria 1712
265 Ga0496115_0283096 3300048918 Bacteria 1361
266 Ga0496115_0502624 3300048918 Bacteria 974
267 Ga0496121_0025457 3300048924 Bacteria 5612
268 Ga0496121_0569741 3300048924 Bacteria 705
269 Ga0496126_0014102 3300048929 Bacteria 8093
270 Ga0496126_0034492 3300048929 Bacteria 4752
271 Ga0501034_0003012 3300049571 Bacteria 19480
272 Ga0501046_0087490 3300049580 Bacteria 2401
273 Ga0501047_0039627 3300049581 Bacteria 4556
274 Ga0501048_0416385 3300049582 Bacteria 961
275 Ga0501070_0043183 3300049586 Bacteria 3752
276 Ga0501073_0218003 3300049589 Bacteria 1318
277 Ga0501074_0108521 3300049590 Bacteria 1986
278 Ga0501044_0036012 3300049823 Bacteria 5179
279 nmdc:mga03n38_379411_c1 3300050490 Bacteria 774
280 nmdc:mga00v17_84625_c1 3300050491 Bacteria 1985
281 nmdc:mga06z11_82054_c1 3300050494 Bacteria 1732
282 nmdc:mga04h51_328872_c1 3300050495 Bacteria 628
283 nmdc:mga08y16_330037_c1 3300050511 Bacteria 1569
284 Ga0495601_0034574 3300053077 Bacteria 3154
285 Ga0500610_0176538 3300053079 Bacteria 1050
286 Ga0500635_0010711 3300053080 Bacteria 2584
287 Ga0500635_0045019 3300053080 Bacteria 1491
288 Ga0495595_0002875 3300053084 Bacteria 6791
289 Ga0495619_0000556 3300053085 Bacteria 24680
290 Ga0500647_0147816 3300053091 Bacteria 1098
291 Ga0500566_0000150 3300053094 Bacteria 35703
292 Ga0500640_003756 3300053095 Bacteria 5384
293 Ga0500554_049634 3300053102 Bacteria 1317
294 Ga0500572_003755 3300053111 Bacteria 3446
295 Ga0500608_071708 3300053122 Bacteria 1647
296 Ga0500559_0087296 3300053136 Bacteria 1424
297 Ga0500603_000115 3300053150 Bacteria 18809
298 Ga0500630_050986 3300053159 Bacteria 2001
299 Ga0500639_163641 3300053163 Bacteria 1008
300 Ga0500637_0014994 3300053178 Bacteria 4096
301 Ga0500637_0213026 3300053178 Bacteria 1095
302 Ga0500596_000250 3300053735 Bacteria 9375
303 Ga0500601_004515 3300053737 Bacteria 1517
304 Ga0500661_043701 3300055283 Bacteria 795

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2513237098 2513675104 174
2 iso_pu_bacteria 2524023210 2524469492 174
3 iso_pu_bacteria 2885383462 2885390813 174
4 iso_pu_bacteria 2903768456 2903771833 174
5 iso_pu_bacteria 2922386360 2922392591 174
6 iso_pu_bacteria 8006984368 8006990947 174
7 3300031901 Ga0307406_10694260 Ga0307406_106942602 176
8 3300032002 Ga0307416_100220974 Ga0307416_1002209744 176
9 3300041413 Ga0439465_0188987 Ga0439465_0188987_171_701 176
10 3300005336 Ga0070680_100192358 Ga0070680_1001923583 177
11 3300005339 Ga0070660_100084704 Ga0070660_1000847043 177
12 3300005366 Ga0070659_100120592 Ga0070659_1001205921 177
13 3300005530 Ga0070679_100446984 Ga0070679_1004469842 177
14 3300005539 Ga0068853_100760083 Ga0068853_1007600831 177
15 3300005578 Ga0068854_100213553 Ga0068854_1002135532 177
16 3300005614 Ga0068856_100034770 Ga0068856_1000347703 177
17 3300009093 Ga0105240_10125559 Ga0105240_101255594 177
18 3300013307 Ga0157372_10789194 Ga0157372_107891942 177
19 3300025949 Ga0207667_10140474 Ga0207667_101404743 177
20 3300035089 Ga0373944_0131852 Ga0373944_0131852_252_785 177
21 3300035695 Ga0373927_0063268 Ga0373927_0063268_148_681 177
22 3300003203 JGI25406J46586_10000241 JGI25406J46586_100002414 178
23 3300005327 Ga0070658_10711391 Ga0070658_107113911 178
24 3300005329 Ga0070683_100238241 Ga0070683_1002382412 178
25 3300005329 Ga0070683_100360672 Ga0070683_1003606721 178
26 3300005337 Ga0070682_100142227 Ga0070682_1001422272 178
27 3300005356 Ga0070674_100113207 Ga0070674_1001132073 178
28 3300005367 Ga0070667_100886878 Ga0070667_1008868781 178
29 3300005435 Ga0070714_100014889 Ga0070714_1000148896 178
30 3300005436 Ga0070713_100011227 Ga0070713_1000112273 178
31 3300005436 Ga0070713_100183236 Ga0070713_1001832363 178
32 3300005437 Ga0070710_10240839 Ga0070710_102408392 178
33 3300005458 Ga0070681_10025289 Ga0070681_100252895 178
34 3300005458 Ga0070681_10653421 Ga0070681_106534211 178
35 3300005471 Ga0070698_100207347 Ga0070698_1002073473 178
36 3300005530 Ga0070679_100041560 Ga0070679_1000415602 178
37 3300005535 Ga0070684_100003873 Ga0070684_1000038737 178
38 3300005535 Ga0070684_100661010 Ga0070684_1006610101 178
39 3300005539 Ga0068853_100400850 Ga0068853_1004008502 178
40 3300005539 Ga0068853_100618054 Ga0068853_1006180542 178
41 3300005548 Ga0070665_100171749 Ga0070665_1001717492 178
42 3300005548 Ga0070665_100699544 Ga0070665_1006995442 178
43 3300005563 Ga0068855_100012000 Ga0068855_1000120005 178
44 3300005563 Ga0068855_100068036 Ga0068855_1000680363 178
45 3300005563 Ga0068855_100173071 Ga0068855_1001730712 178
46 3300005563 Ga0068855_100536719 Ga0068855_1005367192 178
47 3300005577 Ga0068857_100352322 Ga0068857_1003523223 178
48 3300005615 Ga0070702_100132317 Ga0070702_1001323172 178
49 3300005616 Ga0068852_101113365 Ga0068852_1011133651 178
50 3300005841 Ga0068863_100591181 Ga0068863_1005911812 178
51 3300005842 Ga0068858_100315460 Ga0068858_1003154602 178
52 3300005983 Ga0081540_1125292 Ga0081540_11252922 178
53 3300005985 Ga0081539_10000064 Ga0081539_1000006423 178
54 3300006028 Ga0070717_10000379 Ga0070717_100003795 178
55 3300006028 Ga0070717_10055197 Ga0070717_100551973 178
56 3300006028 Ga0070717_10241264 Ga0070717_102412642 178
57 3300006038 Ga0075365_10173366 Ga0075365_101733663 178
58 3300006042 Ga0075368_10363188 Ga0075368_103631881 178
59 3300006048 Ga0075363_100174873 Ga0075363_1001748732 178
60 3300006048 Ga0075363_100234742 Ga0075363_1002347422 178
61 3300006051 Ga0075364_10113200 Ga0075364_101132003 178
62 3300006051 Ga0075364_10305862 Ga0075364_103058621 178
63 3300006163 Ga0070715_10451334 Ga0070715_104513341 178
64 3300006175 Ga0070712_100306209 Ga0070712_1003062092 178
65 3300006175 Ga0070712_100372455 Ga0070712_1003724551 178
66 3300006177 Ga0075362_10081240 Ga0075362_100812402 178
67 3300006178 Ga0075367_10095224 Ga0075367_100952242 178
68 3300006186 Ga0075369_10316950 Ga0075369_103169501 178
69 3300006881 Ga0068865_100287204 Ga0068865_1002872042 178
70 3300007265 Ga0099794_10028463 Ga0099794_100284633 178
71 3300007265 Ga0099794_10154127 Ga0099794_101541272 178
72 3300007788 Ga0099795_10187680 Ga0099795_101876801 178
73 3300009093 Ga0105240_10203637 Ga0105240_102036373 178
74 3300009147 Ga0114129_10305906 Ga0114129_103059063 178
75 3300009177 Ga0105248_10055781 Ga0105248_100557813 178
76 3300009545 Ga0105237_10044076 Ga0105237_100440767 178
77 3300009545 Ga0105237_10077922 Ga0105237_100779224 178
78 3300009545 Ga0105237_10387507 Ga0105237_103875071 178
79 3300009551 Ga0105238_10044634 Ga0105238_100446344 178
80 3300009551 Ga0105238_10913782 Ga0105238_109137822 178
81 3300010159 Ga0099796_10248760 Ga0099796_102487601 178
82 3300010375 Ga0105239_10024102 Ga0105239_100241025 178
83 3300010375 Ga0105239_10033520 Ga0105239_100335207 178
84 3300011119 Ga0105246_10408964 Ga0105246_104089642 178
85 3300011119 Ga0105246_10424703 Ga0105246_104247032 178
86 3300011119 Ga0105246_10674866 Ga0105246_106748661 178
87 3300013104 Ga0157370_10021676 Ga0157370_100216763 178
88 3300013104 Ga0157370_10296214 Ga0157370_102962142 178
89 3300013104 Ga0157370_10406477 Ga0157370_104064773 178
90 3300013105 Ga0157369_10003844 Ga0157369_1000384411 178
91 3300013105 Ga0157369_10191388 Ga0157369_101913883 178
92 3300013105 Ga0157369_10761692 Ga0157369_107616922 178
93 3300013296 Ga0157374_10016889 Ga0157374_100168893 178
94 3300013307 Ga0157372_10884244 Ga0157372_108842442 178
95 3300013308 Ga0157375_10703638 Ga0157375_107036382 178
96 3300013308 Ga0157375_10707182 Ga0157375_107071822 178
97 3300014968 Ga0157379_10807011 Ga0157379_108070112 178
98 3300014969 Ga0157376_10289179 Ga0157376_102891793 178
99 3300017792 Ga0163161_10346575 Ga0163161_103465752 178
100 3300017792 Ga0163161_10529816 Ga0163161_105298162 178
101 3300021384 Ga0213876_10349176 Ga0213876_103491762 178
102 3300025898 Ga0207692_10221167 Ga0207692_102211672 178
103 3300025899 Ga0207642_10218542 Ga0207642_102185421 178
104 3300025910 Ga0207684_10135442 Ga0207684_101354423 178
105 3300025912 Ga0207707_10017137 Ga0207707_100171374 178
106 3300025912 Ga0207707_10034744 Ga0207707_100347443 178
107 3300025913 Ga0207695_10025261 Ga0207695_100252618 178
108 3300025914 Ga0207671_10182080 Ga0207671_101820803 178
109 3300025914 Ga0207671_10281500 Ga0207671_102815002 178
110 3300025914 Ga0207671_10820691 Ga0207671_108206911 178
111 3300025921 Ga0207652_10189913 Ga0207652_101899132 178
112 3300025922 Ga0207646_10025654 Ga0207646_100256546 178
113 3300025924 Ga0207694_10143530 Ga0207694_101435302 178
114 3300025929 Ga0207664_10286802 Ga0207664_102868022 178
115 3300025934 Ga0207686_10254055 Ga0207686_102540552 178
116 3300025935 Ga0207709_10392149 Ga0207709_103921492 178
117 3300025937 Ga0207669_10258410 Ga0207669_102584102 178
118 3300025938 Ga0207704_10148508 Ga0207704_101485083 178
119 3300025940 Ga0207691_10466149 Ga0207691_104661491 178
120 3300025942 Ga0207689_10327251 Ga0207689_103272513 178
121 3300025944 Ga0207661_10009246 Ga0207661_100092468 178
122 3300025944 Ga0207661_10166393 Ga0207661_101663933 178
123 3300025944 Ga0207661_10259415 Ga0207661_102594152 178
124 3300025944 Ga0207661_11245917 Ga0207661_112459171 178
125 3300025949 Ga0207667_10009829 Ga0207667_100098296 178
126 3300025949 Ga0207667_10258040 Ga0207667_102580403 178
127 3300025949 Ga0207667_10454306 Ga0207667_104543061 178
128 3300025949 Ga0207667_10513888 Ga0207667_105138881 178
129 3300025986 Ga0207658_10360275 Ga0207658_103602752 178
130 3300026035 Ga0207703_10499354 Ga0207703_104993541 178
131 3300026041 Ga0207639_10058606 Ga0207639_100586064 178
132 3300026041 Ga0207639_10141735 Ga0207639_101417352 178
133 3300026041 Ga0207639_10550564 Ga0207639_105505642 178
134 3300026078 Ga0207702_10281704 Ga0207702_102817043 178
135 3300026088 Ga0207641_10792429 Ga0207641_107924292 178
136 3300026116 Ga0207674_10050875 Ga0207674_100508752 178
137 3300026142 Ga0207698_10179992 Ga0207698_101799921 178
138 3300026142 Ga0207698_10875817 Ga0207698_108758172 178
139 3300027512 Ga0209179_1022922 Ga0209179_10229221 178
140 3300027671 Ga0209588_1002567 Ga0209588_10025676 178
141 3300027671 Ga0209588_1008910 Ga0209588_10089103 178
142 3300027866 Ga0209813_10293570 Ga0209813_102935701 178
143 3300028573 Ga0265334_10038192 Ga0265334_100381923 178
144 3300028786 Ga0307517_10000942 Ga0307517_1000094232 178
145 3300031238 Ga0265332_10022336 Ga0265332_100223363 178
146 3300031239 Ga0265328_10166685 Ga0265328_101666852 178
147 3300031247 Ga0265340_10151160 Ga0265340_101511602 178
148 3300031249 Ga0265339_10023050 Ga0265339_100230503 178
149 3300031456 Ga0307513_10057565 Ga0307513_100575654 178
150 3300031456 Ga0307513_10074689 Ga0307513_100746895 178
151 3300031616 Ga0307508_10286682 Ga0307508_102866822 178
152 3300031711 Ga0265314_10220788 Ga0265314_102207882 178
153 3300031712 Ga0265342_10073722 Ga0265342_100737223 178
154 3300031824 Ga0307413_10093609 Ga0307413_100936093 178
155 3300031852 Ga0307410_10266214 Ga0307410_102662142 178
156 3300031911 Ga0307412_10727562 Ga0307412_107275621 178
157 3300031995 Ga0307409_101093847 Ga0307409_1010938471 178
158 3300032005 Ga0307411_11155221 Ga0307411_111552211 178
159 3300032126 Ga0307415_100576469 Ga0307415_1005764692 178
160 3300035085 Ga0373929_0059339 Ga0373929_0059339_180_788 178
161 3300035086 Ga0373934_0016035 Ga0373934_0016035_1084_1620 178
162 3300035086 Ga0373934_0202310 Ga0373934_0202310_96_632 178
163 3300035111 Ga0373923_0000670 Ga0373923_0000670_5005_5541 178
164 3300035117 Ga0373953_0000650 Ga0373953_0000650_6298_6834 178
165 3300035118 Ga0373954_0001234 Ga0373954_0001234_9684_10220 178
166 3300035119 Ga0373956_0000627 Ga0373956_0000627_6530_7066 178
167 3300035120 Ga0373957_0004833 Ga0373957_0004833_3312_3848 178
168 3300035121 Ga0373960_0036594 Ga0373960_0036594_348_956 178
169 3300035170 Ga0373943_0024574 Ga0373943_0024574_184_747 178
170 3300035170 Ga0373943_0108280 Ga0373943_0108280_603_1139 178
171 3300035171 Ga0373946_0404867 Ga0373946_0404867_35_571 178
172 3300035172 Ga0373955_0005992 Ga0373955_0005992_4051_4587 178
173 3300035410 Ga0373924_0006901 Ga0373924_0006901_2919_3455 178
174 3300035691 Ga0373931_0001051 Ga0373931_0001051_5976_6584 178
175 3300035692 Ga0373935_0129540 Ga0373935_0129540_296_832 178
176 3300035695 Ga0373927_0024530 Ga0373927_0024530_1886_2422 178
177 3300035695 Ga0373927_0049150 Ga0373927_0049150_2110_2646 178
178 3300035724 Ga0373933_0000487 Ga0373933_0000487_21675_22211 178
179 3300035725 Ga0373947_0022175 Ga0373947_0022175_1933_2469 178
180 3300035725 Ga0373947_0263293 Ga0373947_0263293_561_1100 178
181 3300036401 Ga0373937_0013907 Ga0373937_0013907_6045_6581 178
182 3300037068 Ga0373925_0029293 Ga0373925_0029293_1483_2091 178
183 3300037068 Ga0373925_0050219 Ga0373925_0050219_579_1115 178
184 3300037068 Ga0373925_0145744 Ga0373925_0145744_58_621 178
185 3300037068 Ga0373925_0758889 Ga0373925_0758889_180_716 178
186 3300037418 Ga0395900_0017110 Ga0395900_0017110_5310_5858 178
187 3300037466 Ga0395898_0013931 Ga0395898_0013931_2159_2707 178
188 3300037466 Ga0395898_0159263 Ga0395898_0159263_925_1461 178
189 3300037853 Ga0436364_1328077 Ga0436364_1328077_353_895 178
190 3300038443 Ga0395901_0045549 Ga0395901_0045549_1153_1701 178
191 3300038443 Ga0395901_0770841 Ga0395901_0770841_363_914 178
192 3300039437 Ga0436365_0064588 Ga0436365_0064588_335_871 178
193 3300039437 Ga0436365_0074035 Ga0436365_0074035_1504_2040 178
194 3300039437 Ga0436365_1235034 Ga0436365_1235034_56_598 178
195 3300039438 Ga0436360_0763726 Ga0436360_0763726_346_882 178
196 3300039447 Ga0436361_0653875 Ga0436361_0653875_82_621 178
197 3300039453 Ga0436362_1077866 Ga0436362_1077866_374_910 178
198 3300044694 Ga0466963_0034728 Ga0466963_0034728_2240_2776 178
199 3300045976 Ga0466967_0482491 Ga0466967_0482491_216_752 178
200 3300046454 Ga0495592_0000610 Ga0495592_0000610_8373_8909 178
201 3300046455 Ga0495603_0005317 Ga0495603_0005317_1897_2433 178
202 3300046455 Ga0495603_0043428 Ga0495603_0043428_648_1184 178
203 3300046459 Ga0495629_0000124 Ga0495629_0000124_41741_42277 178
204 3300046459 Ga0495629_0341735 Ga0495629_0341735_243_800 178
205 3300046460 Ga0495638_0206697 Ga0495638_0206697_222_761 178
206 3300046462 Ga0495651_0002831 Ga0495651_0002831_11562_12098 178
207 3300046463 Ga0495653_0000465 Ga0495653_0000465_22952_23488 178
208 3300046472 Ga0495580_0832782 Ga0495580_0832782_10_546 178
209 3300046476 Ga0495662_0094479 Ga0495662_0094479_503_1060 178
210 3300046477 Ga0495664_0091304 Ga0495664_0091304_549_1088 178
211 3300046477 Ga0495664_0646669 Ga0495664_0646669_44_601 178
212 3300046499 Ga0495594_0109858 Ga0495594_0109858_634_1212 178
213 3300046500 Ga0495596_0070407 Ga0495596_0070407_529_1107 178
214 3300046507 Ga0495606_0001721 Ga0495606_0001721_21206_21742 178
215 3300046507 Ga0495606_0241619 Ga0495606_0241619_159_713 178
216 3300046511 Ga0495608_0021426 Ga0495608_0021426_2558_3094 178
217 3300046514 Ga0495618_0045470 Ga0495618_0045470_409_945 178
218 3300046516 Ga0495628_0005485 Ga0495628_0005485_92_628 178
219 3300046529 Ga0495652_0070013 Ga0495652_0070013_1342_1878 178
220 3300046533 Ga0495640_0044960 Ga0495640_0044960_2446_2982 178
221 3300046536 Ga0495587_0004810 Ga0495587_0004810_643_1179 178
222 3300046537 Ga0495598_0251881 Ga0495598_0251881_48_626 178
223 3300046543 Ga0495645_0007013 Ga0495645_0007013_2022_2558 178
224 3300046559 Ga0495667_0000551 Ga0495667_0000551_1110_1646 178
225 3300046559 Ga0495667_0455794 Ga0495667_0455794_233_790 178
226 3300046615 Ga0495656_0013251 Ga0495656_0013251_345_884 178
227 3300046642 Ga0495634_0019074 Ga0495634_0019074_3795_4331 178
228 3300046663 Ga0495635_0000786 Ga0495635_0000786_461_997 178
229 3300046664 Ga0495659_0389345 Ga0495659_0389345_49_585 178
230 3300046665 Ga0495661_0264860 Ga0495661_0264860_280_819 178
231 3300046675 Ga0495657_0039048 Ga0495657_0039048_982_1518 178
232 3300046678 Ga0495599_0000556 Ga0495599_0000556_3300_3836 178
233 3300046680 Ga0495646_0002174 Ga0495646_0002174_3082_3618 178
234 3300046689 Ga0495613_0071685 Ga0495613_0071685_260_796 178
235 3300046809 Ga0495600_0036164 Ga0495600_0036164_927_1463 178
236 3300047315 Ga0495581_0187038 Ga0495581_0187038_107_673 178
237 3300047317 Ga0495604_0004036 Ga0495604_0004036_282_818 178
238 3300047319 Ga0495674_0003198 Ga0495674_0003198_3265_3801 178
239 3300047320 Ga0495672_0029184 Ga0495672_0029184_325_864 178
240 3300047322 Ga0495680_0001556 Ga0495680_0001556_3296_3832 178
241 3300047444 Ga0495675_0036474 Ga0495675_0036474_982_1518 178
242 3300047471 Ga0495684_0000169 Ga0495684_0000169_46071_46607 178
243 3300047673 Ga0495593_0002450 Ga0495593_0002450_7424_7960 178
244 3300048088 Ga0495602_0007192 Ga0495602_0007192_643_1179 178
245 3300048905 Ga0496102_0499315 Ga0496102_0499315_21_575 178
246 3300048905 Ga0496102_0540954 Ga0496102_0540954_330_938 178
247 3300048906 Ga0496103_0727179 Ga0496103_0727179_50_589 178
248 3300048907 Ga0496104_0130231 Ga0496104_0130231_1600_2136 178
249 3300048907 Ga0496104_0239528 Ga0496104_0239528_464_1072 178
250 3300048907 Ga0496104_0887139 Ga0496104_0887139_206_745 178
251 3300048908 Ga0496105_0007450 Ga0496105_0007450_3393_4001 178
252 3300048909 Ga0496106_0032680 Ga0496106_0032680_1202_1810 178
253 3300048909 Ga0496106_0532543 Ga0496106_0532543_248_787 178
254 3300048910 Ga0496107_0187031 Ga0496107_0187031_327_935 178
255 3300048911 Ga0496108_0452219 Ga0496108_0452219_366_905 178
256 3300048912 Ga0496109_0126530 Ga0496109_0126530_1770_2309 178
257 3300048912 Ga0496109_0329980 Ga0496109_0329980_645_1181 178
258 3300048912 Ga0496109_0426249 Ga0496109_0426249_465_1073 178
259 3300048913 Ga0496110_0060804 Ga0496110_0060804_222_758 178
260 3300048913 Ga0496110_0648571 Ga0496110_0648571_197_805 178
261 3300048914 Ga0496111_0067901 Ga0496111_0067901_1556_2164 178
262 3300048914 Ga0496111_0149689 Ga0496111_0149689_270_806 178
263 3300048914 Ga0496111_0446388 Ga0496111_0446388_217_771 178
264 3300048915 Ga0496112_0029550 Ga0496112_0029550_4228_4836 178
265 3300048915 Ga0496112_0550312 Ga0496112_0550312_290_826 178
266 3300048916 Ga0496113_0067416 Ga0496113_0067416_1001_1609 178
267 3300048917 Ga0496114_0084218 Ga0496114_0084218_1864_2403 178
268 3300048917 Ga0496114_0103930 Ga0496114_0103930_381_989 178
269 3300048918 Ga0496115_0024110 Ga0496115_0024110_3818_4426 178
270 3300048918 Ga0496115_0186789 Ga0496115_0186789_726_1262 178
271 3300048918 Ga0496115_0283096 Ga0496115_0283096_560_1114 178
272 3300048918 Ga0496115_0502624 Ga0496115_0502624_296_832 178
273 3300048924 Ga0496121_0025457 Ga0496121_0025457_3260_3853 178
274 3300048924 Ga0496121_0569741 Ga0496121_0569741_129_665 178
275 3300048929 Ga0496126_0014102 Ga0496126_0014102_6738_7274 178
276 3300048929 Ga0496126_0034492 Ga0496126_0034492_402_950 178
277 3300049571 Ga0501034_0003012 Ga0501034_0003012_18279_18815 178
278 3300049580 Ga0501046_0087490 Ga0501046_0087490_1335_1883 178
279 3300049581 Ga0501047_0039627 Ga0501047_0039627_119_667 178
280 3300049582 Ga0501048_0416385 Ga0501048_0416385_112_660 178
281 3300049586 Ga0501070_0043183 Ga0501070_0043183_2913_3461 178
282 3300049589 Ga0501073_0218003 Ga0501073_0218003_274_822 178
283 3300049590 Ga0501074_0108521 Ga0501074_0108521_763_1311 178
284 3300049823 Ga0501044_0036012 Ga0501044_0036012_3865_4413 178
285 3300050490 nmdc:mga03n38_379411_c1 nmdc:mga03n38_379411_c1_61_597 178
286 3300050491 nmdc:mga00v17_84625_c1 nmdc:mga00v17_84625_c1_1035_1574 178
287 3300050494 nmdc:mga06z11_82054_c1 nmdc:mga06z11_82054_c1_884_1423 178
288 3300050495 nmdc:mga04h51_328872_c1 nmdc:mga04h51_328872_c1_22_561 178
289 3300050511 nmdc:mga08y16_330037_c1 nmdc:mga08y16_330037_c1_135_671 178
290 3300053077 Ga0495601_0034574 Ga0495601_0034574_2338_2904 178
291 3300053079 Ga0500610_0176538 Ga0500610_0176538_78_614 178
292 3300053080 Ga0500635_0010711 Ga0500635_0010711_1699_2235 178
293 3300053080 Ga0500635_0045019 Ga0500635_0045019_300_836 178
294 3300053084 Ga0495595_0002875 Ga0495595_0002875_5274_5810 178
295 3300053085 Ga0495619_0000556 Ga0495619_0000556_18100_18636 178
296 3300053091 Ga0500647_0147816 Ga0500647_0147816_79_630 178
297 3300053094 Ga0500566_0000150 Ga0500566_0000150_3070_3621 178
298 3300053095 Ga0500640_003756 Ga0500640_003756_2950_3501 178
299 3300053102 Ga0500554_049634 Ga0500554_049634_558_1094 178
300 3300053111 Ga0500572_003755 Ga0500572_003755_2633_3184 178
301 3300053122 Ga0500608_071708 Ga0500608_071708_138_689 178
302 3300053136 Ga0500559_0087296 Ga0500559_0087296_100_636 178
303 3300053150 Ga0500603_000115 Ga0500603_000115_12971_13507 178
304 3300053159 Ga0500630_050986 Ga0500630_050986_1068_1619 178
305 3300053163 Ga0500639_163641 Ga0500639_163641_80_616 178
306 3300053178 Ga0500637_0014994 Ga0500637_0014994_3228_3764 178
307 3300053178 Ga0500637_0213026 Ga0500637_0213026_90_626 178
308 3300053735 Ga0500596_000250 Ga0500596_000250_5778_6329 178
309 3300053737 Ga0500601_004515 Ga0500601_004515_358_909 178
310 3300055283 Ga0500661_043701 Ga0500661_043701_152_703 178
311 iso_pu_bacteria 8056681323 8056686559 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

34

79

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g7r-assembly1.cif.gz_A crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor 0.7954 10 178
3g7r-assembly1.cif.gz_B crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor 0.7921 10 178
2g3b-assembly1.cif.gz_B crystal structure of putative tetr-family transcriptional regulator from rhodococcus sp. 0.7759 10 178
6o6n-assembly1.cif.gz_A structure of the regulator fasr from mycobacterium tuberculosis in complex with c20-coa 0.7758 10 176
2np5-assembly1.cif.gz_A crystal structure of a transcriptional regulator (rha1_ro04179) from rhodococcus sp. rha1. 0.7692 6 177
ID Description Score Start End Superfamily
1zk8B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9516 5 48 1.10.10.60
2y30A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9469 6 59 1.10.10.60
3fiwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9465 6 48 1.10.10.60
2y2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9425 5 59 1.10.10.60
2y31B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9424 4 59 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2H9VKR7-F1-model_v4 deleted 0.9601 1 178
AF-A0A2H9VKR7-F1-model_v4 deleted 0.9549 1 178
AF-A0A0S6UNV9-F1-model_v4 HTH tetR-type domain-containing protein 0.9498 1 178 GO:0003677
AF-G3D5H5-F1-model_v4 Transcriptional regulatory protein 0.9451 3 177 GO:0000976
GO:0003700
AF-H0TRG6-F1-model_v4 Putative transcriptional regulator protein 0.9444 1 177 GO:0003677

Feature Viewer

pLDDT pTM Quality
86.83 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map