F401155
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 311 | 230 | 304 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300006881|Ga0068865_100287204|Ga0068865_1002872042 |
| Length | 202 |
| Sequence | MDMTPGMAAVNTVVYGTLSQGGNMGDQLSAQDWLDQGLKTLAKAGFTALKAEPLAKAMGVSRGSFYWHFTDISAFHAAILKHWREIAAEQIIAGVEAAAGTENALAVLLRRVFGERLTLERAVRIWASVDPAARAAVQAIDRRRLGYVESLMMQSGLSTEVARARAQILYWAFLGFALSDQPLPKAQQKAVLDEMLRIAAAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 3 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 4 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 5 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 33 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 36 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 37 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 38 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 46 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 64 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 93 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 94 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 96 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 97 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 99 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 100 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 102 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 103 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 104 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 105 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 107 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 108 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 109 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 110 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 111 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 112 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 113 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 115 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 116 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 117 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 118 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 119 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 120 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 121 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 122 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 123 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 126 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 127 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 136 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 137 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 138 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 139 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 140 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 141 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 182 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 183 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 184 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 190 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 191 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 192 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 193 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 194 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 195 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 196 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 197 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 206 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 207 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 208 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 209 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 212 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 213 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 216 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 217 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 218 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 219 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 220 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 221 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 222 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 223 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 224 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 225 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 226 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 227 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 228 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 229 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 230 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.75 |
| Metatranscriptomes | 0 |
| Isolates | 2.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.29 |
| Nodule | 1.29 |
| Rhizoplane | 9 |
| Rhizosphere | 74.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000241 | 3300003203 | Bacteria | 24433 |
| 2 | Ga0070658_10711391 | 3300005327 | Bacteria | 872 |
| 3 | Ga0070683_100238241 | 3300005329 | Bacteria | 1730 |
| 4 | Ga0070683_100360672 | 3300005329 | Bacteria | 1384 |
| 5 | Ga0070680_100192358 | 3300005336 | Bacteria | 1719 |
| 6 | Ga0070682_100142227 | 3300005337 | Bacteria | 1637 |
| 7 | Ga0070660_100084704 | 3300005339 | Bacteria | 2492 |
| 8 | Ga0070674_100113207 | 3300005356 | Bacteria | 1996 |
| 9 | Ga0070659_100120592 | 3300005366 | Bacteria | 2124 |
| 10 | Ga0070667_100886878 | 3300005367 | Bacteria | 830 |
| 11 | Ga0070714_100014889 | 3300005435 | Bacteria | 6252 |
| 12 | Ga0070713_100011227 | 3300005436 | Bacteria | 6514 |
| 13 | Ga0070713_100183236 | 3300005436 | Bacteria | 1883 |
| 14 | Ga0070710_10240839 | 3300005437 | Bacteria | 1159 |
| 15 | Ga0070681_10025289 | 3300005458 | Bacteria | 5972 |
| 16 | Ga0070681_10653421 | 3300005458 | Bacteria | 966 |
| 17 | Ga0070698_100207347 | 3300005471 | Bacteria | 1895 |
| 18 | Ga0070679_100041560 | 3300005530 | Bacteria | 4576 |
| 19 | Ga0070679_100446984 | 3300005530 | Bacteria | 1237 |
| 20 | Ga0070684_100003873 | 3300005535 | Bacteria | 11324 |
| 21 | Ga0070684_100661010 | 3300005535 | Bacteria | 973 |
| 22 | Ga0068853_100400850 | 3300005539 | Bacteria | 1284 |
| 23 | Ga0068853_100618054 | 3300005539 | Bacteria | 1030 |
| 24 | Ga0068853_100760083 | 3300005539 | Bacteria | 926 |
| 25 | Ga0070665_100171749 | 3300005548 | Bacteria | 2169 |
| 26 | Ga0070665_100699544 | 3300005548 | Bacteria | 1027 |
| 27 | Ga0068855_100012000 | 3300005563 | Bacteria | 10475 |
| 28 | Ga0068855_100068036 | 3300005563 | Bacteria | 4147 |
| 29 | Ga0068855_100173071 | 3300005563 | Bacteria | 2444 |
| 30 | Ga0068855_100536719 | 3300005563 | Bacteria | 1268 |
| 31 | Ga0068857_100352322 | 3300005577 | Bacteria | 1363 |
| 32 | Ga0068854_100213553 | 3300005578 | Bacteria | 1523 |
| 33 | Ga0068856_100034770 | 3300005614 | Bacteria | 4937 |
| 34 | Ga0070702_100132317 | 3300005615 | Bacteria | 1577 |
| 35 | Ga0068852_101113365 | 3300005616 | Bacteria | 810 |
| 36 | Ga0068863_100591181 | 3300005841 | Bacteria | 1098 |
| 37 | Ga0068858_100315460 | 3300005842 | Bacteria | 1493 |
| 38 | Ga0081540_1125292 | 3300005983 | Bacteria | 1058 |
| 39 | Ga0081539_10000064 | 3300005985 | Bacteria | 247020 |
| 40 | Ga0070717_10000379 | 3300006028 | Bacteria | 28424 |
| 41 | Ga0070717_10055197 | 3300006028 | Bacteria | 3277 |
| 42 | Ga0070717_10241264 | 3300006028 | Bacteria | 1594 |
| 43 | Ga0075365_10173366 | 3300006038 | Bacteria | 1506 |
| 44 | Ga0075368_10363188 | 3300006042 | Bacteria | 632 |
| 45 | Ga0075363_100174873 | 3300006048 | Bacteria | 1220 |
| 46 | Ga0075363_100234742 | 3300006048 | Bacteria | 1053 |
| 47 | Ga0075364_10113200 | 3300006051 | Bacteria | 1812 |
| 48 | Ga0075364_10305862 | 3300006051 | Bacteria | 1082 |
| 49 | Ga0070715_10451334 | 3300006163 | Bacteria | 726 |
| 50 | Ga0070712_100306209 | 3300006175 | Bacteria | 1287 |
| 51 | Ga0070712_100372455 | 3300006175 | Bacteria | 1174 |
| 52 | Ga0075362_10081240 | 3300006177 | Bacteria | 1494 |
| 53 | Ga0075367_10095224 | 3300006178 | Bacteria | 1816 |
| 54 | Ga0075369_10316950 | 3300006186 | Bacteria | 729 |
| 55 | Ga0068865_100287204 | 3300006881 | Bacteria | 1312 |
| 56 | Ga0099794_10028463 | 3300007265 | Bacteria | 2599 |
| 57 | Ga0099794_10154127 | 3300007265 | Bacteria | 1167 |
| 58 | Ga0099795_10187680 | 3300007788 | Bacteria | 866 |
| 59 | Ga0105240_10125559 | 3300009093 | Bacteria | 3084 |
| 60 | Ga0105240_10203637 | 3300009093 | Bacteria | 2318 |
| 61 | Ga0114129_10305906 | 3300009147 | Bacteria | 2117 |
| 62 | Ga0105248_10055781 | 3300009177 | Bacteria | 4433 |
| 63 | Ga0105237_10044076 | 3300009545 | Bacteria | 4492 |
| 64 | Ga0105237_10077922 | 3300009545 | Bacteria | 3304 |
| 65 | Ga0105237_10387507 | 3300009545 | Bacteria | 1402 |
| 66 | Ga0105238_10044634 | 3300009551 | Bacteria | 4480 |
| 67 | Ga0105238_10913782 | 3300009551 | Bacteria | 896 |
| 68 | Ga0099796_10248760 | 3300010159 | Bacteria | 737 |
| 69 | Ga0105239_10024102 | 3300010375 | Bacteria | 6702 |
| 70 | Ga0105239_10033520 | 3300010375 | Bacteria | 5639 |
| 71 | Ga0105246_10408964 | 3300011119 | Bacteria | 1129 |
| 72 | Ga0105246_10424703 | 3300011119 | Bacteria | 1110 |
| 73 | Ga0105246_10674866 | 3300011119 | Bacteria | 902 |
| 74 | Ga0157370_10021676 | 3300013104 | Bacteria | 6401 |
| 75 | Ga0157370_10296214 | 3300013104 | Bacteria | 1494 |
| 76 | Ga0157370_10406477 | 3300013104 | Bacteria | 1253 |
| 77 | Ga0157369_10003844 | 3300013105 | Bacteria | 17843 |
| 78 | Ga0157369_10191388 | 3300013105 | Bacteria | 2150 |
| 79 | Ga0157369_10761692 | 3300013105 | Bacteria | 996 |
| 80 | Ga0157374_10016889 | 3300013296 | Bacteria | 6423 |
| 81 | Ga0157372_10789194 | 3300013307 | Bacteria | 1104 |
| 82 | Ga0157372_10884244 | 3300013307 | Bacteria | 1037 |
| 83 | Ga0157375_10703638 | 3300013308 | Bacteria | 1164 |
| 84 | Ga0157375_10707182 | 3300013308 | Bacteria | 1161 |
| 85 | Ga0157379_10807011 | 3300014968 | Bacteria | 886 |
| 86 | Ga0157376_10289179 | 3300014969 | Bacteria | 1547 |
| 87 | Ga0163161_10346575 | 3300017792 | Bacteria | 1179 |
| 88 | Ga0163161_10529816 | 3300017792 | Bacteria | 963 |
| 89 | Ga0213876_10349176 | 3300021384 | Bacteria | 787 |
| 90 | Ga0207692_10221167 | 3300025898 | Bacteria | 1122 |
| 91 | Ga0207642_10218542 | 3300025899 | Bacteria | 1064 |
| 92 | Ga0207684_10135442 | 3300025910 | Bacteria | 2115 |
| 93 | Ga0207707_10017137 | 3300025912 | Bacteria | 6312 |
| 94 | Ga0207707_10034744 | 3300025912 | Bacteria | 4410 |
| 95 | Ga0207695_10025261 | 3300025913 | Bacteria | 6656 |
| 96 | Ga0207671_10182080 | 3300025914 | Bacteria | 1635 |
| 97 | Ga0207671_10281500 | 3300025914 | Bacteria | 1312 |
| 98 | Ga0207671_10820691 | 3300025914 | Bacteria | 737 |
| 99 | Ga0207652_10189913 | 3300025921 | Bacteria | 1848 |
| 100 | Ga0207646_10025654 | 3300025922 | Bacteria | 5390 |
| 101 | Ga0207694_10143530 | 3300025924 | Bacteria | 1921 |
| 102 | Ga0207664_10286802 | 3300025929 | Bacteria | 1446 |
| 103 | Ga0207686_10254055 | 3300025934 | Bacteria | 1286 |
| 104 | Ga0207709_10392149 | 3300025935 | Bacteria | 1059 |
| 105 | Ga0207669_10258410 | 3300025937 | Bacteria | 1301 |
| 106 | Ga0207704_10148508 | 3300025938 | Bacteria | 1651 |
| 107 | Ga0207691_10466149 | 3300025940 | Bacteria | 1074 |
| 108 | Ga0207689_10327251 | 3300025942 | Bacteria | 1272 |
| 109 | Ga0207661_10009246 | 3300025944 | Bacteria | 7060 |
| 110 | Ga0207661_10166393 | 3300025944 | Bacteria | 1916 |
| 111 | Ga0207661_10259415 | 3300025944 | Bacteria | 1548 |
| 112 | Ga0207661_11245917 | 3300025944 | Bacteria | 684 |
| 113 | Ga0207667_10009829 | 3300025949 | Bacteria | 11241 |
| 114 | Ga0207667_10140474 | 3300025949 | Bacteria | 2487 |
| 115 | Ga0207667_10258040 | 3300025949 | Bacteria | 1782 |
| 116 | Ga0207667_10454306 | 3300025949 | Bacteria | 1301 |
| 117 | Ga0207667_10513888 | 3300025949 | Bacteria | 1214 |
| 118 | Ga0207658_10360275 | 3300025986 | Bacteria | 1269 |
| 119 | Ga0207703_10499354 | 3300026035 | Bacteria | 1142 |
| 120 | Ga0207639_10058606 | 3300026041 | Bacteria | 2963 |
| 121 | Ga0207639_10141735 | 3300026041 | Bacteria | 2003 |
| 122 | Ga0207639_10550564 | 3300026041 | Bacteria | 1059 |
| 123 | Ga0207702_10281704 | 3300026078 | Bacteria | 1572 |
| 124 | Ga0207641_10792429 | 3300026088 | Bacteria | 937 |
| 125 | Ga0207674_10050875 | 3300026116 | Bacteria | 4230 |
| 126 | Ga0207698_10179992 | 3300026142 | Bacteria | 1872 |
| 127 | Ga0207698_10875817 | 3300026142 | Bacteria | 904 |
| 128 | Ga0209179_1022922 | 3300027512 | Bacteria | 1229 |
| 129 | Ga0209588_1002567 | 3300027671 | Bacteria | 4932 |
| 130 | Ga0209588_1008910 | 3300027671 | Bacteria | 2986 |
| 131 | Ga0209813_10293570 | 3300027866 | Bacteria | 629 |
| 132 | Ga0265334_10038192 | 3300028573 | Bacteria | 1890 |
| 133 | Ga0307517_10000942 | 3300028786 | Bacteria | 49547 |
| 134 | Ga0265332_10022336 | 3300031238 | Bacteria | 2792 |
| 135 | Ga0265328_10166685 | 3300031239 | Bacteria | 831 |
| 136 | Ga0265340_10151160 | 3300031247 | Bacteria | 1058 |
| 137 | Ga0265339_10023050 | 3300031249 | Bacteria | 3602 |
| 138 | Ga0307513_10057565 | 3300031456 | Bacteria | 4139 |
| 139 | Ga0307513_10074689 | 3300031456 | Bacteria | 3524 |
| 140 | Ga0307508_10286682 | 3300031616 | Bacteria | 1240 |
| 141 | Ga0265314_10220788 | 3300031711 | Bacteria | 1106 |
| 142 | Ga0265342_10073722 | 3300031712 | Bacteria | 1985 |
| 143 | Ga0307413_10093609 | 3300031824 | Bacteria | 1965 |
| 144 | Ga0307410_10266214 | 3300031852 | Bacteria | 1339 |
| 145 | Ga0307406_10694260 | 3300031901 | Bacteria | 849 |
| 146 | Ga0307412_10727562 | 3300031911 | Bacteria | 854 |
| 147 | Ga0307409_101093847 | 3300031995 | Bacteria | 818 |
| 148 | Ga0307416_100220974 | 3300032002 | Bacteria | 1817 |
| 149 | Ga0307411_11155221 | 3300032005 | Bacteria | 700 |
| 150 | Ga0307415_100576469 | 3300032126 | Bacteria | 997 |
| 151 | Ga0373929_0059339 | 3300035085 | Bacteria | 892 |
| 152 | Ga0373934_0016035 | 3300035086 | Bacteria | 2846 |
| 153 | Ga0373934_0202310 | 3300035086 | Bacteria | 818 |
| 154 | Ga0373944_0131852 | 3300035089 | Bacteria | 869 |
| 155 | Ga0373923_0000670 | 3300035111 | Bacteria | 8700 |
| 156 | Ga0373953_0000650 | 3300035117 | Bacteria | 9650 |
| 157 | Ga0373954_0001234 | 3300035118 | Bacteria | 10292 |
| 158 | Ga0373956_0000627 | 3300035119 | Bacteria | 14473 |
| 159 | Ga0373957_0004833 | 3300035120 | Bacteria | 4129 |
| 160 | Ga0373960_0036594 | 3300035121 | Bacteria | 1399 |
| 161 | Ga0373943_0024574 | 3300035170 | Bacteria | 2810 |
| 162 | Ga0373943_0108280 | 3300035170 | Bacteria | 1462 |
| 163 | Ga0373946_0404867 | 3300035171 | Bacteria | 689 |
| 164 | Ga0373955_0005992 | 3300035172 | Bacteria | 5513 |
| 165 | Ga0373924_0006901 | 3300035410 | Bacteria | 4085 |
| 166 | Ga0373931_0001051 | 3300035691 | Bacteria | 11687 |
| 167 | Ga0373935_0129540 | 3300035692 | Bacteria | 1694 |
| 168 | Ga0373927_0024530 | 3300035695 | Bacteria | 3943 |
| 169 | Ga0373927_0049150 | 3300035695 | Bacteria | 2728 |
| 170 | Ga0373927_0063268 | 3300035695 | Bacteria | 2393 |
| 171 | Ga0373933_0000487 | 3300035724 | Bacteria | 24768 |
| 172 | Ga0373947_0022175 | 3300035725 | Bacteria | 3680 |
| 173 | Ga0373947_0263293 | 3300035725 | Bacteria | 1143 |
| 174 | Ga0373937_0013907 | 3300036401 | Bacteria | 7095 |
| 175 | Ga0373925_0029293 | 3300037068 | Bacteria | 4039 |
| 176 | Ga0373925_0050219 | 3300037068 | Bacteria | 3111 |
| 177 | Ga0373925_0145744 | 3300037068 | Bacteria | 1856 |
| 178 | Ga0373925_0758889 | 3300037068 | Bacteria | 800 |
| 179 | Ga0395900_0017110 | 3300037418 | Bacteria | 7402 |
| 180 | Ga0395898_0013931 | 3300037466 | Bacteria | 8263 |
| 181 | Ga0395898_0159263 | 3300037466 | Bacteria | 2159 |
| 182 | Ga0436364_1328077 | 3300037853 | Bacteria | 2488 |
| 183 | Ga0395901_0045549 | 3300038443 | Bacteria | 4553 |
| 184 | Ga0395901_0770841 | 3300038443 | Bacteria | 953 |
| 185 | Ga0436365_0064588 | 3300039437 | Bacteria | 1605 |
| 186 | Ga0436365_0074035 | 3300039437 | Bacteria | 2195 |
| 187 | Ga0436365_1235034 | 3300039437 | Bacteria | 820 |
| 188 | Ga0436360_0763726 | 3300039438 | Bacteria | 1141 |
| 189 | Ga0436361_0653875 | 3300039447 | Bacteria | 718 |
| 190 | Ga0436362_1077866 | 3300039453 | Bacteria | 1050 |
| 191 | Ga0439465_0188987 | 3300041413 | Bacteria | 747 |
| 192 | Ga0466963_0034728 | 3300044694 | Bacteria | 3282 |
| 193 | Ga0466967_0482491 | 3300045976 | Bacteria | 1215 |
| 194 | Ga0495592_0000610 | 3300046454 | Bacteria | 25275 |
| 195 | Ga0495603_0005317 | 3300046455 | Bacteria | 7679 |
| 196 | Ga0495603_0043428 | 3300046455 | Bacteria | 2684 |
| 197 | Ga0495629_0000124 | 3300046459 | Bacteria | 68796 |
| 198 | Ga0495629_0341735 | 3300046459 | Bacteria | 1022 |
| 199 | Ga0495638_0206697 | 3300046460 | Bacteria | 1105 |
| 200 | Ga0495651_0002831 | 3300046462 | Bacteria | 13439 |
| 201 | Ga0495653_0000465 | 3300046463 | Bacteria | 31535 |
| 202 | Ga0495580_0832782 | 3300046472 | Bacteria | 596 |
| 203 | Ga0495662_0094479 | 3300046476 | Bacteria | 1460 |
| 204 | Ga0495664_0091304 | 3300046477 | Bacteria | 1831 |
| 205 | Ga0495664_0646669 | 3300046477 | Bacteria | 627 |
| 206 | Ga0495594_0109858 | 3300046499 | Bacteria | 1555 |
| 207 | Ga0495596_0070407 | 3300046500 | Bacteria | 1359 |
| 208 | Ga0495606_0001721 | 3300046507 | Bacteria | 28133 |
| 209 | Ga0495606_0241619 | 3300046507 | Bacteria | 1007 |
| 210 | Ga0495608_0021426 | 3300046511 | Bacteria | 4435 |
| 211 | Ga0495618_0045470 | 3300046514 | Bacteria | 2769 |
| 212 | Ga0495628_0005485 | 3300046516 | Bacteria | 11108 |
| 213 | Ga0495652_0070013 | 3300046529 | Bacteria | 2934 |
| 214 | Ga0495640_0044960 | 3300046533 | Bacteria | 3066 |
| 215 | Ga0495587_0004810 | 3300046536 | Bacteria | 8865 |
| 216 | Ga0495598_0251881 | 3300046537 | Bacteria | 654 |
| 217 | Ga0495645_0007013 | 3300046543 | Bacteria | 7837 |
| 218 | Ga0495667_0000551 | 3300046559 | Bacteria | 23946 |
| 219 | Ga0495667_0455794 | 3300046559 | Bacteria | 803 |
| 220 | Ga0495656_0013251 | 3300046615 | Bacteria | 3063 |
| 221 | Ga0495634_0019074 | 3300046642 | Bacteria | 4875 |
| 222 | Ga0495635_0000786 | 3300046663 | Bacteria | 20681 |
| 223 | Ga0495659_0389345 | 3300046664 | Bacteria | 600 |
| 224 | Ga0495661_0264860 | 3300046665 | Bacteria | 872 |
| 225 | Ga0495657_0039048 | 3300046675 | Bacteria | 3263 |
| 226 | Ga0495599_0000556 | 3300046678 | Bacteria | 21265 |
| 227 | Ga0495646_0002174 | 3300046680 | Bacteria | 11940 |
| 228 | Ga0495613_0071685 | 3300046689 | Bacteria | 2525 |
| 229 | Ga0495600_0036164 | 3300046809 | Bacteria | 3208 |
| 230 | Ga0495581_0187038 | 3300047315 | Bacteria | 1211 |
| 231 | Ga0495604_0004036 | 3300047317 | Bacteria | 11668 |
| 232 | Ga0495674_0003198 | 3300047319 | Bacteria | 15908 |
| 233 | Ga0495672_0029184 | 3300047320 | Bacteria | 3477 |
| 234 | Ga0495680_0001556 | 3300047322 | Bacteria | 24553 |
| 235 | Ga0495675_0036474 | 3300047444 | Bacteria | 3135 |
| 236 | Ga0495684_0000169 | 3300047471 | Bacteria | 49164 |
| 237 | Ga0495593_0002450 | 3300047673 | Bacteria | 11166 |
| 238 | Ga0495602_0007192 | 3300048088 | Bacteria | 11665 |
| 239 | Ga0496102_0499315 | 3300048905 | Bacteria | 1139 |
| 240 | Ga0496102_0540954 | 3300048905 | Bacteria | 1087 |
| 241 | Ga0496103_0727179 | 3300048906 | Bacteria | 628 |
| 242 | Ga0496104_0130231 | 3300048907 | Bacteria | 2417 |
| 243 | Ga0496104_0239528 | 3300048907 | Bacteria | 1726 |
| 244 | Ga0496104_0887139 | 3300048907 | Bacteria | 797 |
| 245 | Ga0496105_0007450 | 3300048908 | Bacteria | 8472 |
| 246 | Ga0496106_0032680 | 3300048909 | Bacteria | 3880 |
| 247 | Ga0496106_0532543 | 3300048909 | Bacteria | 943 |
| 248 | Ga0496107_0187031 | 3300048910 | Bacteria | 1538 |
| 249 | Ga0496108_0452219 | 3300048911 | Bacteria | 1122 |
| 250 | Ga0496109_0126530 | 3300048912 | Bacteria | 2383 |
| 251 | Ga0496109_0329980 | 3300048912 | Bacteria | 1440 |
| 252 | Ga0496109_0426249 | 3300048912 | Bacteria | 1253 |
| 253 | Ga0496110_0060804 | 3300048913 | Bacteria | 3333 |
| 254 | Ga0496110_0648571 | 3300048913 | Bacteria | 955 |
| 255 | Ga0496111_0067901 | 3300048914 | Bacteria | 2591 |
| 256 | Ga0496111_0149689 | 3300048914 | Bacteria | 1731 |
| 257 | Ga0496111_0446388 | 3300048914 | Bacteria | 954 |
| 258 | Ga0496112_0029550 | 3300048915 | Bacteria | 5300 |
| 259 | Ga0496112_0550312 | 3300048915 | Bacteria | 1088 |
| 260 | Ga0496113_0067416 | 3300048916 | Bacteria | 2713 |
| 261 | Ga0496114_0084218 | 3300048917 | Bacteria | 2692 |
| 262 | Ga0496114_0103930 | 3300048917 | Bacteria | 2428 |
| 263 | Ga0496115_0024110 | 3300048918 | Bacteria | 4726 |
| 264 | Ga0496115_0186789 | 3300048918 | Bacteria | 1712 |
| 265 | Ga0496115_0283096 | 3300048918 | Bacteria | 1361 |
| 266 | Ga0496115_0502624 | 3300048918 | Bacteria | 974 |
| 267 | Ga0496121_0025457 | 3300048924 | Bacteria | 5612 |
| 268 | Ga0496121_0569741 | 3300048924 | Bacteria | 705 |
| 269 | Ga0496126_0014102 | 3300048929 | Bacteria | 8093 |
| 270 | Ga0496126_0034492 | 3300048929 | Bacteria | 4752 |
| 271 | Ga0501034_0003012 | 3300049571 | Bacteria | 19480 |
| 272 | Ga0501046_0087490 | 3300049580 | Bacteria | 2401 |
| 273 | Ga0501047_0039627 | 3300049581 | Bacteria | 4556 |
| 274 | Ga0501048_0416385 | 3300049582 | Bacteria | 961 |
| 275 | Ga0501070_0043183 | 3300049586 | Bacteria | 3752 |
| 276 | Ga0501073_0218003 | 3300049589 | Bacteria | 1318 |
| 277 | Ga0501074_0108521 | 3300049590 | Bacteria | 1986 |
| 278 | Ga0501044_0036012 | 3300049823 | Bacteria | 5179 |
| 279 | nmdc:mga03n38_379411_c1 | 3300050490 | Bacteria | 774 |
| 280 | nmdc:mga00v17_84625_c1 | 3300050491 | Bacteria | 1985 |
| 281 | nmdc:mga06z11_82054_c1 | 3300050494 | Bacteria | 1732 |
| 282 | nmdc:mga04h51_328872_c1 | 3300050495 | Bacteria | 628 |
| 283 | nmdc:mga08y16_330037_c1 | 3300050511 | Bacteria | 1569 |
| 284 | Ga0495601_0034574 | 3300053077 | Bacteria | 3154 |
| 285 | Ga0500610_0176538 | 3300053079 | Bacteria | 1050 |
| 286 | Ga0500635_0010711 | 3300053080 | Bacteria | 2584 |
| 287 | Ga0500635_0045019 | 3300053080 | Bacteria | 1491 |
| 288 | Ga0495595_0002875 | 3300053084 | Bacteria | 6791 |
| 289 | Ga0495619_0000556 | 3300053085 | Bacteria | 24680 |
| 290 | Ga0500647_0147816 | 3300053091 | Bacteria | 1098 |
| 291 | Ga0500566_0000150 | 3300053094 | Bacteria | 35703 |
| 292 | Ga0500640_003756 | 3300053095 | Bacteria | 5384 |
| 293 | Ga0500554_049634 | 3300053102 | Bacteria | 1317 |
| 294 | Ga0500572_003755 | 3300053111 | Bacteria | 3446 |
| 295 | Ga0500608_071708 | 3300053122 | Bacteria | 1647 |
| 296 | Ga0500559_0087296 | 3300053136 | Bacteria | 1424 |
| 297 | Ga0500603_000115 | 3300053150 | Bacteria | 18809 |
| 298 | Ga0500630_050986 | 3300053159 | Bacteria | 2001 |
| 299 | Ga0500639_163641 | 3300053163 | Bacteria | 1008 |
| 300 | Ga0500637_0014994 | 3300053178 | Bacteria | 4096 |
| 301 | Ga0500637_0213026 | 3300053178 | Bacteria | 1095 |
| 302 | Ga0500596_000250 | 3300053735 | Bacteria | 9375 |
| 303 | Ga0500601_004515 | 3300053737 | Bacteria | 1517 |
| 304 | Ga0500661_043701 | 3300055283 | Bacteria | 795 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2513237098 | 2513675104 | 174 |
| 2 | iso_pu_bacteria | 2524023210 | 2524469492 | 174 |
| 3 | iso_pu_bacteria | 2885383462 | 2885390813 | 174 |
| 4 | iso_pu_bacteria | 2903768456 | 2903771833 | 174 |
| 5 | iso_pu_bacteria | 2922386360 | 2922392591 | 174 |
| 6 | iso_pu_bacteria | 8006984368 | 8006990947 | 174 |
| 7 | 3300031901 | Ga0307406_10694260 | Ga0307406_106942602 | 176 |
| 8 | 3300032002 | Ga0307416_100220974 | Ga0307416_1002209744 | 176 |
| 9 | 3300041413 | Ga0439465_0188987 | Ga0439465_0188987_171_701 | 176 |
| 10 | 3300005336 | Ga0070680_100192358 | Ga0070680_1001923583 | 177 |
| 11 | 3300005339 | Ga0070660_100084704 | Ga0070660_1000847043 | 177 |
| 12 | 3300005366 | Ga0070659_100120592 | Ga0070659_1001205921 | 177 |
| 13 | 3300005530 | Ga0070679_100446984 | Ga0070679_1004469842 | 177 |
| 14 | 3300005539 | Ga0068853_100760083 | Ga0068853_1007600831 | 177 |
| 15 | 3300005578 | Ga0068854_100213553 | Ga0068854_1002135532 | 177 |
| 16 | 3300005614 | Ga0068856_100034770 | Ga0068856_1000347703 | 177 |
| 17 | 3300009093 | Ga0105240_10125559 | Ga0105240_101255594 | 177 |
| 18 | 3300013307 | Ga0157372_10789194 | Ga0157372_107891942 | 177 |
| 19 | 3300025949 | Ga0207667_10140474 | Ga0207667_101404743 | 177 |
| 20 | 3300035089 | Ga0373944_0131852 | Ga0373944_0131852_252_785 | 177 |
| 21 | 3300035695 | Ga0373927_0063268 | Ga0373927_0063268_148_681 | 177 |
| 22 | 3300003203 | JGI25406J46586_10000241 | JGI25406J46586_100002414 | 178 |
| 23 | 3300005327 | Ga0070658_10711391 | Ga0070658_107113911 | 178 |
| 24 | 3300005329 | Ga0070683_100238241 | Ga0070683_1002382412 | 178 |
| 25 | 3300005329 | Ga0070683_100360672 | Ga0070683_1003606721 | 178 |
| 26 | 3300005337 | Ga0070682_100142227 | Ga0070682_1001422272 | 178 |
| 27 | 3300005356 | Ga0070674_100113207 | Ga0070674_1001132073 | 178 |
| 28 | 3300005367 | Ga0070667_100886878 | Ga0070667_1008868781 | 178 |
| 29 | 3300005435 | Ga0070714_100014889 | Ga0070714_1000148896 | 178 |
| 30 | 3300005436 | Ga0070713_100011227 | Ga0070713_1000112273 | 178 |
| 31 | 3300005436 | Ga0070713_100183236 | Ga0070713_1001832363 | 178 |
| 32 | 3300005437 | Ga0070710_10240839 | Ga0070710_102408392 | 178 |
| 33 | 3300005458 | Ga0070681_10025289 | Ga0070681_100252895 | 178 |
| 34 | 3300005458 | Ga0070681_10653421 | Ga0070681_106534211 | 178 |
| 35 | 3300005471 | Ga0070698_100207347 | Ga0070698_1002073473 | 178 |
| 36 | 3300005530 | Ga0070679_100041560 | Ga0070679_1000415602 | 178 |
| 37 | 3300005535 | Ga0070684_100003873 | Ga0070684_1000038737 | 178 |
| 38 | 3300005535 | Ga0070684_100661010 | Ga0070684_1006610101 | 178 |
| 39 | 3300005539 | Ga0068853_100400850 | Ga0068853_1004008502 | 178 |
| 40 | 3300005539 | Ga0068853_100618054 | Ga0068853_1006180542 | 178 |
| 41 | 3300005548 | Ga0070665_100171749 | Ga0070665_1001717492 | 178 |
| 42 | 3300005548 | Ga0070665_100699544 | Ga0070665_1006995442 | 178 |
| 43 | 3300005563 | Ga0068855_100012000 | Ga0068855_1000120005 | 178 |
| 44 | 3300005563 | Ga0068855_100068036 | Ga0068855_1000680363 | 178 |
| 45 | 3300005563 | Ga0068855_100173071 | Ga0068855_1001730712 | 178 |
| 46 | 3300005563 | Ga0068855_100536719 | Ga0068855_1005367192 | 178 |
| 47 | 3300005577 | Ga0068857_100352322 | Ga0068857_1003523223 | 178 |
| 48 | 3300005615 | Ga0070702_100132317 | Ga0070702_1001323172 | 178 |
| 49 | 3300005616 | Ga0068852_101113365 | Ga0068852_1011133651 | 178 |
| 50 | 3300005841 | Ga0068863_100591181 | Ga0068863_1005911812 | 178 |
| 51 | 3300005842 | Ga0068858_100315460 | Ga0068858_1003154602 | 178 |
| 52 | 3300005983 | Ga0081540_1125292 | Ga0081540_11252922 | 178 |
| 53 | 3300005985 | Ga0081539_10000064 | Ga0081539_1000006423 | 178 |
| 54 | 3300006028 | Ga0070717_10000379 | Ga0070717_100003795 | 178 |
| 55 | 3300006028 | Ga0070717_10055197 | Ga0070717_100551973 | 178 |
| 56 | 3300006028 | Ga0070717_10241264 | Ga0070717_102412642 | 178 |
| 57 | 3300006038 | Ga0075365_10173366 | Ga0075365_101733663 | 178 |
| 58 | 3300006042 | Ga0075368_10363188 | Ga0075368_103631881 | 178 |
| 59 | 3300006048 | Ga0075363_100174873 | Ga0075363_1001748732 | 178 |
| 60 | 3300006048 | Ga0075363_100234742 | Ga0075363_1002347422 | 178 |
| 61 | 3300006051 | Ga0075364_10113200 | Ga0075364_101132003 | 178 |
| 62 | 3300006051 | Ga0075364_10305862 | Ga0075364_103058621 | 178 |
| 63 | 3300006163 | Ga0070715_10451334 | Ga0070715_104513341 | 178 |
| 64 | 3300006175 | Ga0070712_100306209 | Ga0070712_1003062092 | 178 |
| 65 | 3300006175 | Ga0070712_100372455 | Ga0070712_1003724551 | 178 |
| 66 | 3300006177 | Ga0075362_10081240 | Ga0075362_100812402 | 178 |
| 67 | 3300006178 | Ga0075367_10095224 | Ga0075367_100952242 | 178 |
| 68 | 3300006186 | Ga0075369_10316950 | Ga0075369_103169501 | 178 |
| 69 | 3300006881 | Ga0068865_100287204 | Ga0068865_1002872042 | 178 |
| 70 | 3300007265 | Ga0099794_10028463 | Ga0099794_100284633 | 178 |
| 71 | 3300007265 | Ga0099794_10154127 | Ga0099794_101541272 | 178 |
| 72 | 3300007788 | Ga0099795_10187680 | Ga0099795_101876801 | 178 |
| 73 | 3300009093 | Ga0105240_10203637 | Ga0105240_102036373 | 178 |
| 74 | 3300009147 | Ga0114129_10305906 | Ga0114129_103059063 | 178 |
| 75 | 3300009177 | Ga0105248_10055781 | Ga0105248_100557813 | 178 |
| 76 | 3300009545 | Ga0105237_10044076 | Ga0105237_100440767 | 178 |
| 77 | 3300009545 | Ga0105237_10077922 | Ga0105237_100779224 | 178 |
| 78 | 3300009545 | Ga0105237_10387507 | Ga0105237_103875071 | 178 |
| 79 | 3300009551 | Ga0105238_10044634 | Ga0105238_100446344 | 178 |
| 80 | 3300009551 | Ga0105238_10913782 | Ga0105238_109137822 | 178 |
| 81 | 3300010159 | Ga0099796_10248760 | Ga0099796_102487601 | 178 |
| 82 | 3300010375 | Ga0105239_10024102 | Ga0105239_100241025 | 178 |
| 83 | 3300010375 | Ga0105239_10033520 | Ga0105239_100335207 | 178 |
| 84 | 3300011119 | Ga0105246_10408964 | Ga0105246_104089642 | 178 |
| 85 | 3300011119 | Ga0105246_10424703 | Ga0105246_104247032 | 178 |
| 86 | 3300011119 | Ga0105246_10674866 | Ga0105246_106748661 | 178 |
| 87 | 3300013104 | Ga0157370_10021676 | Ga0157370_100216763 | 178 |
| 88 | 3300013104 | Ga0157370_10296214 | Ga0157370_102962142 | 178 |
| 89 | 3300013104 | Ga0157370_10406477 | Ga0157370_104064773 | 178 |
| 90 | 3300013105 | Ga0157369_10003844 | Ga0157369_1000384411 | 178 |
| 91 | 3300013105 | Ga0157369_10191388 | Ga0157369_101913883 | 178 |
| 92 | 3300013105 | Ga0157369_10761692 | Ga0157369_107616922 | 178 |
| 93 | 3300013296 | Ga0157374_10016889 | Ga0157374_100168893 | 178 |
| 94 | 3300013307 | Ga0157372_10884244 | Ga0157372_108842442 | 178 |
| 95 | 3300013308 | Ga0157375_10703638 | Ga0157375_107036382 | 178 |
| 96 | 3300013308 | Ga0157375_10707182 | Ga0157375_107071822 | 178 |
| 97 | 3300014968 | Ga0157379_10807011 | Ga0157379_108070112 | 178 |
| 98 | 3300014969 | Ga0157376_10289179 | Ga0157376_102891793 | 178 |
| 99 | 3300017792 | Ga0163161_10346575 | Ga0163161_103465752 | 178 |
| 100 | 3300017792 | Ga0163161_10529816 | Ga0163161_105298162 | 178 |
| 101 | 3300021384 | Ga0213876_10349176 | Ga0213876_103491762 | 178 |
| 102 | 3300025898 | Ga0207692_10221167 | Ga0207692_102211672 | 178 |
| 103 | 3300025899 | Ga0207642_10218542 | Ga0207642_102185421 | 178 |
| 104 | 3300025910 | Ga0207684_10135442 | Ga0207684_101354423 | 178 |
| 105 | 3300025912 | Ga0207707_10017137 | Ga0207707_100171374 | 178 |
| 106 | 3300025912 | Ga0207707_10034744 | Ga0207707_100347443 | 178 |
| 107 | 3300025913 | Ga0207695_10025261 | Ga0207695_100252618 | 178 |
| 108 | 3300025914 | Ga0207671_10182080 | Ga0207671_101820803 | 178 |
| 109 | 3300025914 | Ga0207671_10281500 | Ga0207671_102815002 | 178 |
| 110 | 3300025914 | Ga0207671_10820691 | Ga0207671_108206911 | 178 |
| 111 | 3300025921 | Ga0207652_10189913 | Ga0207652_101899132 | 178 |
| 112 | 3300025922 | Ga0207646_10025654 | Ga0207646_100256546 | 178 |
| 113 | 3300025924 | Ga0207694_10143530 | Ga0207694_101435302 | 178 |
| 114 | 3300025929 | Ga0207664_10286802 | Ga0207664_102868022 | 178 |
| 115 | 3300025934 | Ga0207686_10254055 | Ga0207686_102540552 | 178 |
| 116 | 3300025935 | Ga0207709_10392149 | Ga0207709_103921492 | 178 |
| 117 | 3300025937 | Ga0207669_10258410 | Ga0207669_102584102 | 178 |
| 118 | 3300025938 | Ga0207704_10148508 | Ga0207704_101485083 | 178 |
| 119 | 3300025940 | Ga0207691_10466149 | Ga0207691_104661491 | 178 |
| 120 | 3300025942 | Ga0207689_10327251 | Ga0207689_103272513 | 178 |
| 121 | 3300025944 | Ga0207661_10009246 | Ga0207661_100092468 | 178 |
| 122 | 3300025944 | Ga0207661_10166393 | Ga0207661_101663933 | 178 |
| 123 | 3300025944 | Ga0207661_10259415 | Ga0207661_102594152 | 178 |
| 124 | 3300025944 | Ga0207661_11245917 | Ga0207661_112459171 | 178 |
| 125 | 3300025949 | Ga0207667_10009829 | Ga0207667_100098296 | 178 |
| 126 | 3300025949 | Ga0207667_10258040 | Ga0207667_102580403 | 178 |
| 127 | 3300025949 | Ga0207667_10454306 | Ga0207667_104543061 | 178 |
| 128 | 3300025949 | Ga0207667_10513888 | Ga0207667_105138881 | 178 |
| 129 | 3300025986 | Ga0207658_10360275 | Ga0207658_103602752 | 178 |
| 130 | 3300026035 | Ga0207703_10499354 | Ga0207703_104993541 | 178 |
| 131 | 3300026041 | Ga0207639_10058606 | Ga0207639_100586064 | 178 |
| 132 | 3300026041 | Ga0207639_10141735 | Ga0207639_101417352 | 178 |
| 133 | 3300026041 | Ga0207639_10550564 | Ga0207639_105505642 | 178 |
| 134 | 3300026078 | Ga0207702_10281704 | Ga0207702_102817043 | 178 |
| 135 | 3300026088 | Ga0207641_10792429 | Ga0207641_107924292 | 178 |
| 136 | 3300026116 | Ga0207674_10050875 | Ga0207674_100508752 | 178 |
| 137 | 3300026142 | Ga0207698_10179992 | Ga0207698_101799921 | 178 |
| 138 | 3300026142 | Ga0207698_10875817 | Ga0207698_108758172 | 178 |
| 139 | 3300027512 | Ga0209179_1022922 | Ga0209179_10229221 | 178 |
| 140 | 3300027671 | Ga0209588_1002567 | Ga0209588_10025676 | 178 |
| 141 | 3300027671 | Ga0209588_1008910 | Ga0209588_10089103 | 178 |
| 142 | 3300027866 | Ga0209813_10293570 | Ga0209813_102935701 | 178 |
| 143 | 3300028573 | Ga0265334_10038192 | Ga0265334_100381923 | 178 |
| 144 | 3300028786 | Ga0307517_10000942 | Ga0307517_1000094232 | 178 |
| 145 | 3300031238 | Ga0265332_10022336 | Ga0265332_100223363 | 178 |
| 146 | 3300031239 | Ga0265328_10166685 | Ga0265328_101666852 | 178 |
| 147 | 3300031247 | Ga0265340_10151160 | Ga0265340_101511602 | 178 |
| 148 | 3300031249 | Ga0265339_10023050 | Ga0265339_100230503 | 178 |
| 149 | 3300031456 | Ga0307513_10057565 | Ga0307513_100575654 | 178 |
| 150 | 3300031456 | Ga0307513_10074689 | Ga0307513_100746895 | 178 |
| 151 | 3300031616 | Ga0307508_10286682 | Ga0307508_102866822 | 178 |
| 152 | 3300031711 | Ga0265314_10220788 | Ga0265314_102207882 | 178 |
| 153 | 3300031712 | Ga0265342_10073722 | Ga0265342_100737223 | 178 |
| 154 | 3300031824 | Ga0307413_10093609 | Ga0307413_100936093 | 178 |
| 155 | 3300031852 | Ga0307410_10266214 | Ga0307410_102662142 | 178 |
| 156 | 3300031911 | Ga0307412_10727562 | Ga0307412_107275621 | 178 |
| 157 | 3300031995 | Ga0307409_101093847 | Ga0307409_1010938471 | 178 |
| 158 | 3300032005 | Ga0307411_11155221 | Ga0307411_111552211 | 178 |
| 159 | 3300032126 | Ga0307415_100576469 | Ga0307415_1005764692 | 178 |
| 160 | 3300035085 | Ga0373929_0059339 | Ga0373929_0059339_180_788 | 178 |
| 161 | 3300035086 | Ga0373934_0016035 | Ga0373934_0016035_1084_1620 | 178 |
| 162 | 3300035086 | Ga0373934_0202310 | Ga0373934_0202310_96_632 | 178 |
| 163 | 3300035111 | Ga0373923_0000670 | Ga0373923_0000670_5005_5541 | 178 |
| 164 | 3300035117 | Ga0373953_0000650 | Ga0373953_0000650_6298_6834 | 178 |
| 165 | 3300035118 | Ga0373954_0001234 | Ga0373954_0001234_9684_10220 | 178 |
| 166 | 3300035119 | Ga0373956_0000627 | Ga0373956_0000627_6530_7066 | 178 |
| 167 | 3300035120 | Ga0373957_0004833 | Ga0373957_0004833_3312_3848 | 178 |
| 168 | 3300035121 | Ga0373960_0036594 | Ga0373960_0036594_348_956 | 178 |
| 169 | 3300035170 | Ga0373943_0024574 | Ga0373943_0024574_184_747 | 178 |
| 170 | 3300035170 | Ga0373943_0108280 | Ga0373943_0108280_603_1139 | 178 |
| 171 | 3300035171 | Ga0373946_0404867 | Ga0373946_0404867_35_571 | 178 |
| 172 | 3300035172 | Ga0373955_0005992 | Ga0373955_0005992_4051_4587 | 178 |
| 173 | 3300035410 | Ga0373924_0006901 | Ga0373924_0006901_2919_3455 | 178 |
| 174 | 3300035691 | Ga0373931_0001051 | Ga0373931_0001051_5976_6584 | 178 |
| 175 | 3300035692 | Ga0373935_0129540 | Ga0373935_0129540_296_832 | 178 |
| 176 | 3300035695 | Ga0373927_0024530 | Ga0373927_0024530_1886_2422 | 178 |
| 177 | 3300035695 | Ga0373927_0049150 | Ga0373927_0049150_2110_2646 | 178 |
| 178 | 3300035724 | Ga0373933_0000487 | Ga0373933_0000487_21675_22211 | 178 |
| 179 | 3300035725 | Ga0373947_0022175 | Ga0373947_0022175_1933_2469 | 178 |
| 180 | 3300035725 | Ga0373947_0263293 | Ga0373947_0263293_561_1100 | 178 |
| 181 | 3300036401 | Ga0373937_0013907 | Ga0373937_0013907_6045_6581 | 178 |
| 182 | 3300037068 | Ga0373925_0029293 | Ga0373925_0029293_1483_2091 | 178 |
| 183 | 3300037068 | Ga0373925_0050219 | Ga0373925_0050219_579_1115 | 178 |
| 184 | 3300037068 | Ga0373925_0145744 | Ga0373925_0145744_58_621 | 178 |
| 185 | 3300037068 | Ga0373925_0758889 | Ga0373925_0758889_180_716 | 178 |
| 186 | 3300037418 | Ga0395900_0017110 | Ga0395900_0017110_5310_5858 | 178 |
| 187 | 3300037466 | Ga0395898_0013931 | Ga0395898_0013931_2159_2707 | 178 |
| 188 | 3300037466 | Ga0395898_0159263 | Ga0395898_0159263_925_1461 | 178 |
| 189 | 3300037853 | Ga0436364_1328077 | Ga0436364_1328077_353_895 | 178 |
| 190 | 3300038443 | Ga0395901_0045549 | Ga0395901_0045549_1153_1701 | 178 |
| 191 | 3300038443 | Ga0395901_0770841 | Ga0395901_0770841_363_914 | 178 |
| 192 | 3300039437 | Ga0436365_0064588 | Ga0436365_0064588_335_871 | 178 |
| 193 | 3300039437 | Ga0436365_0074035 | Ga0436365_0074035_1504_2040 | 178 |
| 194 | 3300039437 | Ga0436365_1235034 | Ga0436365_1235034_56_598 | 178 |
| 195 | 3300039438 | Ga0436360_0763726 | Ga0436360_0763726_346_882 | 178 |
| 196 | 3300039447 | Ga0436361_0653875 | Ga0436361_0653875_82_621 | 178 |
| 197 | 3300039453 | Ga0436362_1077866 | Ga0436362_1077866_374_910 | 178 |
| 198 | 3300044694 | Ga0466963_0034728 | Ga0466963_0034728_2240_2776 | 178 |
| 199 | 3300045976 | Ga0466967_0482491 | Ga0466967_0482491_216_752 | 178 |
| 200 | 3300046454 | Ga0495592_0000610 | Ga0495592_0000610_8373_8909 | 178 |
| 201 | 3300046455 | Ga0495603_0005317 | Ga0495603_0005317_1897_2433 | 178 |
| 202 | 3300046455 | Ga0495603_0043428 | Ga0495603_0043428_648_1184 | 178 |
| 203 | 3300046459 | Ga0495629_0000124 | Ga0495629_0000124_41741_42277 | 178 |
| 204 | 3300046459 | Ga0495629_0341735 | Ga0495629_0341735_243_800 | 178 |
| 205 | 3300046460 | Ga0495638_0206697 | Ga0495638_0206697_222_761 | 178 |
| 206 | 3300046462 | Ga0495651_0002831 | Ga0495651_0002831_11562_12098 | 178 |
| 207 | 3300046463 | Ga0495653_0000465 | Ga0495653_0000465_22952_23488 | 178 |
| 208 | 3300046472 | Ga0495580_0832782 | Ga0495580_0832782_10_546 | 178 |
| 209 | 3300046476 | Ga0495662_0094479 | Ga0495662_0094479_503_1060 | 178 |
| 210 | 3300046477 | Ga0495664_0091304 | Ga0495664_0091304_549_1088 | 178 |
| 211 | 3300046477 | Ga0495664_0646669 | Ga0495664_0646669_44_601 | 178 |
| 212 | 3300046499 | Ga0495594_0109858 | Ga0495594_0109858_634_1212 | 178 |
| 213 | 3300046500 | Ga0495596_0070407 | Ga0495596_0070407_529_1107 | 178 |
| 214 | 3300046507 | Ga0495606_0001721 | Ga0495606_0001721_21206_21742 | 178 |
| 215 | 3300046507 | Ga0495606_0241619 | Ga0495606_0241619_159_713 | 178 |
| 216 | 3300046511 | Ga0495608_0021426 | Ga0495608_0021426_2558_3094 | 178 |
| 217 | 3300046514 | Ga0495618_0045470 | Ga0495618_0045470_409_945 | 178 |
| 218 | 3300046516 | Ga0495628_0005485 | Ga0495628_0005485_92_628 | 178 |
| 219 | 3300046529 | Ga0495652_0070013 | Ga0495652_0070013_1342_1878 | 178 |
| 220 | 3300046533 | Ga0495640_0044960 | Ga0495640_0044960_2446_2982 | 178 |
| 221 | 3300046536 | Ga0495587_0004810 | Ga0495587_0004810_643_1179 | 178 |
| 222 | 3300046537 | Ga0495598_0251881 | Ga0495598_0251881_48_626 | 178 |
| 223 | 3300046543 | Ga0495645_0007013 | Ga0495645_0007013_2022_2558 | 178 |
| 224 | 3300046559 | Ga0495667_0000551 | Ga0495667_0000551_1110_1646 | 178 |
| 225 | 3300046559 | Ga0495667_0455794 | Ga0495667_0455794_233_790 | 178 |
| 226 | 3300046615 | Ga0495656_0013251 | Ga0495656_0013251_345_884 | 178 |
| 227 | 3300046642 | Ga0495634_0019074 | Ga0495634_0019074_3795_4331 | 178 |
| 228 | 3300046663 | Ga0495635_0000786 | Ga0495635_0000786_461_997 | 178 |
| 229 | 3300046664 | Ga0495659_0389345 | Ga0495659_0389345_49_585 | 178 |
| 230 | 3300046665 | Ga0495661_0264860 | Ga0495661_0264860_280_819 | 178 |
| 231 | 3300046675 | Ga0495657_0039048 | Ga0495657_0039048_982_1518 | 178 |
| 232 | 3300046678 | Ga0495599_0000556 | Ga0495599_0000556_3300_3836 | 178 |
| 233 | 3300046680 | Ga0495646_0002174 | Ga0495646_0002174_3082_3618 | 178 |
| 234 | 3300046689 | Ga0495613_0071685 | Ga0495613_0071685_260_796 | 178 |
| 235 | 3300046809 | Ga0495600_0036164 | Ga0495600_0036164_927_1463 | 178 |
| 236 | 3300047315 | Ga0495581_0187038 | Ga0495581_0187038_107_673 | 178 |
| 237 | 3300047317 | Ga0495604_0004036 | Ga0495604_0004036_282_818 | 178 |
| 238 | 3300047319 | Ga0495674_0003198 | Ga0495674_0003198_3265_3801 | 178 |
| 239 | 3300047320 | Ga0495672_0029184 | Ga0495672_0029184_325_864 | 178 |
| 240 | 3300047322 | Ga0495680_0001556 | Ga0495680_0001556_3296_3832 | 178 |
| 241 | 3300047444 | Ga0495675_0036474 | Ga0495675_0036474_982_1518 | 178 |
| 242 | 3300047471 | Ga0495684_0000169 | Ga0495684_0000169_46071_46607 | 178 |
| 243 | 3300047673 | Ga0495593_0002450 | Ga0495593_0002450_7424_7960 | 178 |
| 244 | 3300048088 | Ga0495602_0007192 | Ga0495602_0007192_643_1179 | 178 |
| 245 | 3300048905 | Ga0496102_0499315 | Ga0496102_0499315_21_575 | 178 |
| 246 | 3300048905 | Ga0496102_0540954 | Ga0496102_0540954_330_938 | 178 |
| 247 | 3300048906 | Ga0496103_0727179 | Ga0496103_0727179_50_589 | 178 |
| 248 | 3300048907 | Ga0496104_0130231 | Ga0496104_0130231_1600_2136 | 178 |
| 249 | 3300048907 | Ga0496104_0239528 | Ga0496104_0239528_464_1072 | 178 |
| 250 | 3300048907 | Ga0496104_0887139 | Ga0496104_0887139_206_745 | 178 |
| 251 | 3300048908 | Ga0496105_0007450 | Ga0496105_0007450_3393_4001 | 178 |
| 252 | 3300048909 | Ga0496106_0032680 | Ga0496106_0032680_1202_1810 | 178 |
| 253 | 3300048909 | Ga0496106_0532543 | Ga0496106_0532543_248_787 | 178 |
| 254 | 3300048910 | Ga0496107_0187031 | Ga0496107_0187031_327_935 | 178 |
| 255 | 3300048911 | Ga0496108_0452219 | Ga0496108_0452219_366_905 | 178 |
| 256 | 3300048912 | Ga0496109_0126530 | Ga0496109_0126530_1770_2309 | 178 |
| 257 | 3300048912 | Ga0496109_0329980 | Ga0496109_0329980_645_1181 | 178 |
| 258 | 3300048912 | Ga0496109_0426249 | Ga0496109_0426249_465_1073 | 178 |
| 259 | 3300048913 | Ga0496110_0060804 | Ga0496110_0060804_222_758 | 178 |
| 260 | 3300048913 | Ga0496110_0648571 | Ga0496110_0648571_197_805 | 178 |
| 261 | 3300048914 | Ga0496111_0067901 | Ga0496111_0067901_1556_2164 | 178 |
| 262 | 3300048914 | Ga0496111_0149689 | Ga0496111_0149689_270_806 | 178 |
| 263 | 3300048914 | Ga0496111_0446388 | Ga0496111_0446388_217_771 | 178 |
| 264 | 3300048915 | Ga0496112_0029550 | Ga0496112_0029550_4228_4836 | 178 |
| 265 | 3300048915 | Ga0496112_0550312 | Ga0496112_0550312_290_826 | 178 |
| 266 | 3300048916 | Ga0496113_0067416 | Ga0496113_0067416_1001_1609 | 178 |
| 267 | 3300048917 | Ga0496114_0084218 | Ga0496114_0084218_1864_2403 | 178 |
| 268 | 3300048917 | Ga0496114_0103930 | Ga0496114_0103930_381_989 | 178 |
| 269 | 3300048918 | Ga0496115_0024110 | Ga0496115_0024110_3818_4426 | 178 |
| 270 | 3300048918 | Ga0496115_0186789 | Ga0496115_0186789_726_1262 | 178 |
| 271 | 3300048918 | Ga0496115_0283096 | Ga0496115_0283096_560_1114 | 178 |
| 272 | 3300048918 | Ga0496115_0502624 | Ga0496115_0502624_296_832 | 178 |
| 273 | 3300048924 | Ga0496121_0025457 | Ga0496121_0025457_3260_3853 | 178 |
| 274 | 3300048924 | Ga0496121_0569741 | Ga0496121_0569741_129_665 | 178 |
| 275 | 3300048929 | Ga0496126_0014102 | Ga0496126_0014102_6738_7274 | 178 |
| 276 | 3300048929 | Ga0496126_0034492 | Ga0496126_0034492_402_950 | 178 |
| 277 | 3300049571 | Ga0501034_0003012 | Ga0501034_0003012_18279_18815 | 178 |
| 278 | 3300049580 | Ga0501046_0087490 | Ga0501046_0087490_1335_1883 | 178 |
| 279 | 3300049581 | Ga0501047_0039627 | Ga0501047_0039627_119_667 | 178 |
| 280 | 3300049582 | Ga0501048_0416385 | Ga0501048_0416385_112_660 | 178 |
| 281 | 3300049586 | Ga0501070_0043183 | Ga0501070_0043183_2913_3461 | 178 |
| 282 | 3300049589 | Ga0501073_0218003 | Ga0501073_0218003_274_822 | 178 |
| 283 | 3300049590 | Ga0501074_0108521 | Ga0501074_0108521_763_1311 | 178 |
| 284 | 3300049823 | Ga0501044_0036012 | Ga0501044_0036012_3865_4413 | 178 |
| 285 | 3300050490 | nmdc:mga03n38_379411_c1 | nmdc:mga03n38_379411_c1_61_597 | 178 |
| 286 | 3300050491 | nmdc:mga00v17_84625_c1 | nmdc:mga00v17_84625_c1_1035_1574 | 178 |
| 287 | 3300050494 | nmdc:mga06z11_82054_c1 | nmdc:mga06z11_82054_c1_884_1423 | 178 |
| 288 | 3300050495 | nmdc:mga04h51_328872_c1 | nmdc:mga04h51_328872_c1_22_561 | 178 |
| 289 | 3300050511 | nmdc:mga08y16_330037_c1 | nmdc:mga08y16_330037_c1_135_671 | 178 |
| 290 | 3300053077 | Ga0495601_0034574 | Ga0495601_0034574_2338_2904 | 178 |
| 291 | 3300053079 | Ga0500610_0176538 | Ga0500610_0176538_78_614 | 178 |
| 292 | 3300053080 | Ga0500635_0010711 | Ga0500635_0010711_1699_2235 | 178 |
| 293 | 3300053080 | Ga0500635_0045019 | Ga0500635_0045019_300_836 | 178 |
| 294 | 3300053084 | Ga0495595_0002875 | Ga0495595_0002875_5274_5810 | 178 |
| 295 | 3300053085 | Ga0495619_0000556 | Ga0495619_0000556_18100_18636 | 178 |
| 296 | 3300053091 | Ga0500647_0147816 | Ga0500647_0147816_79_630 | 178 |
| 297 | 3300053094 | Ga0500566_0000150 | Ga0500566_0000150_3070_3621 | 178 |
| 298 | 3300053095 | Ga0500640_003756 | Ga0500640_003756_2950_3501 | 178 |
| 299 | 3300053102 | Ga0500554_049634 | Ga0500554_049634_558_1094 | 178 |
| 300 | 3300053111 | Ga0500572_003755 | Ga0500572_003755_2633_3184 | 178 |
| 301 | 3300053122 | Ga0500608_071708 | Ga0500608_071708_138_689 | 178 |
| 302 | 3300053136 | Ga0500559_0087296 | Ga0500559_0087296_100_636 | 178 |
| 303 | 3300053150 | Ga0500603_000115 | Ga0500603_000115_12971_13507 | 178 |
| 304 | 3300053159 | Ga0500630_050986 | Ga0500630_050986_1068_1619 | 178 |
| 305 | 3300053163 | Ga0500639_163641 | Ga0500639_163641_80_616 | 178 |
| 306 | 3300053178 | Ga0500637_0014994 | Ga0500637_0014994_3228_3764 | 178 |
| 307 | 3300053178 | Ga0500637_0213026 | Ga0500637_0213026_90_626 | 178 |
| 308 | 3300053735 | Ga0500596_000250 | Ga0500596_000250_5778_6329 | 178 |
| 309 | 3300053737 | Ga0500601_004515 | Ga0500601_004515_358_909 | 178 |
| 310 | 3300055283 | Ga0500661_043701 | Ga0500661_043701_152_703 | 178 |
| 311 | iso_pu_bacteria | 8056681323 | 8056686559 | 178 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3g7r-assembly1.cif.gz_A | crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor | 0.7954 | 10 | 178 |
| 3g7r-assembly1.cif.gz_B | crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor | 0.7921 | 10 | 178 |
| 2g3b-assembly1.cif.gz_B | crystal structure of putative tetr-family transcriptional regulator from rhodococcus sp. | 0.7759 | 10 | 178 |
| 6o6n-assembly1.cif.gz_A | structure of the regulator fasr from mycobacterium tuberculosis in complex with c20-coa | 0.7758 | 10 | 176 |
| 2np5-assembly1.cif.gz_A | crystal structure of a transcriptional regulator (rha1_ro04179) from rhodococcus sp. rha1. | 0.7692 | 6 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1zk8B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9516 | 5 | 48 | 1.10.10.60 |
| 2y30A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9469 | 6 | 59 | 1.10.10.60 |
| 3fiwB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9465 | 6 | 48 | 1.10.10.60 |
| 2y2zA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9425 | 5 | 59 | 1.10.10.60 |
| 2y31B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9424 | 4 | 59 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H9VKR7-F1-model_v4 | deleted | 0.9601 | 1 | 178 |
|
| AF-A0A2H9VKR7-F1-model_v4 | deleted | 0.9549 | 1 | 178 |
|
| AF-A0A0S6UNV9-F1-model_v4 | HTH tetR-type domain-containing protein | 0.9498 | 1 | 178 |
GO:0003677
|
| AF-G3D5H5-F1-model_v4 | Transcriptional regulatory protein | 0.9451 | 3 | 177 |
GO:0000976
GO:0003700 |
| AF-H0TRG6-F1-model_v4 | Putative transcriptional regulator protein | 0.9444 | 1 | 177 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar