F401265

General Info

Members Datasets Scaffolds Average Seq Length
311 182 311 355

Family's Representative Sequence

Representative Sequence 3300028666|Ga0265336_10000234|Ga0265336_1000023437
Length 359
Sequence MKIMIVTGSGGLIGGEVVEHFIKLGWMVHGIDNNNRKRFFGEAGDTAWRVNQLLEKYQGSYFHYDADISMATELEEVFTVVDSQDKISAIVHCAAQPSHDLAAQIMRKDFGTNVVGTFNMLSLAKKYCPEAPFVFTSTNKVYGDNPNKLNYYETETRWSPLDNYDRKIAEFGFDETLSIDNCKHSLFGAGKAAADLYVQEFGRYFNMPTACLRGGCLTGPNHSGVELHGFLNYLIKCNLEGKKYTVFGYKGKQVRDNIHAYDVARFIEEFIAAPKCAEIYNIGGGMSNSISILESFKLIEQITSKPMEYEITDAVRSGDHQWYVSDLHKMRVHYPKWEITKTLKDIFNETVETWHQRTA

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
134 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
135 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.54
Nodule 0
Rhizoplane 1.29
Rhizosphere 87.46
Stem 0
Stem Tuber 0
Unclassified 7.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000253 3300002773 Bacteria 35641
2 JGI25150J39212_1000186 3300002774 Bacteria 35005
3 JGI25151J46595_10000543 3300003187 Bacteria 34834
4 JGI25153J46596_10000323 3300003215 Bacteria 34832
5 rootH2_10153962 3300003320 Bacteria 1666
6 rootH1_10064251 3300003323 Bacteria 29046
7 rootH1_10100585 3300003323 Bacteria 9920
8 rootH1_10383638 3300003323 Unclassified 3561
9 Ga0070658_10054921 3300005327 Bacteria 3235
10 Ga0070690_100002713 3300005330 Bacteria 9552
11 Ga0070690_100015200 3300005330 Bacteria 4586
12 Ga0070670_100011587 3300005331 Bacteria 7536
13 Ga0070670_100113737 3300005331 Unclassified 2333
14 Ga0070670_100251393 3300005331 Bacteria 1540
15 Ga0070670_100400116 3300005331 Bacteria 1212
16 Ga0070666_10058098 3300005335 Bacteria 2615
17 Ga0070666_10244183 3300005335 Bacteria 1270
18 Ga0070680_100005464 3300005336 Bacteria 9619
19 Ga0070682_100001051 3300005337 Bacteria 15934
20 Ga0070660_100014900 3300005339 Bacteria 5611
21 Ga0070660_100162322 3300005339 Bacteria 1801
22 Ga0070689_100114957 3300005340 Bacteria 2144
23 Ga0070689_100143712 3300005340 Bacteria 1920
24 Ga0070689_100148464 3300005340 Bacteria 1890
25 Ga0070689_100188901 3300005340 Bacteria 1677
26 Ga0070687_100087998 3300005343 Bacteria 1711
27 Ga0070661_100007070 3300005344 Bacteria 7743
28 Ga0070692_10001552 3300005345 Bacteria 8428
29 Ga0070675_100000185 3300005354 Bacteria 38683
30 Ga0070675_100000829 3300005354 Bacteria 21856
31 Ga0070671_100068604 3300005355 Bacteria 2958
32 Ga0070673_100002822 3300005364 Bacteria 10684
33 Ga0070673_100079007 3300005364 Bacteria 2663
34 Ga0070688_100033502 3300005365 Bacteria 3106
35 Ga0070659_100002538 3300005366 Bacteria 12980
36 Ga0070667_100006755 3300005367 Bacteria 9529
37 Ga0070667_100281776 3300005367 Bacteria 1492
38 Ga0070709_10065723 3300005434 Bacteria 2323
39 Ga0070709_10105098 3300005434 Bacteria 1888
40 Ga0070713_100003276 3300005436 Bacteria 10670
41 Ga0070711_100051779 3300005439 Unclassified 2822
42 Ga0070705_100261673 3300005440 Bacteria 1220
43 Ga0070663_100143856 3300005455 Bacteria 1823
44 Ga0070678_100094814 3300005456 Bacteria 2298
45 Ga0070662_100001389 3300005457 Bacteria 14908
46 Ga0070681_10001162 3300005458 Bacteria 22701
47 Ga0070681_10298123 3300005458 Bacteria 1522
48 Ga0070685_10004447 3300005466 Bacteria 7089
49 Ga0070698_100071429 3300005471 Bacteria 3481
50 Ga0070679_100001134 3300005530 Bacteria 23290
51 Ga0070684_100036293 3300005535 Bacteria 4224
52 Ga0070684_100054863 3300005535 Unclassified 3473
53 Ga0070697_100085311 3300005536 Bacteria 2605
54 Ga0068853_100025502 3300005539 Bacteria 4961
55 Ga0068853_100234480 3300005539 Bacteria 1680
56 Ga0068853_100280096 3300005539 Bacteria 1537
57 Ga0070686_100021433 3300005544 Bacteria 3841
58 Ga0070695_100042782 3300005545 Bacteria 2877
59 Ga0070693_100003849 3300005547 Bacteria 7033
60 Ga0070665_100222092 3300005548 Bacteria 1890
61 Ga0070665_100263398 3300005548 Bacteria 1725
62 Ga0068855_100051659 3300005563 Bacteria 4842
63 Ga0070664_100047244 3300005564 Bacteria 3636
64 Ga0070664_100224569 3300005564 Bacteria 1681
65 Ga0070664_100362408 3300005564 Bacteria 1320
66 Ga0068857_100001342 3300005577 Bacteria 19388
67 Ga0068857_100005410 3300005577 Bacteria 10889
68 Ga0068857_100035368 3300005577 Bacteria 4424
69 Ga0068857_100212187 3300005577 Bacteria 1767
70 Ga0068857_100252415 3300005577 Bacteria 1617
71 Ga0068856_100002079 3300005614 Bacteria 20770
72 Ga0068856_100004319 3300005614 Bacteria 14184
73 Ga0068856_100034620 3300005614 Unclassified 4946
74 Ga0070702_100000739 3300005615 Bacteria 12365
75 Ga0068859_100000877 3300005617 Bacteria 30669
76 Ga0068859_100001584 3300005617 Bacteria 23196
77 Ga0068859_100003023 3300005617 Bacteria 17051
78 Ga0068864_100009737 3300005618 Bacteria 7926
79 Ga0068851_10043197 3300005834 Bacteria 2271
80 Ga0068870_10016148 3300005840 Bacteria 3561
81 Ga0068863_100002080 3300005841 Bacteria 19842
82 Ga0068863_100002689 3300005841 Bacteria 17573
83 Ga0068863_100124781 3300005841 Bacteria 2456
84 Ga0068858_100007120 3300005842 Bacteria 10861
85 Ga0068860_100001451 3300005843 Bacteria 25672
86 Ga0068860_100126352 3300005843 Bacteria 2451
87 Ga0068860_100274533 3300005843 Bacteria 1646
88 Ga0070717_10009162 3300006028 Bacteria 7438
89 Ga0070717_10203920 3300006028 Bacteria 1733
90 Ga0070712_100043439 3300006175 Unclassified 3094
91 Ga0070712_100180555 3300006175 Bacteria 1644
92 Ga0097621_100004043 3300006237 Bacteria 10174
93 Ga0097621_100054856 3300006237 Bacteria 3252
94 Ga0068871_100020922 3300006358 Bacteria 5018
95 Ga0068871_100026347 3300006358 Bacteria 4535
96 Ga0068871_100044721 3300006358 Unclassified 3563
97 Ga0068871_100142928 3300006358 Bacteria 2036
98 Ga0075428_100081383 3300006844 Bacteria 3534
99 Ga0075430_100081965 3300006846 Bacteria 2703
100 Ga0075431_100048621 3300006847 Bacteria 4375
101 Ga0075433_10020426 3300006852 Bacteria 5537
102 Ga0075434_100048591 3300006871 Bacteria 4210
103 Ga0075434_100140910 3300006871 Bacteria 2431
104 Ga0075429_100024932 3300006880 Bacteria 5192
105 Ga0075429_100200510 3300006880 Bacteria 1748
106 Ga0068865_100084584 3300006881 Bacteria 2286
107 Ga0075436_100023436 3300006914 Bacteria 4240
108 Ga0097620_100000877 3300006931 Bacteria 30669
109 Ga0097620_100001584 3300006931 Bacteria 23196
110 Ga0097620_100003023 3300006931 Bacteria 17051
111 Ga0097620_100012361 3300006931 Bacteria 8586
112 Ga0097620_100295538 3300006931 Bacteria 1713
113 Ga0099794_10026271 3300007265 Bacteria 2690
114 Ga0105240_10033735 3300009093 Bacteria 6609
115 Ga0111539_10001259 3300009094 Bacteria 33782
116 Ga0111539_10248525 3300009094 Bacteria 2071
117 Ga0111539_10407943 3300009094 Bacteria 1582
118 Ga0105245_10001793 3300009098 Bacteria 19550
119 Ga0105245_10002792 3300009098 Bacteria 15712
120 Ga0114129_10042240 3300009147 Bacteria 6419
121 Ga0114129_10067334 3300009147 Bacteria 4994
122 Ga0105241_10015360 3300009174 Bacteria 5607
123 Ga0105241_10027142 3300009174 Unclassified 4262
124 Ga0105241_10031634 3300009174 Bacteria 3962
125 Ga0105242_10004614 3300009176 Bacteria 10680
126 Ga0105242_10091922 3300009176 Bacteria 2555
127 Ga0105248_10001949 3300009177 Bacteria 22933
128 Ga0105248_10019743 3300009177 Bacteria 7462
129 Ga0105248_10042616 3300009177 Bacteria 5091
130 Ga0105248_10670378 3300009177 Bacteria 1170
131 Ga0105237_10004880 3300009545 Bacteria 15363
132 Ga0105238_10005143 3300009551 Bacteria 12932
133 Ga0105239_10009056 3300010375 Bacteria 11264
134 Ga0105239_10075394 3300010375 Bacteria 3709
135 Ga0105246_10000534 3300011119 Bacteria 20787
136 Ga0105246_10034819 3300011119 Unclassified 3359
137 Ga0105246_10191321 3300011119 Unclassified 1584
138 Ga0157373_10003590 3300013100 Bacteria 11719
139 Ga0157370_10315006 3300013104 Bacteria 1444
140 Ga0157369_10001377 3300013105 Bacteria 29939
141 Ga0157369_10003408 3300013105 Bacteria 18846
142 Ga0157369_10053841 3300013105 Bacteria 4347
143 Ga0157374_10001347 3300013296 Bacteria 20902
144 Ga0157374_10002302 3300013296 Bacteria 16089
145 Ga0157374_10004008 3300013296 Bacteria 12378
146 Ga0157374_10294385 3300013296 Bacteria 1605
147 Ga0157378_10073798 3300013297 Unclassified 3068
148 Ga0157378_10290833 3300013297 Unclassified 1578
149 Ga0163162_10006860 3300013306 Bacteria 11048
150 Ga0157372_10000973 3300013307 Bacteria 31256
151 Ga0157372_10012098 3300013307 Bacteria 9191
152 Ga0157372_10057211 3300013307 Bacteria 4359
153 Ga0157372_10275176 3300013307 Bacteria 1957
154 Ga0157375_10013226 3300013308 Bacteria 7337
155 Ga0163163_10010609 3300014325 Bacteria 8298
156 Ga0163163_10019342 3300014325 Bacteria 6394
157 Ga0157377_10001313 3300014745 Bacteria 10635
158 Ga0157377_10141269 3300014745 Bacteria 1480
159 Ga0157376_10330014 3300014969 Bacteria 1453
160 Ga0213872_10020894 3300021361 Unclassified 3016
161 Ga0213876_10122930 3300021384 Unclassified 1378
162 Ga0213875_10000402 3300021388 Bacteria 38119
163 Ga0213875_10002265 3300021388 Bacteria 11669
164 Ga0213875_10009994 3300021388 Unclassified 4775
165 Ga0213875_10012847 3300021388 Bacteria 4125
166 Ga0228598_1014159 3300024227 Bacteria 1578
167 Ga0207425_1000051 3300025245 Bacteria 166795
168 Ga0209129_1000395 3300025258 Bacteria 34881
169 Ga0209025_1000160 3300025294 Bacteria 166795
170 Ga0209758_1000147 3300025297 Bacteria 166795
171 Ga0207680_10017407 3300025903 Bacteria 3797
172 Ga0207705_10093720 3300025909 Bacteria 2202
173 Ga0207684_10092649 3300025910 Bacteria 2576
174 Ga0207654_10066510 3300025911 Bacteria 2126
175 Ga0207654_10080869 3300025911 Bacteria 1955
176 Ga0207654_10127641 3300025911 Bacteria 1606
177 Ga0207707_10003020 3300025912 Bacteria 14960
178 Ga0207695_10035696 3300025913 Bacteria 5386
179 Ga0207671_10017004 3300025914 Bacteria 5628
180 Ga0207663_10005461 3300025916 Bacteria 6403
181 Ga0207660_10030985 3300025917 Bacteria 3680
182 Ga0207657_10020192 3300025919 Bacteria 6302
183 Ga0207657_10164042 3300025919 Bacteria 1803
184 Ga0207649_10037553 3300025920 Bacteria 2926
185 Ga0207649_10097952 3300025920 Unclassified 1935
186 Ga0207652_10008243 3300025921 Bacteria 8371
187 Ga0207694_10010013 3300025924 Bacteria 7146
188 Ga0207650_10003945 3300025925 Bacteria 10149
189 Ga0207650_10268257 3300025925 Bacteria 1387
190 Ga0207650_10351707 3300025925 Bacteria 1212
191 Ga0207659_10001170 3300025926 Bacteria 15652
192 Ga0207659_10003226 3300025926 Bacteria 9753
193 Ga0207659_10025752 3300025926 Bacteria 3958
194 Ga0207687_10041442 3300025927 Bacteria 3162
195 Ga0207700_10004031 3300025928 Bacteria 8600
196 Ga0207664_10005720 3300025929 Bacteria 8501
197 Ga0207690_10027048 3300025932 Bacteria 3621
198 Ga0207690_10163406 3300025932 Bacteria 1662
199 Ga0207706_10030585 3300025933 Bacteria 4802
200 Ga0207670_10090570 3300025936 Bacteria 2161
201 Ga0207670_10120610 3300025936 Bacteria 1905
202 Ga0207711_10004636 3300025941 Bacteria 11681
203 Ga0207711_10153080 3300025941 Bacteria 2082
204 Ga0207689_10001291 3300025942 Bacteria 24137
205 Ga0207661_10003462 3300025944 Bacteria 10960
206 Ga0207661_10028914 3300025944 Bacteria 4250
207 Ga0207679_10000834 3300025945 Bacteria 19827
208 Ga0207667_10028700 3300025949 Bacteria 6041
209 Ga0207667_10101170 3300025949 Bacteria 2973
210 Ga0207667_10164193 3300025949 Bacteria 2283
211 Ga0207658_10002406 3300025986 Bacteria 13701
212 Ga0207703_10022718 3300026035 Bacteria 4926
213 Ga0207702_10018527 3300026078 Bacteria 5760
214 Ga0207702_10034076 3300026078 Bacteria 4255
215 Ga0207702_10037025 3300026078 Bacteria 4082
216 Ga0207702_10174187 3300026078 Bacteria 1976
217 Ga0207641_10062909 3300026088 Bacteria 3168
218 Ga0207641_10099925 3300026088 Unclassified 2554
219 Ga0207676_10002319 3300026095 Bacteria 13655
220 Ga0207674_10001148 3300026116 Bacteria 34315
221 Ga0207674_10011541 3300026116 Bacteria 9923
222 Ga0207674_10016357 3300026116 Bacteria 8123
223 Ga0207674_10105219 3300026116 Bacteria 2800
224 Ga0207683_10090695 3300026121 Bacteria 2722
225 Ga0207698_10019345 3300026142 Bacteria 4660
226 Ga0268264_10037640 3300028381 Bacteria 3989
227 Ga0265337_1035627 3300028556 Bacteria 1457
228 Ga0265318_10001475 3300028577 Bacteria 13762
229 Ga0265323_10000319 3300028653 Bacteria 27903
230 Ga0265323_10000906 3300028653 Bacteria 15674
231 Ga0265336_10000234 3300028666 Bacteria 39696
232 Ga0265324_10000035 3300029957 Bacteria 122758
233 Ga0265332_10027217 3300031238 Bacteria 2505
234 Ga0265325_10001928 3300031241 Bacteria 14315
235 Ga0265339_10000042 3300031249 Bacteria 119235
236 Ga0265316_10000383 3300031344 Bacteria 50345
237 Ga0265316_10002868 3300031344 Bacteria 17647
238 Ga0265316_10013936 3300031344 Bacteria 7112
239 Ga0265316_10205188 3300031344 Bacteria 1460
240 Ga0265313_10003535 3300031595 Bacteria 12599
241 Ga0265314_10000002 3300031711 Bacteria 2092193
242 Ga0265314_10006395 3300031711 Bacteria 10438
243 Ga0265342_10032412 3300031712 Bacteria 3223
244 Ga0265342_10113388 3300031712 Bacteria 1532
245 Ga0373923_0109950 3300035111 Unclassified 1223
246 Ga0373954_0005196 3300035118 Bacteria 5624
247 Ga0373955_0055018 3300035172 Bacteria 2178
248 Ga0373935_0083019 3300035692 Bacteria 2085
249 Ga0373927_0020888 3300035695 Bacteria 4291
250 Ga0373937_0260557 3300036401 Bacteria 1635
251 Ga0373925_0035996 3300037068 Bacteria 3654
252 Ga0373925_0108933 3300037068 Bacteria 2138
253 Ga0436364_0444311 3300037853 Bacteria 16955
254 Ga0436364_0502984 3300037853 Bacteria 2708
255 Ga0436364_0565327 3300037853 Bacteria 10308
256 Ga0436364_0586215 3300037853 Bacteria 68755
257 Ga0436364_0719883 3300037853 Unclassified 1890
258 Ga0436364_0899652 3300037853 Bacteria 84839
259 Ga0436364_1261237 3300037853 Bacteria 4092
260 Ga0436364_1318787 3300037853 Bacteria 5630
261 Ga0436364_1496995 3300037853 Bacteria 2103
262 Ga0436364_1560413 3300037853 Bacteria 14487
263 Ga0436365_0165408 3300039437 Bacteria 30957
264 Ga0436365_0281356 3300039437 Unclassified 1158
265 Ga0436365_0524390 3300039437 Bacteria 4863
266 Ga0436365_1829804 3300039437 Bacteria 2011
267 Ga0436361_0327528 3300039447 Bacteria 75180
268 Ga0436361_0469526 3300039447 Bacteria 1560
269 Ga0436361_0936851 3300039447 Bacteria 2746
270 Ga0436363_1272110 3300039450 Bacteria 9668
271 Ga0451577_0021368 3300042876 Bacteria 5924
272 Ga0451577_0092198 3300042876 Bacteria 2705
273 Ga0451577_0324638 3300042876 Bacteria 1396
274 Ga0466972_0012758 3300044658 Unclassified 4219
275 Ga0453683_0000001 3300044673 Bacteria 1384965
276 Ga0453683_0002609 3300044673 Bacteria 13817
277 Ga0453683_0016260 3300044673 Bacteria 4804
278 Ga0453684_0004411 3300044712 Bacteria 29758
279 Ga0453684_0005338 3300044712 Bacteria 25599
280 Ga0466957_0004788 3300044842 Bacteria 7576
281 Ga0466957_0031812 3300044842 Unclassified 3156
282 Ga0451576_0010023 3300045051 Bacteria 10916
283 Ga0451576_0014757 3300045051 Bacteria 8684
284 Ga0451576_0108697 3300045051 Bacteria 2886
285 Ga0495635_0046930 3300046663 Bacteria 2980
286 Ga0495661_0032871 3300046665 Bacteria 3276
287 Ga0495684_0066260 3300047471 Bacteria 2746
288 Ga0495686_0067981 3300047472 Unclassified 2199
289 Ga0496110_0014366 3300048913 Bacteria 6572
290 Ga0496112_0026678 3300048915 Bacteria 5565
291 Ga0496112_0095140 3300048915 Bacteria 2950
292 Ga0496112_0152510 3300048915 Bacteria 2278
293 Ga0501046_0301936 3300049580 Bacteria 1169
294 Ga0501035_0034592 3300049822 Bacteria 4590
295 Ga0501044_0265662 3300049823 Bacteria 1653
296 nmdc:mga07m45_50327_c1 3300050496 Bacteria 2056
297 nmdc:mga05p37_101702_c1 3300050507 Bacteria 3539
298 nmdc:mga05p37_26525_c1 3300050507 Bacteria 7046
299 nmdc:mga09592_176780_c1 3300050508 Bacteria 1846
300 nmdc:mga09592_33400_c1 3300050508 Bacteria 4294
301 nmdc:mga06r32_193827_c1 3300050510 Bacteria 2019
302 nmdc:mga06r32_263148_c1 3300050510 Bacteria 1712
303 nmdc:mga08y16_590427_c1 3300050511 Bacteria 1120
304 nmdc:mga0n895_25463_c1 3300050512 Bacteria 5590
305 nmdc:mga0n895_351937_c1 3300050512 Bacteria 1492
306 nmdc:mga0rr50_364748_c1 3300050513 Bacteria 1216
307 nmdc:mga08x19_31855_c1 3300050514 Bacteria 3320
308 nmdc:mga0a205_102402_c1 3300050515 Bacteria 2762
309 Ga0500592_010110 3300053116 Bacteria 1502
310 Ga0500559_0007210 3300053136 Bacteria 4944
311 Ga0501082_0000020 3300060353 Bacteria 109889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100113737 Ga0070670_1001137371 337
2 3300006931 Ga0097620_100295538 Ga0097620_1002955381 338
3 3300035111 Ga0373923_0109950 Ga0373923_0109950_42_1073 338
4 3300013296 Ga0157374_10294385 Ga0157374_102943852 345
5 3300048915 Ga0496112_0026678 Ga0496112_0026678_2900_3955 345
6 3300003323 rootH1_10100585 rootH1_101005853 347
7 3300005327 Ga0070658_10054921 Ga0070658_100549212 347
8 3300005330 Ga0070690_100002713 Ga0070690_1000027139 347
9 3300005331 Ga0070670_100011587 Ga0070670_1000115875 347
10 3300005335 Ga0070666_10058098 Ga0070666_100580982 347
11 3300005336 Ga0070680_100005464 Ga0070680_1000054642 347
12 3300005337 Ga0070682_100001051 Ga0070682_1000010515 347
13 3300005339 Ga0070660_100014900 Ga0070660_1000149002 347
14 3300005340 Ga0070689_100114957 Ga0070689_1001149572 347
15 3300005343 Ga0070687_100087998 Ga0070687_1000879981 347
16 3300005344 Ga0070661_100007070 Ga0070661_1000070708 347
17 3300005345 Ga0070692_10001552 Ga0070692_100015524 347
18 3300005355 Ga0070671_100068604 Ga0070671_1000686042 347
19 3300005364 Ga0070673_100079007 Ga0070673_1000790072 347
20 3300005366 Ga0070659_100002538 Ga0070659_1000025382 347
21 3300005367 Ga0070667_100281776 Ga0070667_1002817762 347
22 3300005434 Ga0070709_10105098 Ga0070709_101050981 347
23 3300005455 Ga0070663_100143856 Ga0070663_1001438562 347
24 3300005456 Ga0070678_100094814 Ga0070678_1000948142 347
25 3300005457 Ga0070662_100001389 Ga0070662_10000138913 347
26 3300005458 Ga0070681_10001162 Ga0070681_100011625 347
27 3300005530 Ga0070679_100001134 Ga0070679_10000113412 347
28 3300005535 Ga0070684_100036293 Ga0070684_1000362932 347
29 3300005539 Ga0068853_100025502 Ga0068853_1000255022 347
30 3300005545 Ga0070695_100042782 Ga0070695_1000427822 347
31 3300005547 Ga0070693_100003849 Ga0070693_1000038495 347
32 3300005564 Ga0070664_100047244 Ga0070664_1000472442 347
33 3300005577 Ga0068857_100035368 Ga0068857_1000353682 347
34 3300005614 Ga0068856_100004319 Ga0068856_1000043192 347
35 3300005615 Ga0070702_100000739 Ga0070702_10000073910 347
36 3300005617 Ga0068859_100003023 Ga0068859_10000302321 347
37 3300005618 Ga0068864_100009737 Ga0068864_1000097378 347
38 3300005834 Ga0068851_10043197 Ga0068851_100431972 347
39 3300005840 Ga0068870_10016148 Ga0068870_100161482 347
40 3300005841 Ga0068863_100002080 Ga0068863_10000208014 347
41 3300005842 Ga0068858_100007120 Ga0068858_1000071202 347
42 3300005843 Ga0068860_100274533 Ga0068860_1002745332 347
43 3300006175 Ga0070712_100180555 Ga0070712_1001805551 347
44 3300006237 Ga0097621_100054856 Ga0097621_1000548562 347
45 3300006358 Ga0068871_100026347 Ga0068871_1000263472 347
46 3300006358 Ga0068871_100044721 Ga0068871_1000447213 347
47 3300006358 Ga0068871_100142928 Ga0068871_1001429282 347
48 3300006846 Ga0075430_100081965 Ga0075430_1000819653 347
49 3300006847 Ga0075431_100048621 Ga0075431_1000486212 347
50 3300006871 Ga0075434_100048591 Ga0075434_1000485912 347
51 3300006871 Ga0075434_100140910 Ga0075434_1001409103 347
52 3300006880 Ga0075429_100024932 Ga0075429_1000249323 347
53 3300006880 Ga0075429_100200510 Ga0075429_1002005102 347
54 3300006914 Ga0075436_100023436 Ga0075436_1000234363 347
55 3300006931 Ga0097620_100003023 Ga0097620_10000302321 347
56 3300009094 Ga0111539_10248525 Ga0111539_102485252 347
57 3300009098 Ga0105245_10001793 Ga0105245_1000179313 347
58 3300009174 Ga0105241_10015360 Ga0105241_100153602 347
59 3300009177 Ga0105248_10001949 Ga0105248_1000194912 347
60 3300009177 Ga0105248_10019743 Ga0105248_100197435 347
61 3300009177 Ga0105248_10670378 Ga0105248_106703781 347
62 3300010375 Ga0105239_10075394 Ga0105239_100753942 347
63 3300011119 Ga0105246_10000534 Ga0105246_1000053421 347
64 3300011119 Ga0105246_10191321 Ga0105246_101913211 347
65 3300013100 Ga0157373_10003590 Ga0157373_1000359011 347
66 3300013105 Ga0157369_10053841 Ga0157369_100538412 347
67 3300013296 Ga0157374_10001347 Ga0157374_1000134715 347
68 3300013307 Ga0157372_10000973 Ga0157372_1000097321 347
69 3300013307 Ga0157372_10012098 Ga0157372_100120988 347
70 3300013308 Ga0157375_10013226 Ga0157375_100132264 347
71 3300014325 Ga0163163_10010609 Ga0163163_100106092 347
72 3300014325 Ga0163163_10019342 Ga0163163_100193426 347
73 3300014745 Ga0157377_10001313 Ga0157377_100013133 347
74 3300014969 Ga0157376_10330014 Ga0157376_103300142 347
75 3300021361 Ga0213872_10020894 Ga0213872_100208942 347
76 3300021388 Ga0213875_10012847 Ga0213875_100128473 347
77 3300025909 Ga0207705_10093720 Ga0207705_100937201 347
78 3300025911 Ga0207654_10066510 Ga0207654_100665102 347
79 3300025912 Ga0207707_10003020 Ga0207707_100030202 347
80 3300025917 Ga0207660_10030985 Ga0207660_100309852 347
81 3300025919 Ga0207657_10020192 Ga0207657_100201928 347
82 3300025920 Ga0207649_10037553 Ga0207649_100375532 347
83 3300025921 Ga0207652_10008243 Ga0207652_100082435 347
84 3300025925 Ga0207650_10003945 Ga0207650_100039452 347
85 3300025926 Ga0207659_10025752 Ga0207659_100257524 347
86 3300025927 Ga0207687_10041442 Ga0207687_100414421 347
87 3300025932 Ga0207690_10027048 Ga0207690_100270482 347
88 3300025933 Ga0207706_10030585 Ga0207706_100305855 347
89 3300025936 Ga0207670_10090570 Ga0207670_100905702 347
90 3300025941 Ga0207711_10004636 Ga0207711_1000463613 347
91 3300025942 Ga0207689_10001291 Ga0207689_100012912 347
92 3300025944 Ga0207661_10028914 Ga0207661_100289144 347
93 3300025945 Ga0207679_10000834 Ga0207679_100008345 347
94 3300025949 Ga0207667_10028700 Ga0207667_100287002 347
95 3300026035 Ga0207703_10022718 Ga0207703_100227185 347
96 3300026078 Ga0207702_10034076 Ga0207702_100340762 347
97 3300026088 Ga0207641_10062909 Ga0207641_100629092 347
98 3300026088 Ga0207641_10099925 Ga0207641_100999251 347
99 3300026095 Ga0207676_10002319 Ga0207676_1000231919 347
100 3300026116 Ga0207674_10001148 Ga0207674_1000114827 347
101 3300026121 Ga0207683_10090695 Ga0207683_100906952 347
102 3300026142 Ga0207698_10019345 Ga0207698_100193452 347
103 3300028666 Ga0265336_10000234 Ga0265336_1000023437 347
104 3300029957 Ga0265324_10000035 Ga0265324_10000035163 347
105 3300031238 Ga0265332_10027217 Ga0265332_100272172 347
106 3300031249 Ga0265339_10000042 Ga0265339_1000004241 347
107 3300031344 Ga0265316_10000383 Ga0265316_1000038311 347
108 3300031595 Ga0265313_10003535 Ga0265313_100035356 347
109 3300031711 Ga0265314_10000002 Ga0265314_100000021374 347
110 3300031711 Ga0265314_10006395 Ga0265314_100063956 347
111 3300035118 Ga0373954_0005196 Ga0373954_0005196_915_1982 347
112 3300035172 Ga0373955_0055018 Ga0373955_0055018_1012_2079 347
113 3300035692 Ga0373935_0083019 Ga0373935_0083019_354_1421 347
114 3300036401 Ga0373937_0260557 Ga0373937_0260557_474_1541 347
115 3300037068 Ga0373925_0035996 Ga0373925_0035996_504_1571 347
116 3300037853 Ga0436364_0502984 Ga0436364_0502984_554_1630 347
117 3300039447 Ga0436361_0936851 Ga0436361_0936851_1064_2113 347
118 3300042876 Ga0451577_0021368 Ga0451577_0021368_1819_2871 347
119 3300042876 Ga0451577_0092198 Ga0451577_0092198_648_1703 347
120 3300044673 Ga0453683_0000001 Ga0453683_0000001_552234_553292 347
121 3300044673 Ga0453683_0002609 Ga0453683_0002609_1468_2520 347
122 3300044673 Ga0453683_0016260 Ga0453683_0016260_2357_3412 347
123 3300044712 Ga0453684_0004411 Ga0453684_0004411_22533_23588 347
124 3300044712 Ga0453684_0005338 Ga0453684_0005338_13250_14302 347
125 3300045051 Ga0451576_0010023 Ga0451576_0010023_8284_9342 347
126 3300045051 Ga0451576_0108697 Ga0451576_0108697_930_1985 347
127 3300046663 Ga0495635_0046930 Ga0495635_0046930_1655_2722 347
128 3300047471 Ga0495684_0066260 Ga0495684_0066260_78_1145 347
129 3300047472 Ga0495686_0067981 Ga0495686_0067981_620_1672 347
130 3300048915 Ga0496112_0095140 Ga0496112_0095140_1244_2293 347
131 3300049580 Ga0501046_0301936 Ga0501046_0301936_47_1102 347
132 3300049822 Ga0501035_0034592 Ga0501035_0034592_555_1607 347
133 3300049823 Ga0501044_0265662 Ga0501044_0265662_269_1321 347
134 3300050508 nmdc:mga09592_176780_c1 nmdc:mga09592_176780_c1_96_1154 347
135 3300050510 nmdc:mga06r32_193827_c1 nmdc:mga06r32_193827_c1_415_1467 347
136 3300050510 nmdc:mga06r32_263148_c1 nmdc:mga06r32_263148_c1_413_1471 347
137 3300050512 nmdc:mga0n895_351937_c1 nmdc:mga0n895_351937_c1_267_1331 347
138 3300050514 nmdc:mga08x19_31855_c1 nmdc:mga08x19_31855_c1_1205_2269 347
139 3300053136 Ga0500559_0007210 Ga0500559_0007210_944_2008 347
140 3300005471 Ga0070698_100071429 Ga0070698_1000714293 348
141 3300005536 Ga0070697_100085311 Ga0070697_1000853111 348
142 3300025910 Ga0207684_10092649 Ga0207684_100926492 348
143 3300028556 Ga0265337_1035627 Ga0265337_10356271 348
144 3300028577 Ga0265318_10001475 Ga0265318_1000147511 348
145 3300028653 Ga0265323_10000319 Ga0265323_1000031916 348
146 3300031344 Ga0265316_10002868 Ga0265316_1000286814 348
147 3300035695 Ga0373927_0020888 Ga0373927_0020888_746_1822 348
148 3300037068 Ga0373925_0108933 Ga0373925_0108933_153_1229 348
149 3300044842 Ga0466957_0031812 Ga0466957_0031812_1245_2336 348
150 3300002773 JGI25152J39213_1000253 JGI25152J39213_10002534 349
151 3300002774 JGI25150J39212_1000186 JGI25150J39212_100018631 349
152 3300003187 JGI25151J46595_10000543 JGI25151J46595_1000054331 349
153 3300003215 JGI25153J46596_10000323 JGI25153J46596_1000032331 349
154 3300003320 rootH2_10153962 rootH2_101539622 349
155 3300003323 rootH1_10064251 rootH1_1006425119 349
156 3300003323 rootH1_10383638 rootH1_103836382 349
157 3300005330 Ga0070690_100015200 Ga0070690_1000152004 349
158 3300005331 Ga0070670_100251393 Ga0070670_1002513931 349
159 3300005331 Ga0070670_100400116 Ga0070670_1004001161 349
160 3300005335 Ga0070666_10244183 Ga0070666_102441831 349
161 3300005339 Ga0070660_100162322 Ga0070660_1001623221 349
162 3300005340 Ga0070689_100143712 Ga0070689_1001437122 349
163 3300005340 Ga0070689_100148464 Ga0070689_1001484642 349
164 3300005340 Ga0070689_100188901 Ga0070689_1001889012 349
165 3300005354 Ga0070675_100000185 Ga0070675_10000018532 349
166 3300005354 Ga0070675_100000829 Ga0070675_1000008299 349
167 3300005364 Ga0070673_100002822 Ga0070673_1000028223 349
168 3300005365 Ga0070688_100033502 Ga0070688_1000335021 349
169 3300005367 Ga0070667_100006755 Ga0070667_1000067554 349
170 3300005434 Ga0070709_10065723 Ga0070709_100657232 349
171 3300005436 Ga0070713_100003276 Ga0070713_1000032764 349
172 3300005439 Ga0070711_100051779 Ga0070711_1000517792 349
173 3300005440 Ga0070705_100261673 Ga0070705_1002616731 349
174 3300005458 Ga0070681_10298123 Ga0070681_102981231 349
175 3300005466 Ga0070685_10004447 Ga0070685_100044473 349
176 3300005535 Ga0070684_100054863 Ga0070684_1000548631 349
177 3300005539 Ga0068853_100234480 Ga0068853_1002344802 349
178 3300005539 Ga0068853_100280096 Ga0068853_1002800962 349
179 3300005544 Ga0070686_100021433 Ga0070686_1000214332 349
180 3300005548 Ga0070665_100222092 Ga0070665_1002220922 349
181 3300005548 Ga0070665_100263398 Ga0070665_1002633981 349
182 3300005563 Ga0068855_100051659 Ga0068855_1000516592 349
183 3300005564 Ga0070664_100224569 Ga0070664_1002245692 349
184 3300005564 Ga0070664_100362408 Ga0070664_1003624081 349
185 3300005577 Ga0068857_100001342 Ga0068857_1000013428 349
186 3300005577 Ga0068857_100005410 Ga0068857_1000054107 349
187 3300005577 Ga0068857_100212187 Ga0068857_1002121872 349
188 3300005577 Ga0068857_100252415 Ga0068857_1002524152 349
189 3300005614 Ga0068856_100002079 Ga0068856_1000020795 349
190 3300005614 Ga0068856_100034620 Ga0068856_1000346203 349
191 3300005617 Ga0068859_100000877 Ga0068859_1000008776 349
192 3300005617 Ga0068859_100001584 Ga0068859_1000015845 349
193 3300005841 Ga0068863_100002689 Ga0068863_10000268915 349
194 3300005841 Ga0068863_100124781 Ga0068863_1001247812 349
195 3300005843 Ga0068860_100001451 Ga0068860_10000145122 349
196 3300005843 Ga0068860_100126352 Ga0068860_1001263521 349
197 3300006028 Ga0070717_10009162 Ga0070717_100091626 349
198 3300006028 Ga0070717_10203920 Ga0070717_102039202 349
199 3300006175 Ga0070712_100043439 Ga0070712_1000434393 349
200 3300006237 Ga0097621_100004043 Ga0097621_1000040433 349
201 3300006358 Ga0068871_100020922 Ga0068871_1000209223 349
202 3300006844 Ga0075428_100081383 Ga0075428_1000813833 349
203 3300006852 Ga0075433_10020426 Ga0075433_100204265 349
204 3300006881 Ga0068865_100084584 Ga0068865_1000845843 349
205 3300006931 Ga0097620_100000877 Ga0097620_10000087722 349
206 3300006931 Ga0097620_100001584 Ga0097620_1000015845 349
207 3300006931 Ga0097620_100012361 Ga0097620_1000123618 349
208 3300007265 Ga0099794_10026271 Ga0099794_100262713 349
209 3300009093 Ga0105240_10033735 Ga0105240_100337355 349
210 3300009094 Ga0111539_10001259 Ga0111539_1000125929 349
211 3300009094 Ga0111539_10407943 Ga0111539_104079432 349
212 3300009098 Ga0105245_10002792 Ga0105245_100027927 349
213 3300009147 Ga0114129_10042240 Ga0114129_100422404 349
214 3300009147 Ga0114129_10067334 Ga0114129_100673344 349
215 3300009174 Ga0105241_10027142 Ga0105241_100271423 349
216 3300009174 Ga0105241_10031634 Ga0105241_100316343 349
217 3300009176 Ga0105242_10004614 Ga0105242_100046148 349
218 3300009176 Ga0105242_10091922 Ga0105242_100919222 349
219 3300009177 Ga0105248_10042616 Ga0105248_100426163 349
220 3300009545 Ga0105237_10004880 Ga0105237_1000488011 349
221 3300009551 Ga0105238_10005143 Ga0105238_100051437 349
222 3300010375 Ga0105239_10009056 Ga0105239_100090568 349
223 3300011119 Ga0105246_10034819 Ga0105246_100348193 349
224 3300013104 Ga0157370_10315006 Ga0157370_103150062 349
225 3300013105 Ga0157369_10001377 Ga0157369_1000137715 349
226 3300013105 Ga0157369_10003408 Ga0157369_100034083 349
227 3300013296 Ga0157374_10002302 Ga0157374_100023027 349
228 3300013296 Ga0157374_10004008 Ga0157374_100040087 349
229 3300013297 Ga0157378_10073798 Ga0157378_100737983 349
230 3300013297 Ga0157378_10290833 Ga0157378_102908331 349
231 3300013306 Ga0163162_10006860 Ga0163162_100068605 349
232 3300013307 Ga0157372_10057211 Ga0157372_100572115 349
233 3300013307 Ga0157372_10275176 Ga0157372_102751762 349
234 3300014745 Ga0157377_10141269 Ga0157377_101412691 349
235 3300021384 Ga0213876_10122930 Ga0213876_101229301 349
236 3300021388 Ga0213875_10000402 Ga0213875_1000040220 349
237 3300021388 Ga0213875_10002265 Ga0213875_100022658 349
238 3300021388 Ga0213875_10009994 Ga0213875_100099942 349
239 3300024227 Ga0228598_1014159 Ga0228598_10141592 349
240 3300025245 Ga0207425_1000051 Ga0207425_10000514 349
241 3300025258 Ga0209129_1000395 Ga0209129_100039531 349
242 3300025294 Ga0209025_1000160 Ga0209025_1000160154 349
243 3300025297 Ga0209758_1000147 Ga0209758_1000147154 349
244 3300025903 Ga0207680_10017407 Ga0207680_100174074 349
245 3300025911 Ga0207654_10080869 Ga0207654_100808692 349
246 3300025911 Ga0207654_10127641 Ga0207654_101276412 349
247 3300025913 Ga0207695_10035696 Ga0207695_100356964 349
248 3300025914 Ga0207671_10017004 Ga0207671_100170042 349
249 3300025916 Ga0207663_10005461 Ga0207663_100054615 349
250 3300025919 Ga0207657_10164042 Ga0207657_101640421 349
251 3300025920 Ga0207649_10097952 Ga0207649_100979522 349
252 3300025924 Ga0207694_10010013 Ga0207694_1001001310 349
253 3300025925 Ga0207650_10268257 Ga0207650_102682571 349
254 3300025925 Ga0207650_10351707 Ga0207650_103517071 349
255 3300025926 Ga0207659_10001170 Ga0207659_1000117010 349
256 3300025926 Ga0207659_10003226 Ga0207659_100032264 349
257 3300025928 Ga0207700_10004031 Ga0207700_100040315 349
258 3300025929 Ga0207664_10005720 Ga0207664_100057204 349
259 3300025932 Ga0207690_10163406 Ga0207690_101634062 349
260 3300025936 Ga0207670_10120610 Ga0207670_101206102 349
261 3300025941 Ga0207711_10153080 Ga0207711_101530802 349
262 3300025944 Ga0207661_10003462 Ga0207661_100034622 349
263 3300025949 Ga0207667_10101170 Ga0207667_101011702 349
264 3300025949 Ga0207667_10164193 Ga0207667_101641932 349
265 3300025986 Ga0207658_10002406 Ga0207658_100024064 349
266 3300026078 Ga0207702_10018527 Ga0207702_100185275 349
267 3300026078 Ga0207702_10037025 Ga0207702_100370252 349
268 3300026078 Ga0207702_10174187 Ga0207702_101741871 349
269 3300026116 Ga0207674_10011541 Ga0207674_100115417 349
270 3300026116 Ga0207674_10016357 Ga0207674_100163575 349
271 3300026116 Ga0207674_10105219 Ga0207674_101052194 349
272 3300028381 Ga0268264_10037640 Ga0268264_100376403 349
273 3300028653 Ga0265323_10000906 Ga0265323_100009065 349
274 3300031241 Ga0265325_10001928 Ga0265325_1000192812 349
275 3300031344 Ga0265316_10013936 Ga0265316_100139369 349
276 3300031344 Ga0265316_10205188 Ga0265316_102051882 349
277 3300031712 Ga0265342_10032412 Ga0265342_100324123 349
278 3300031712 Ga0265342_10113388 Ga0265342_101133881 349
279 3300037853 Ga0436364_0444311 Ga0436364_0444311_474_1547 349
280 3300037853 Ga0436364_0565327 Ga0436364_0565327_3319_4413 349
281 3300037853 Ga0436364_0586215 Ga0436364_0586215_47890_48981 349
282 3300037853 Ga0436364_0719883 Ga0436364_0719883_726_1802 349
283 3300037853 Ga0436364_0899652 Ga0436364_0899652_78036_79112 349
284 3300037853 Ga0436364_1261237 Ga0436364_1261237_1217_2308 349
285 3300037853 Ga0436364_1318787 Ga0436364_1318787_4177_5265 349
286 3300037853 Ga0436364_1496995 Ga0436364_1496995_752_1840 349
287 3300037853 Ga0436364_1560413 Ga0436364_1560413_11627_12715 349
288 3300039437 Ga0436365_0165408 Ga0436365_0165408_6397_7476 349
289 3300039437 Ga0436365_0281356 Ga0436365_0281356_36_1127 349
290 3300039437 Ga0436365_0524390 Ga0436365_0524390_1108_2190 349
291 3300039437 Ga0436365_1829804 Ga0436365_1829804_118_1188 349
292 3300039447 Ga0436361_0327528 Ga0436361_0327528_60477_61646 349
293 3300039447 Ga0436361_0469526 Ga0436361_0469526_249_1346 349
294 3300039450 Ga0436363_1272110 Ga0436363_1272110_7375_8454 349
295 3300042876 Ga0451577_0324638 Ga0451577_0324638_37_1107 349
296 3300044658 Ga0466972_0012758 Ga0466972_0012758_427_1527 349
297 3300044842 Ga0466957_0004788 Ga0466957_0004788_6107_7171 349
298 3300045051 Ga0451576_0014757 Ga0451576_0014757_7101_8162 349
299 3300046665 Ga0495661_0032871 Ga0495661_0032871_821_1876 349
300 3300048913 Ga0496110_0014366 Ga0496110_0014366_4049_5116 349
301 3300048915 Ga0496112_0152510 Ga0496112_0152510_811_1899 349
302 3300050496 nmdc:mga07m45_50327_c1 nmdc:mga07m45_50327_c1_398_1465 349
303 3300050507 nmdc:mga05p37_101702_c1 nmdc:mga05p37_101702_c1_174_1280 349
304 3300050507 nmdc:mga05p37_26525_c1 nmdc:mga05p37_26525_c1_4229_5290 349
305 3300050508 nmdc:mga09592_33400_c1 nmdc:mga09592_33400_c1_2040_3146 349
306 3300050511 nmdc:mga08y16_590427_c1 nmdc:mga08y16_590427_c1_38_1102 349
307 3300050512 nmdc:mga0n895_25463_c1 nmdc:mga0n895_25463_c1_1455_2561 349
308 3300050513 nmdc:mga0rr50_364748_c1 nmdc:mga0rr50_364748_c1_26_1084 349
309 3300050515 nmdc:mga0a205_102402_c1 nmdc:mga0a205_102402_c1_549_1610 349
310 3300053116 Ga0500592_010110 Ga0500592_010110_140_1195 349
311 3300060353 Ga0501082_0000020 Ga0501082_0000020_8601_9662 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

170

0.9

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

4

283

0.89

PF00106

adh_short

short chain dehydrogenase

2

132

0.84

PF07993

NAD_binding_4

Male sterility protein

51

264

0.8

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

5

267

0.79

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

4

148

0.77

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

5

350

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1orr-assembly3.cif.gz_C crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.9282 3 344
1orr-assembly1.cif.gz_A crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.9255 3 347
1orr-assembly2.cif.gz_D crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.9224 3 344
1orr-assembly1.cif.gz_A crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.9176 3 347
1orr-assembly3.cif.gz_C crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.9123 3 344
ID Description Score Start End Superfamily
1orrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9224 3 344 3.40.50.720
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.909 1 348 3.40.50.720
1orrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9066 3 344 3.40.50.720
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8926 1 348 3.40.50.720
2pzkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8862 3 348 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6J4JJD0-F1-model_v4 dTDP-glucose 4,6-dehydratase (EC 4.2.1.46) 0.9808 1 109 GO:0008460
AF-A0A5B1CMT2-F1-model_v4 CDP-paratose 2-epimerase (EC 5.1.3.10) 0.9773 2 348 GO:0047732
AF-A0A519YQM3-F1-model_v4 NAD-dependent epimerase 0.9768 224 349
AF-A0A850Q6N9-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9766 1 272
AF-A0A358ENP8-F1-model_v4 NAD-dependent epimerase 0.9749 95 348

Feature Viewer

pLDDT pTM Quality
89.92 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map