F401273

General Info

Members Datasets Scaffolds Average Seq Length
311 162 310 303

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10027517|Ga0265331_100275173
Length 317
Sequence MTLRLAFLGTPDFAVPTLAELIGQGHDIACVYSQPPRPKGRGLGTEPSPVHALALAHKIAVRTPASLKGAAEQAEFAALNLDAAIVVAYGLILPKPILDAPRLGCFNLHGSLLPRWRGAAPIQRAIMAGDAQTGVMTMRMEEGLDTGPVLMAERTPIARKTYGELHDELARLGADLMARTLAALERGSVTETPQSAEGVTYAKKILKEETRIDWSRPAHEIDCLIRGLSPAPGAWSEAKGERIKVLNCTPVSGSGLPGTIIDDALTVACGPASSSEAVGQTEKTGLRLTRLQRPGKSAMDATELLRGFALPAGTIFV

Samples

Sample ID Description Type Environment
1 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
159 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
160 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0
Rhizoplane 0.32
Rhizosphere 94.21
Stem 0
Stem Tuber 0
Unclassified 3.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000812 3300003215 Bacteria 19097
2 rootH2_10006890 3300003320 Bacteria 23032
3 Ga0070690_100081777 3300005330 Bacteria 2114
4 Ga0070680_100000332 3300005336 Bacteria 31618
5 Ga0068868_100098636 3300005338 Bacteria 2362
6 Ga0070671_100421082 3300005355 Bacteria 1144
7 Ga0070709_10092233 3300005434 Bacteria 2000
8 Ga0070714_100003461 3300005435 Bacteria 11767
9 Ga0070714_100041533 3300005435 Bacteria 3882
10 Ga0070713_100000006 3300005436 Bacteria 190565
11 Ga0070713_100083878 3300005436 Bacteria 2725
12 Ga0070711_100077287 3300005439 Bacteria 2362
13 Ga0070678_100059713 3300005456 Bacteria 2804
14 Ga0070681_10000123 3300005458 Bacteria 57938
15 Ga0068867_100008764 3300005459 Bacteria 7142
16 Ga0070685_10014107 3300005466 Bacteria 4226
17 Ga0070699_100545560 3300005518 Bacteria 1055
18 Ga0070679_100000490 3300005530 Bacteria 33743
19 Ga0070679_100068194 3300005530 Bacteria 3548
20 Ga0070665_100043121 3300005548 Bacteria 4535
21 Ga0070665_100043691 3300005548 Bacteria 4502
22 Ga0070665_100060645 3300005548 Bacteria 3792
23 Ga0070665_100337983 3300005548 Bacteria 1510
24 Ga0068855_100000529 3300005563 Bacteria 46748
25 Ga0068855_100107220 3300005563 Bacteria 3210
26 Ga0068855_100107743 3300005563 Bacteria 3201
27 Ga0068856_100000280 3300005614 Bacteria 55488
28 Ga0068852_100085023 3300005616 Bacteria 2817
29 Ga0068852_100124144 3300005616 Bacteria 2368
30 Ga0068859_100622302 3300005617 Bacteria 1172
31 Ga0068864_100530568 3300005618 Bacteria 1136
32 Ga0068858_100008268 3300005842 Bacteria 10001
33 Ga0068858_100017472 3300005842 Bacteria 6729
34 Ga0068860_100044968 3300005843 Bacteria 4208
35 Ga0068860_100090247 3300005843 Bacteria 2919
36 Ga0068862_100082008 3300005844 Bacteria 2798
37 Ga0070715_10096392 3300006163 Bacteria 1371
38 Ga0070716_100018499 3300006173 Bacteria 3632
39 Ga0070712_100000528 3300006175 Bacteria 22081
40 Ga0070712_100050085 3300006175 Bacteria 2904
41 Ga0097621_100000267 3300006237 Bacteria 35345
42 Ga0097621_100008216 3300006237 Bacteria 7507
43 Ga0097621_100115090 3300006237 Bacteria 2276
44 Ga0068871_100002164 3300006358 Bacteria 13334
45 Ga0068871_100003594 3300006358 Bacteria 10654
46 Ga0068871_100005709 3300006358 Bacteria 8736
47 Ga0068871_100031940 3300006358 Bacteria 4154
48 Ga0068871_100079996 3300006358 Bacteria 2705
49 Ga0068871_100480233 3300006358 Bacteria 1118
50 Ga0075428_100040069 3300006844 Bacteria 5155
51 Ga0075430_100059850 3300006846 Bacteria 3201
52 Ga0075431_100045135 3300006847 Bacteria 4544
53 Ga0075434_100033117 3300006871 Bacteria 5099
54 Ga0075429_100045890 3300006880 Bacteria 3801
55 Ga0068865_100005263 3300006881 Bacteria 7824
56 Ga0075436_100000054 3300006914 Bacteria 68580
57 Ga0097620_100622417 3300006931 Bacteria 1172
58 Ga0075435_100059834 3300007076 Bacteria 3088
59 Ga0105240_10000055 3300009093 Bacteria 225380
60 Ga0105240_10029678 3300009093 Bacteria 7117
61 Ga0105240_10093873 3300009093 Bacteria 3661
62 Ga0111539_10004331 3300009094 Bacteria 18575
63 Ga0111539_10158633 3300009094 Bacteria 2647
64 Ga0111539_10424651 3300009094 Bacteria 1548
65 Ga0114129_10080440 3300009147 Bacteria 4529
66 Ga0105241_10010268 3300009174 Bacteria 6877
67 Ga0105241_10015241 3300009174 Bacteria 5629
68 Ga0105241_10074868 3300009174 Bacteria 2637
69 Ga0105241_10192385 3300009174 Bacteria 1699
70 Ga0105241_10300994 3300009174 Bacteria 1376
71 Ga0105242_10075479 3300009176 Bacteria 2807
72 Ga0105242_10176788 3300009176 Bacteria 1880
73 Ga0105242_10423633 3300009176 Bacteria 1248
74 Ga0105248_10151260 3300009177 Bacteria 2618
75 Ga0105248_10600522 3300009177 Bacteria 1242
76 Ga0105237_10013620 3300009545 Bacteria 8518
77 Ga0105237_10076913 3300009545 Bacteria 3327
78 Ga0105237_10203045 3300009545 Bacteria 1982
79 Ga0105238_10042693 3300009551 Bacteria 4591
80 Ga0105238_10056673 3300009551 Bacteria 3931
81 Ga0105249_10127696 3300009553 Bacteria 2423
82 Ga0105239_10003373 3300010375 Bacteria 19598
83 Ga0105239_10012800 3300010375 Bacteria 9333
84 Ga0105239_10029869 3300010375 Bacteria 5994
85 Ga0105239_10116855 3300010375 Bacteria 2960
86 Ga0157371_10180849 3300013102 Bacteria 1508
87 Ga0157370_10037455 3300013104 Bacteria 4701
88 Ga0157369_10004952 3300013105 Bacteria 15601
89 Ga0157369_10012565 3300013105 Bacteria 9606
90 Ga0157369_10359592 3300013105 Bacteria 1512
91 Ga0157374_10330936 3300013296 Bacteria 1511
92 Ga0157372_10048506 3300013307 Bacteria 4721
93 Ga0157372_10064258 3300013307 Bacteria 4118
94 Ga0157372_10160721 3300013307 Bacteria 2596
95 Ga0157375_10007944 3300013308 Bacteria 9288
96 Ga0157379_10000304 3300014968 Bacteria 38893
97 Ga0157379_10003277 3300014968 Bacteria 13713
98 Ga0157379_10047178 3300014968 Bacteria 3843
99 Ga0157379_10210254 3300014968 Bacteria 1761
100 Ga0157376_10012134 3300014969 Bacteria 6383
101 Ga0157376_10229636 3300014969 Bacteria 1723
102 Ga0157376_10388635 3300014969 Bacteria 1346
103 Ga0213872_10081819 3300021361 Bacteria 1450
104 Ga0213876_10000322 3300021384 Bacteria 41914
105 Ga0213876_10161752 3300021384 Bacteria 1191
106 Ga0209758_1000008 3300025297 Bacteria 1215263
107 Ga0207680_10010864 3300025903 Bacteria 4574
108 Ga0207685_10064476 3300025905 Bacteria 1463
109 Ga0207699_10007037 3300025906 Bacteria 5480
110 Ga0207699_10244801 3300025906 Bacteria 1234
111 Ga0207643_10040115 3300025908 Bacteria 2635
112 Ga0207705_10000039 3300025909 Bacteria 193592
113 Ga0207705_10004807 3300025909 Bacteria 10169
114 Ga0207705_10398455 3300025909 Bacteria 1064
115 Ga0207654_10016400 3300025911 Bacteria 3858
116 Ga0207654_10066821 3300025911 Bacteria 2122
117 Ga0207707_10000002 3300025912 Bacteria 1142054
118 Ga0207707_10045222 3300025912 Bacteria 3837
119 Ga0207695_10000012 3300025913 Bacteria 840961
120 Ga0207695_10021214 3300025913 Bacteria 7418
121 Ga0207695_10056927 3300025913 Bacteria 4065
122 Ga0207695_10066090 3300025913 Bacteria 3716
123 Ga0207695_10104727 3300025913 Bacteria 2817
124 Ga0207671_10049711 3300025914 Bacteria 3104
125 Ga0207693_10001101 3300025915 Bacteria 24280
126 Ga0207693_10118085 3300025915 Bacteria 2083
127 Ga0207660_10001154 3300025917 Bacteria 17638
128 Ga0207660_10108556 3300025917 Bacteria 2084
129 Ga0207657_10001376 3300025919 Bacteria 25943
130 Ga0207657_10132438 3300025919 Bacteria 2043
131 Ga0207652_10000197 3300025921 Bacteria 63525
132 Ga0207652_10106033 3300025921 Bacteria 2487
133 Ga0207652_10152077 3300025921 Bacteria 2073
134 Ga0207694_10000006 3300025924 Bacteria 631109
135 Ga0207694_10233105 3300025924 Bacteria 1504
136 Ga0207700_10000199 3300025928 Bacteria 35835
137 Ga0207664_10005455 3300025929 Bacteria 8697
138 Ga0207664_10031986 3300025929 Bacteria 4030
139 Ga0207686_10001631 3300025934 Bacteria 12536
140 Ga0207686_10005045 3300025934 Bacteria 7104
141 Ga0207686_10057844 3300025934 Bacteria 2442
142 Ga0207704_10003734 3300025938 Bacteria 6930
143 Ga0207665_10010411 3300025939 Bacteria 6108
144 Ga0207711_10012518 3300025941 Bacteria 7050
145 Ga0207711_10083611 3300025941 Bacteria 2792
146 Ga0207689_10087738 3300025942 Bacteria 2555
147 Ga0207667_10000026 3300025949 Bacteria 343713
148 Ga0207667_10076870 3300025949 Bacteria 3463
149 Ga0207667_10184057 3300025949 Bacteria 2145
150 Ga0207667_10357920 3300025949 Bacteria 1488
151 Ga0207712_10087745 3300025961 Bacteria 2282
152 Ga0207703_10009085 3300026035 Bacteria 7825
153 Ga0207703_10026856 3300026035 Bacteria 4534
154 Ga0207639_10002226 3300026041 Bacteria 13061
155 Ga0207702_10000030 3300026078 Bacteria 178718
156 Ga0207648_10017453 3300026089 Bacteria 6530
157 Ga0207676_10062505 3300026095 Bacteria 2954
158 Ga0207676_10081269 3300026095 Bacteria 2633
159 Ga0207674_10410342 3300026116 Bacteria 1309
160 Ga0207683_10004248 3300026121 Bacteria 12363
161 Ga0207698_10020614 3300026142 Bacteria 4541
162 Ga0207698_10315013 3300026142 Bacteria 1463
163 Ga0207428_10010133 3300027907 Bacteria 8429
164 Ga0268266_10001271 3300028379 Bacteria 30810
165 Ga0268266_10018413 3300028379 Bacteria 5951
166 Ga0268266_10023951 3300028379 Bacteria 5195
167 Ga0268266_10417342 3300028379 Bacteria 1271
168 Ga0268265_10079847 3300028380 Bacteria 2578
169 Ga0265337_1005006 3300028556 Bacteria 5372
170 Ga0265334_10000673 3300028573 Bacteria 17152
171 Ga0265318_10000388 3300028577 Bacteria 34328
172 Ga0265338_10000011 3300028800 Bacteria 433370
173 Ga0265338_10053861 3300028800 Bacteria 3594
174 Ga0265338_10054811 3300028800 Bacteria 3552
175 Ga0265338_10116885 3300028800 Bacteria 2135
176 Ga0265332_10023683 3300031238 Bacteria 2707
177 Ga0265332_10031076 3300031238 Bacteria 2330
178 Ga0265320_10000123 3300031240 Bacteria 67449
179 Ga0265325_10000002 3300031241 Bacteria 396758
180 Ga0265325_10000027 3300031241 Bacteria 106598
181 Ga0265325_10003234 3300031241 Bacteria 10725
182 Ga0265325_10012113 3300031241 Bacteria 4938
183 Ga0265340_10001015 3300031247 Bacteria 15989
184 Ga0265340_10024675 3300031247 Bacteria 3052
185 Ga0265339_10001651 3300031249 Bacteria 16451
186 Ga0265339_10002449 3300031249 Bacteria 13290
187 Ga0265339_10006481 3300031249 Bacteria 7675
188 Ga0265331_10000049 3300031250 Bacteria 182618
189 Ga0265331_10000303 3300031250 Bacteria 53811
190 Ga0265331_10001113 3300031250 Bacteria 20686
191 Ga0265331_10027517 3300031250 Bacteria 2849
192 Ga0265331_10108658 3300031250 Bacteria 1273
193 Ga0265327_10000007 3300031251 Bacteria 678515
194 Ga0265316_10001218 3300031344 Bacteria 27729
195 Ga0265316_10021855 3300031344 Bacteria 5409
196 Ga0265316_10258948 3300031344 Bacteria 1276
197 Ga0265313_10000335 3300031595 Bacteria 51231
198 Ga0265313_10002380 3300031595 Bacteria 16332
199 Ga0265313_10030370 3300031595 Bacteria 2783
200 Ga0265313_10035577 3300031595 Bacteria 2507
201 Ga0265313_10086523 3300031595 Bacteria 1414
202 Ga0265314_10006838 3300031711 Bacteria 9992
203 Ga0265314_10068020 3300031711 Bacteria 2396
204 Ga0265314_10167057 3300031711 Bacteria 1332
205 Ga0265342_10005469 3300031712 Bacteria 9668
206 Ga0307516_10015652 3300031730 Bacteria 7973
207 Ga0307516_10032700 3300031730 Bacteria 5238
208 Ga0307516_10060168 3300031730 Bacteria 3691
209 Ga0373931_0023557 3300035691 Bacteria 3110
210 Ga0373931_0032643 3300035691 Bacteria 2695
211 Ga0373933_0207712 3300035724 Bacteria 1254
212 Ga0373937_0000338 3300036401 Bacteria 44355
213 Ga0373937_0028314 3300036401 Bacteria 5069
214 Ga0373937_0136946 3300036401 Bacteria 2290
215 Ga0436365_0618382 3300039437 Bacteria 4182
216 Ga0436363_0468218 3300039450 Bacteria 2878
217 Ga0436363_1184338 3300039450 Bacteria 22162
218 Ga0439441_034981 3300042001 Bacteria 988
219 Ga0466967_0220465 3300045976 Bacteria 1802
220 Ga0495654_0060887 3300046530 Bacteria 1814
221 Ga0495658_0063790 3300046683 Bacteria 2121
222 Ga0495624_0062346 3300046690 Bacteria 2333
223 Ga0495672_0003016 3300047320 Bacteria 14808
224 Ga0496107_0212188 3300048910 Bacteria 1440
225 Ga0496126_0001104 3300048929 Bacteria 45291
226 Ga0501032_0045954 3300049569 Bacteria 2952
227 Ga0501033_0028926 3300049570 Bacteria 4164
228 Ga0501033_0057077 3300049570 Bacteria 2886
229 Ga0501033_0139260 3300049570 Bacteria 1755
230 Ga0501034_0056365 3300049571 Bacteria 3954
231 Ga0501034_0183114 3300049571 Bacteria 2059
232 Ga0501036_0014554 3300049572 Bacteria 6550
233 Ga0501036_0189156 3300049572 Bacteria 1732
234 Ga0501036_0252466 3300049572 Bacteria 1478
235 Ga0501036_0293245 3300049572 Bacteria 1361
236 Ga0501037_0007669 3300049573 Bacteria 7898
237 Ga0501037_0223685 3300049573 Bacteria 1323
238 Ga0501037_0274489 3300049573 Bacteria 1176
239 Ga0501038_0015099 3300049574 Bacteria 7028
240 Ga0501038_0043065 3300049574 Bacteria 3928
241 Ga0501038_0061785 3300049574 Bacteria 3203
242 Ga0501038_0215671 3300049574 Bacteria 1533
243 Ga0501039_0018692 3300049575 Bacteria 5319
244 Ga0501039_0049833 3300049575 Bacteria 3239
245 Ga0501043_0026016 3300049579 Bacteria 4591
246 Ga0501043_0092184 3300049579 Bacteria 2382
247 Ga0501043_0416990 3300049579 Bacteria 1013
248 Ga0501046_0045826 3300049580 Bacteria 3471
249 Ga0501046_0070170 3300049580 Bacteria 2725
250 Ga0501047_0003568 3300049581 Bacteria 14687
251 Ga0501047_0036811 3300049581 Bacteria 4730
252 Ga0501047_0054946 3300049581 Bacteria 3851
253 Ga0501047_0088235 3300049581 Bacteria 2978
254 Ga0501047_0133864 3300049581 Bacteria 2359
255 Ga0501047_0231831 3300049581 Bacteria 1699
256 Ga0501048_0024593 3300049582 Bacteria 4395
257 Ga0501048_0078181 3300049582 Bacteria 2335
258 Ga0501067_0006462 3300049583 Bacteria 6497
259 Ga0501067_0095220 3300049583 Bacteria 1653
260 Ga0501068_0068097 3300049584 Bacteria 2170
261 Ga0501068_0148979 3300049584 Bacteria 1470
262 Ga0501069_0005609 3300049585 Bacteria 6529
263 Ga0501070_0000018 3300049586 Bacteria 172755
264 Ga0501070_0044975 3300049586 Bacteria 3672
265 Ga0501070_0045991 3300049586 Bacteria 3629
266 Ga0501070_0114696 3300049586 Bacteria 2226
267 Ga0501072_0031353 3300049588 Bacteria 4160
268 Ga0501072_0131012 3300049588 Bacteria 1999
269 Ga0501073_0051241 3300049589 Bacteria 2891
270 Ga0501073_0181284 3300049589 Bacteria 1457
271 Ga0501074_0028145 3300049590 Bacteria 4072
272 Ga0501074_0299351 3300049590 Bacteria 1142
273 Ga0501079_0009469 3300049741 Bacteria 7383
274 Ga0501079_0029462 3300049741 Bacteria 4214
275 Ga0501080_0001258 3300049742 Bacteria 21102
276 Ga0501080_0001754 3300049742 Bacteria 18597
277 Ga0501080_0134223 3300049742 Bacteria 2291
278 Ga0501080_0166510 3300049742 Bacteria 2033
279 Ga0501083_0044373 3300049744 Bacteria 3009
280 Ga0501083_0059666 3300049744 Bacteria 2551
281 Ga0501083_0132470 3300049744 Bacteria 1634
282 Ga0501035_0003074 3300049822 Bacteria 16014
283 Ga0501035_0078651 3300049822 Bacteria 2913
284 Ga0501035_0086439 3300049822 Bacteria 2763
285 Ga0501035_0192088 3300049822 Bacteria 1755
286 Ga0501044_0000644 3300049823 Bacteria 42176
287 Ga0501044_0002729 3300049823 Bacteria 20088
288 Ga0501044_0035468 3300049823 Bacteria 5223
289 Ga0501044_0185818 3300049823 Bacteria 2043
290 Ga0501045_0034096 3300049824 Bacteria 3694
291 nmdc:mga05p37_17193_c1 3300050507 Bacteria 8725
292 nmdc:mga09592_80050_c1 3300050508 Bacteria 2782
293 nmdc:mga0qj67_15205_c1 3300050509 Bacteria 5824
294 nmdc:mga06r32_72810_c1 3300050510 Bacteria 3327
295 nmdc:mga08y16_160487_c1 3300050511 Bacteria 2336
296 nmdc:mga08y16_2609_c1 3300050511 Bacteria 18511
297 nmdc:mga0n895_26558_c1 3300050512 Bacteria 5486
298 nmdc:mga0rr50_48811_c1 3300050513 Bacteria 3131
299 nmdc:mga08x19_249_c1 3300050514 Bacteria 40899
300 Ga0500595_000852 3300053119 Bacteria 17399
301 Ga0500595_015574 3300053119 Bacteria 2852
302 Ga0500559_0027670 3300053136 Bacteria 2420
303 Ga0500573_0000032 3300053140 Bacteria 131098
304 Ga0500639_066791 3300053163 Bacteria 1842
305 Ga0501084_0001862 3300054114 Bacteria 16810
306 Ga0501084_0058918 3300054114 Bacteria 3214
307 Ga0501084_0386451 3300054114 Bacteria 1183
308 Ga0501082_0060435 3300060353 Bacteria 3263
309 Ga0501082_0101660 3300060353 Bacteria 2487
310 Ga0501082_0144395 3300060353 Bacteria 2065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0189156 Ga0501036_0189156_947_1714 245
2 3300049574 Ga0501038_0215671 Ga0501038_0215671_10_777 245
3 3300049744 Ga0501083_0132470 Ga0501083_0132470_111_878 245
4 3300049822 Ga0501035_0078651 Ga0501035_0078651_40_807 245
5 3300026116 Ga0207674_10410342 Ga0207674_104103422 255
6 3300048910 Ga0496107_0212188 Ga0496107_0212188_652_1422 256
7 3300054114 Ga0501084_0386451 Ga0501084_0386451_308_1120 260
8 3300035724 Ga0373933_0207712 Ga0373933_0207712_408_1232 274
9 3300049583 Ga0501067_0095220 Ga0501067_0095220_568_1500 276
10 3300049588 Ga0501072_0031353 Ga0501072_0031353_136_1068 276
11 3300049589 Ga0501073_0181284 Ga0501073_0181284_448_1380 276
12 3300049590 Ga0501074_0299351 Ga0501074_0299351_50_982 276
13 3300049744 Ga0501083_0044373 Ga0501083_0044373_1025_1957 276
14 3300003320 rootH2_10006890 rootH2_1000689024 278
15 3300021361 Ga0213872_10081819 Ga0213872_100818192 284
16 3300048929 Ga0496126_0001104 Ga0496126_0001104_34508_35404 284
17 3300049573 Ga0501037_0274489 Ga0501037_0274489_249_1160 285
18 3300006844 Ga0075428_100040069 Ga0075428_1000400691 287
19 3300006846 Ga0075430_100059850 Ga0075430_1000598501 287
20 3300006847 Ga0075431_100045135 Ga0075431_1000451351 287
21 3300006880 Ga0075429_100045890 Ga0075429_1000458901 287
22 3300009094 Ga0111539_10004331 Ga0111539_1000433119 287
23 3300009147 Ga0114129_10080440 Ga0114129_100804409 287
24 3300027907 Ga0207428_10010133 Ga0207428_1001013312 287
25 3300046530 Ga0495654_0060887 Ga0495654_0060887_261_1178 287
26 3300050507 nmdc:mga05p37_17193_c1 nmdc:mga05p37_17193_c1_7616_8551 287
27 3300050508 nmdc:mga09592_80050_c1 nmdc:mga09592_80050_c1_154_1089 287
28 3300050509 nmdc:mga0qj67_15205_c1 nmdc:mga0qj67_15205_c1_2830_3765 287
29 3300050510 nmdc:mga06r32_72810_c1 nmdc:mga06r32_72810_c1_195_1130 287
30 3300050511 nmdc:mga08y16_2609_c1 nmdc:mga08y16_2609_c1_176_1111 287
31 3300005466 Ga0070685_10014107 Ga0070685_100141072 291
32 3300049742 Ga0501080_0134223 Ga0501080_0134223_136_1068 294
33 3300036401 Ga0373937_0028314 Ga0373937_0028314_345_1238 297
34 3300009093 Ga0105240_10000055 Ga0105240_10000055233 298
35 3300009551 Ga0105238_10042693 Ga0105238_100426932 298
36 3300010375 Ga0105239_10003373 Ga0105239_100033735 298
37 3300010375 Ga0105239_10012800 Ga0105239_100128008 298
38 3300013105 Ga0157369_10012565 Ga0157369_1001256511 298
39 3300013307 Ga0157372_10064258 Ga0157372_100642582 298
40 3300014968 Ga0157379_10047178 Ga0157379_100471785 298
41 3300014968 Ga0157379_10210254 Ga0157379_102102542 298
42 3300021384 Ga0213876_10000322 Ga0213876_1000032247 298
43 3300028556 Ga0265337_1005006 Ga0265337_10050063 298
44 3300028573 Ga0265334_10000673 Ga0265334_1000067313 298
45 3300028800 Ga0265338_10053861 Ga0265338_100538613 298
46 3300031344 Ga0265316_10258948 Ga0265316_102589481 298
47 3300031595 Ga0265313_10030370 Ga0265313_100303703 298
48 3300031711 Ga0265314_10068020 Ga0265314_100680202 298
49 3300039437 Ga0436365_0618382 Ga0436365_0618382_604_1500 298
50 iso_pu_bacteria 2883577096 2883578320 300
51 3300014968 Ga0157379_10003277 Ga0157379_1000327711 301
52 3300045976 Ga0466967_0220465 Ga0466967_0220465_839_1771 301
53 3300005435 Ga0070714_100003461 Ga0070714_10000346110 302
54 3300009094 Ga0111539_10158633 Ga0111539_101586333 302
55 3300025929 Ga0207664_10005455 Ga0207664_100054553 302
56 3300031250 Ga0265331_10000049 Ga0265331_1000004978 302
57 3300031711 Ga0265314_10006838 Ga0265314_100068383 302
58 3300050511 nmdc:mga08y16_160487_c1 nmdc:mga08y16_160487_c1_177_1085 302
59 3300009094 Ga0111539_10424651 Ga0111539_104246512 303
60 3300013102 Ga0157371_10180849 Ga0157371_101808492 303
61 3300013307 Ga0157372_10160721 Ga0157372_101607212 303
62 3300025909 Ga0207705_10000039 Ga0207705_1000003955 303
63 3300025912 Ga0207707_10045222 Ga0207707_100452224 303
64 3300025917 Ga0207660_10108556 Ga0207660_101085562 303
65 3300025919 Ga0207657_10001376 Ga0207657_1000137623 303
66 3300025921 Ga0207652_10106033 Ga0207652_101060333 303
67 3300025949 Ga0207667_10076870 Ga0207667_100768704 303
68 3300031247 Ga0265340_10001015 Ga0265340_1000101518 303
69 3300031711 Ga0265314_10167057 Ga0265314_101670572 303
70 3300049569 Ga0501032_0045954 Ga0501032_0045954_186_1097 303
71 3300049573 Ga0501037_0223685 Ga0501037_0223685_79_990 303
72 3300049574 Ga0501038_0043065 Ga0501038_0043065_2805_3716 303
73 3300049579 Ga0501043_0026016 Ga0501043_0026016_3499_4410 303
74 3300049579 Ga0501043_0092184 Ga0501043_0092184_488_1399 303
75 3300049586 Ga0501070_0000018 Ga0501070_0000018_173_1084 303
76 3300049742 Ga0501080_0001258 Ga0501080_0001258_101_1012 303
77 3300049822 Ga0501035_0003074 Ga0501035_0003074_14938_15849 303
78 3300049822 Ga0501035_0086439 Ga0501035_0086439_1576_2487 303
79 3300049823 Ga0501044_0000644 Ga0501044_0000644_7590_8501 303
80 3300049823 Ga0501044_0002729 Ga0501044_0002729_15704_16615 303
81 3300053136 Ga0500559_0027670 Ga0500559_0027670_1379_2290 303
82 3300053163 Ga0500639_066791 Ga0500639_066791_300_1211 303
83 3300005330 Ga0070690_100081777 Ga0070690_1000817772 304
84 3300006175 Ga0070712_100050085 Ga0070712_1000500852 304
85 3300025915 Ga0207693_10118085 Ga0207693_101180852 304
86 3300025949 Ga0207667_10357920 Ga0207667_103579201 304
87 3300028800 Ga0265338_10116885 Ga0265338_101168852 304
88 3300031250 Ga0265331_10000303 Ga0265331_100003037 304
89 3300031251 Ga0265327_10000007 Ga0265327_10000007432 304
90 3300035691 Ga0373931_0023557 Ga0373931_0023557_1431_2345 304
91 3300042001 Ga0439441_034981 Ga0439441_034981_62_976 304
92 3300046683 Ga0495658_0063790 Ga0495658_0063790_256_1170 304
93 3300046690 Ga0495624_0062346 Ga0495624_0062346_124_1038 304
94 3300049571 Ga0501034_0183114 Ga0501034_0183114_897_1811 304
95 3300049572 Ga0501036_0252466 Ga0501036_0252466_384_1298 304
96 3300049581 Ga0501047_0088235 Ga0501047_0088235_2018_2932 304
97 3300049582 Ga0501048_0078181 Ga0501048_0078181_962_1876 304
98 3300049586 Ga0501070_0044975 Ga0501070_0044975_696_1610 304
99 3300049741 Ga0501079_0029462 Ga0501079_0029462_201_1115 304
100 3300054114 Ga0501084_0058918 Ga0501084_0058918_610_1524 304
101 3300060353 Ga0501082_0101660 Ga0501082_0101660_719_1633 304
102 3300005336 Ga0070680_100000332 Ga0070680_1000003327 305
103 3300005338 Ga0068868_100098636 Ga0068868_1000986362 305
104 3300005355 Ga0070671_100421082 Ga0070671_1004210821 305
105 3300005434 Ga0070709_10092233 Ga0070709_100922332 305
106 3300005435 Ga0070714_100041533 Ga0070714_1000415332 305
107 3300005436 Ga0070713_100000006 Ga0070713_100000006172 305
108 3300005436 Ga0070713_100083878 Ga0070713_1000838782 305
109 3300005439 Ga0070711_100077287 Ga0070711_1000772873 305
110 3300005456 Ga0070678_100059713 Ga0070678_1000597133 305
111 3300005458 Ga0070681_10000123 Ga0070681_100001237 305
112 3300005459 Ga0068867_100008764 Ga0068867_1000087644 305
113 3300005518 Ga0070699_100545560 Ga0070699_1005455601 305
114 3300005530 Ga0070679_100000490 Ga0070679_10000049033 305
115 3300005530 Ga0070679_100068194 Ga0070679_1000681943 305
116 3300005548 Ga0070665_100043121 Ga0070665_1000431212 305
117 3300005548 Ga0070665_100043691 Ga0070665_1000436914 305
118 3300005548 Ga0070665_100060645 Ga0070665_1000606454 305
119 3300005548 Ga0070665_100337983 Ga0070665_1003379832 305
120 3300005563 Ga0068855_100000529 Ga0068855_10000052941 305
121 3300005563 Ga0068855_100107220 Ga0068855_1001072203 305
122 3300005563 Ga0068855_100107743 Ga0068855_1001077432 305
123 3300005614 Ga0068856_100000280 Ga0068856_10000028032 305
124 3300005616 Ga0068852_100085023 Ga0068852_1000850233 305
125 3300005616 Ga0068852_100124144 Ga0068852_1001241443 305
126 3300005617 Ga0068859_100622302 Ga0068859_1006223022 305
127 3300005618 Ga0068864_100530568 Ga0068864_1005305681 305
128 3300005842 Ga0068858_100008268 Ga0068858_10000826810 305
129 3300005842 Ga0068858_100017472 Ga0068858_1000174722 305
130 3300005843 Ga0068860_100044968 Ga0068860_1000449684 305
131 3300005843 Ga0068860_100090247 Ga0068860_1000902472 305
132 3300005844 Ga0068862_100082008 Ga0068862_1000820082 305
133 3300006163 Ga0070715_10096392 Ga0070715_100963922 305
134 3300006173 Ga0070716_100018499 Ga0070716_1000184993 305
135 3300006175 Ga0070712_100000528 Ga0070712_10000052824 305
136 3300006237 Ga0097621_100000267 Ga0097621_10000026724 305
137 3300006237 Ga0097621_100008216 Ga0097621_1000082165 305
138 3300006237 Ga0097621_100115090 Ga0097621_1001150903 305
139 3300006358 Ga0068871_100002164 Ga0068871_1000021649 305
140 3300006358 Ga0068871_100003594 Ga0068871_1000035942 305
141 3300006358 Ga0068871_100005709 Ga0068871_1000057096 305
142 3300006358 Ga0068871_100031940 Ga0068871_1000319404 305
143 3300006358 Ga0068871_100079996 Ga0068871_1000799961 305
144 3300006358 Ga0068871_100480233 Ga0068871_1004802332 305
145 3300006871 Ga0075434_100033117 Ga0075434_1000331173 305
146 3300006881 Ga0068865_100005263 Ga0068865_1000052634 305
147 3300006914 Ga0075436_100000054 Ga0075436_1000000544 305
148 3300006931 Ga0097620_100622417 Ga0097620_1006224171 305
149 3300007076 Ga0075435_100059834 Ga0075435_1000598343 305
150 3300009093 Ga0105240_10029678 Ga0105240_100296783 305
151 3300009093 Ga0105240_10093873 Ga0105240_100938735 305
152 3300009174 Ga0105241_10010268 Ga0105241_100102686 305
153 3300009174 Ga0105241_10015241 Ga0105241_100152414 305
154 3300009174 Ga0105241_10074868 Ga0105241_100748683 305
155 3300009174 Ga0105241_10192385 Ga0105241_101923852 305
156 3300009174 Ga0105241_10300994 Ga0105241_103009942 305
157 3300009176 Ga0105242_10075479 Ga0105242_100754793 305
158 3300009176 Ga0105242_10176788 Ga0105242_101767882 305
159 3300009176 Ga0105242_10423633 Ga0105242_104236331 305
160 3300009177 Ga0105248_10151260 Ga0105248_101512602 305
161 3300009177 Ga0105248_10600522 Ga0105248_106005222 305
162 3300009545 Ga0105237_10013620 Ga0105237_100136209 305
163 3300009545 Ga0105237_10076913 Ga0105237_100769131 305
164 3300009545 Ga0105237_10203045 Ga0105237_102030452 305
165 3300009551 Ga0105238_10056673 Ga0105238_100566733 305
166 3300009553 Ga0105249_10127696 Ga0105249_101276962 305
167 3300010375 Ga0105239_10029869 Ga0105239_100298693 305
168 3300010375 Ga0105239_10116855 Ga0105239_101168553 305
169 3300013104 Ga0157370_10037455 Ga0157370_100374555 305
170 3300013105 Ga0157369_10004952 Ga0157369_1000495218 305
171 3300013105 Ga0157369_10359592 Ga0157369_103595921 305
172 3300013296 Ga0157374_10330936 Ga0157374_103309362 305
173 3300013307 Ga0157372_10048506 Ga0157372_100485063 305
174 3300013308 Ga0157375_10007944 Ga0157375_100079447 305
175 3300014968 Ga0157379_10000304 Ga0157379_1000030422 305
176 3300014969 Ga0157376_10012134 Ga0157376_100121344 305
177 3300014969 Ga0157376_10229636 Ga0157376_102296362 305
178 3300014969 Ga0157376_10388635 Ga0157376_103886352 305
179 3300021384 Ga0213876_10161752 Ga0213876_101617521 305
180 3300025903 Ga0207680_10010864 Ga0207680_100108642 305
181 3300025905 Ga0207685_10064476 Ga0207685_100644762 305
182 3300025906 Ga0207699_10007037 Ga0207699_100070372 305
183 3300025906 Ga0207699_10244801 Ga0207699_102448011 305
184 3300025908 Ga0207643_10040115 Ga0207643_100401153 305
185 3300025909 Ga0207705_10004807 Ga0207705_100048073 305
186 3300025909 Ga0207705_10398455 Ga0207705_103984552 305
187 3300025911 Ga0207654_10016400 Ga0207654_100164005 305
188 3300025911 Ga0207654_10066821 Ga0207654_100668212 305
189 3300025912 Ga0207707_10000002 Ga0207707_1000000259 305
190 3300025913 Ga0207695_10000012 Ga0207695_10000012104 305
191 3300025913 Ga0207695_10021214 Ga0207695_100212146 305
192 3300025913 Ga0207695_10056927 Ga0207695_100569274 305
193 3300025913 Ga0207695_10066090 Ga0207695_100660903 305
194 3300025913 Ga0207695_10104727 Ga0207695_101047272 305
195 3300025914 Ga0207671_10049711 Ga0207671_100497114 305
196 3300025915 Ga0207693_10001101 Ga0207693_1000110121 305
197 3300025917 Ga0207660_10001154 Ga0207660_100011547 305
198 3300025919 Ga0207657_10132438 Ga0207657_101324383 305
199 3300025921 Ga0207652_10000197 Ga0207652_1000019745 305
200 3300025921 Ga0207652_10152077 Ga0207652_101520773 305
201 3300025924 Ga0207694_10000006 Ga0207694_10000006558 305
202 3300025924 Ga0207694_10233105 Ga0207694_102331052 305
203 3300025928 Ga0207700_10000199 Ga0207700_1000019931 305
204 3300025929 Ga0207664_10031986 Ga0207664_100319864 305
205 3300025934 Ga0207686_10001631 Ga0207686_100016316 305
206 3300025934 Ga0207686_10005045 Ga0207686_100050454 305
207 3300025934 Ga0207686_10057844 Ga0207686_100578443 305
208 3300025938 Ga0207704_10003734 Ga0207704_100037343 305
209 3300025939 Ga0207665_10010411 Ga0207665_100104115 305
210 3300025941 Ga0207711_10012518 Ga0207711_100125184 305
211 3300025941 Ga0207711_10083611 Ga0207711_100836112 305
212 3300025942 Ga0207689_10087738 Ga0207689_100877383 305
213 3300025949 Ga0207667_10000026 Ga0207667_10000026290 305
214 3300025949 Ga0207667_10184057 Ga0207667_101840572 305
215 3300025961 Ga0207712_10087745 Ga0207712_100877453 305
216 3300026035 Ga0207703_10009085 Ga0207703_100090857 305
217 3300026035 Ga0207703_10026856 Ga0207703_100268564 305
218 3300026041 Ga0207639_10002226 Ga0207639_100022264 305
219 3300026078 Ga0207702_10000030 Ga0207702_1000003089 305
220 3300026089 Ga0207648_10017453 Ga0207648_100174534 305
221 3300026095 Ga0207676_10062505 Ga0207676_100625051 305
222 3300026095 Ga0207676_10081269 Ga0207676_100812693 305
223 3300026121 Ga0207683_10004248 Ga0207683_100042488 305
224 3300026142 Ga0207698_10020614 Ga0207698_100206145 305
225 3300026142 Ga0207698_10315013 Ga0207698_103150131 305
226 3300028379 Ga0268266_10001271 Ga0268266_1000127115 305
227 3300028379 Ga0268266_10018413 Ga0268266_100184133 305
228 3300028379 Ga0268266_10023951 Ga0268266_100239515 305
229 3300028379 Ga0268266_10417342 Ga0268266_104173422 305
230 3300028380 Ga0268265_10079847 Ga0268265_100798474 305
231 3300028577 Ga0265318_10000388 Ga0265318_1000038831 305
232 3300028800 Ga0265338_10000011 Ga0265338_10000011428 305
233 3300028800 Ga0265338_10054811 Ga0265338_100548114 305
234 3300031238 Ga0265332_10023683 Ga0265332_100236832 305
235 3300031238 Ga0265332_10031076 Ga0265332_100310763 305
236 3300031240 Ga0265320_10000123 Ga0265320_1000012341 305
237 3300031241 Ga0265325_10000002 Ga0265325_1000000296 305
238 3300031241 Ga0265325_10000027 Ga0265325_1000002735 305
239 3300031241 Ga0265325_10003234 Ga0265325_1000323411 305
240 3300031241 Ga0265325_10012113 Ga0265325_100121135 305
241 3300031247 Ga0265340_10024675 Ga0265340_100246754 305
242 3300031249 Ga0265339_10001651 Ga0265339_1000165110 305
243 3300031249 Ga0265339_10002449 Ga0265339_1000244912 305
244 3300031249 Ga0265339_10006481 Ga0265339_100064813 305
245 3300031250 Ga0265331_10001113 Ga0265331_1000111314 305
246 3300031250 Ga0265331_10027517 Ga0265331_100275173 305
247 3300031250 Ga0265331_10108658 Ga0265331_101086581 305
248 3300031344 Ga0265316_10001218 Ga0265316_1000121818 305
249 3300031344 Ga0265316_10021855 Ga0265316_100218553 305
250 3300031595 Ga0265313_10000335 Ga0265313_1000033521 305
251 3300031595 Ga0265313_10002380 Ga0265313_1000238018 305
252 3300031595 Ga0265313_10035577 Ga0265313_100355772 305
253 3300031595 Ga0265313_10086523 Ga0265313_100865231 305
254 3300031712 Ga0265342_10005469 Ga0265342_100054697 305
255 3300031730 Ga0307516_10015652 Ga0307516_100156522 305
256 3300031730 Ga0307516_10032700 Ga0307516_100327002 305
257 3300031730 Ga0307516_10060168 Ga0307516_100601684 305
258 3300035691 Ga0373931_0032643 Ga0373931_0032643_1378_2313 305
259 3300036401 Ga0373937_0000338 Ga0373937_0000338_22904_23821 305
260 3300036401 Ga0373937_0136946 Ga0373937_0136946_170_1087 305
261 3300039450 Ga0436363_0468218 Ga0436363_0468218_778_1695 305
262 3300039450 Ga0436363_1184338 Ga0436363_1184338_21087_22004 305
263 3300047320 Ga0495672_0003016 Ga0495672_0003016_6261_7196 305
264 3300049570 Ga0501033_0028926 Ga0501033_0028926_2891_3808 305
265 3300049570 Ga0501033_0057077 Ga0501033_0057077_59_976 305
266 3300049570 Ga0501033_0139260 Ga0501033_0139260_368_1309 305
267 3300049571 Ga0501034_0056365 Ga0501034_0056365_960_1877 305
268 3300049572 Ga0501036_0014554 Ga0501036_0014554_1906_2823 305
269 3300049572 Ga0501036_0293245 Ga0501036_0293245_366_1283 305
270 3300049573 Ga0501037_0007669 Ga0501037_0007669_1183_2100 305
271 3300049574 Ga0501038_0015099 Ga0501038_0015099_4162_5079 305
272 3300049574 Ga0501038_0061785 Ga0501038_0061785_2172_3116 305
273 3300049575 Ga0501039_0018692 Ga0501039_0018692_4053_4970 305
274 3300049575 Ga0501039_0049833 Ga0501039_0049833_203_1150 305
275 3300049579 Ga0501043_0416990 Ga0501043_0416990_44_964 305
276 3300049580 Ga0501046_0045826 Ga0501046_0045826_1909_2826 305
277 3300049580 Ga0501046_0070170 Ga0501046_0070170_453_1400 305
278 3300049581 Ga0501047_0003568 Ga0501047_0003568_7890_8822 305
279 3300049581 Ga0501047_0036811 Ga0501047_0036811_1618_2565 305
280 3300049581 Ga0501047_0054946 Ga0501047_0054946_2483_3400 305
281 3300049581 Ga0501047_0133864 Ga0501047_0133864_1032_1949 305
282 3300049581 Ga0501047_0231831 Ga0501047_0231831_359_1276 305
283 3300049582 Ga0501048_0024593 Ga0501048_0024593_706_1623 305
284 3300049583 Ga0501067_0006462 Ga0501067_0006462_5292_6239 305
285 3300049584 Ga0501068_0068097 Ga0501068_0068097_421_1368 305
286 3300049584 Ga0501068_0148979 Ga0501068_0148979_107_1024 305
287 3300049585 Ga0501069_0005609 Ga0501069_0005609_880_1797 305
288 3300049586 Ga0501070_0045991 Ga0501070_0045991_281_1198 305
289 3300049586 Ga0501070_0114696 Ga0501070_0114696_32_949 305
290 3300049588 Ga0501072_0131012 Ga0501072_0131012_221_1141 305
291 3300049589 Ga0501073_0051241 Ga0501073_0051241_1294_2241 305
292 3300049590 Ga0501074_0028145 Ga0501074_0028145_1916_2833 305
293 3300049741 Ga0501079_0009469 Ga0501079_0009469_4317_5234 305
294 3300049742 Ga0501080_0001754 Ga0501080_0001754_14786_15733 305
295 3300049742 Ga0501080_0166510 Ga0501080_0166510_691_1608 305
296 3300049744 Ga0501083_0059666 Ga0501083_0059666_658_1575 305
297 3300049822 Ga0501035_0192088 Ga0501035_0192088_743_1660 305
298 3300049823 Ga0501044_0035468 Ga0501044_0035468_46_963 305
299 3300049823 Ga0501044_0185818 Ga0501044_0185818_352_1299 305
300 3300049824 Ga0501045_0034096 Ga0501045_0034096_2175_3092 305
301 3300050512 nmdc:mga0n895_26558_c1 nmdc:mga0n895_26558_c1_2853_3770 305
302 3300050513 nmdc:mga0rr50_48811_c1 nmdc:mga0rr50_48811_c1_1268_2185 305
303 3300050514 nmdc:mga08x19_249_c1 nmdc:mga08x19_249_c1_3829_4746 305
304 3300053119 Ga0500595_000852 Ga0500595_000852_2177_3094 305
305 3300053119 Ga0500595_015574 Ga0500595_015574_1490_2407 305
306 3300053140 Ga0500573_0000032 Ga0500573_0000032_125300_126217 305
307 3300054114 Ga0501084_0001862 Ga0501084_0001862_13988_14905 305
308 3300060353 Ga0501082_0060435 Ga0501082_0060435_2021_2938 305
309 3300060353 Ga0501082_0144395 Ga0501082_0144395_576_1523 305
310 3300003215 JGI25153J46596_10000812 JGI25153J46596_1000081211 306
311 3300025297 Ga0209758_1000008 Ga0209758_1000008109 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

3

181

0.94

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

204

309

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9374 2 306
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9315 2 306
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9284 1 306
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9255 1 306
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9227 3 305
ID Description Score Start End Superfamily
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.97 2 207 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.965 2 207 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.953 3 207 3.40.50.170
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9403 1 207 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9349 3 207 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A2V7K666-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9829 3 127 GO:0004479
GO:0005829
AF-A0A7U9WVT5-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9794 3 120 GO:0004479
GO:0005829
AF-A0A258BH43-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9769 1 130 GO:0004479
GO:0005829
AF-D8FIG2-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9764 3 207 GO:0004479
GO:0005829
AF-A0A2V7GRZ1-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9724 3 250 GO:0004479
GO:0005829

Feature Viewer

pLDDT pTM Quality
94.33 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map