F401291

General Info

Members Datasets Scaffolds Average Seq Length
311 208 310 159

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0021360|Ga0373923_0021360_770_1333
Length 187
Sequence MAGCTTVQDAEPSIWCGHLAAVRRLRNVDGVPTMSLESVREFLAANAPDVPIIELEMSSDTMTLSAAWSIEPAQVAKTLSVRAGDRNVLLVTCGNARVDNKKAKAVLGGKVRMLRPEEAAAITGHPVGGVCPFGLATPLPIYCDVALRAFEEVVPAAGSTHAAIRINPIRLAELVDAKWVDVCEQQG

Samples

Sample ID Description Type Environment
1 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
200 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
201 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
202 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
203 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
204 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
205 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
206 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
207 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
208 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.4
Nodule 0
Rhizoplane 0
Rhizosphere 76.53
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10042996 3300003911 Bacteria 958
2 Ga0070658_10426902 3300005327 Bacteria 1140
3 Ga0070683_100371401 3300005329 Bacteria 1362
4 Ga0068869_100450762 3300005334 Bacteria 1066
5 Ga0068869_101524767 3300005334 Bacteria 594
6 Ga0068868_100054268 3300005338 Bacteria 3158
7 Ga0070660_100025451 3300005339 Bacteria 4399
8 Ga0070660_100062622 3300005339 Bacteria 2890
9 Ga0070661_100255005 3300005344 Bacteria 1355
10 Ga0070673_100740538 3300005364 Bacteria 904
11 Ga0070659_100020949 3300005366 Bacteria 4972
12 Ga0070708_100097567 3300005445 Bacteria 2687
13 Ga0070708_100115819 3300005445 Bacteria 2467
14 Ga0070708_100962747 3300005445 Bacteria 801
15 Ga0070678_100666258 3300005456 Bacteria 935
16 Ga0070706_100450641 3300005467 Bacteria 1197
17 Ga0070698_100005107 3300005471 Bacteria 14369
18 Ga0070699_100069522 3300005518 Bacteria 3059
19 Ga0070684_100252301 3300005535 Bacteria 1613
20 Ga0070697_100023585 3300005536 Bacteria 4893
21 Ga0070697_100089084 3300005536 Bacteria 2549
22 Ga0068853_100007846 3300005539 Bacteria 8560
23 Ga0068853_100028237 3300005539 Bacteria 4717
24 Ga0070672_101359143 3300005543 Bacteria 635
25 Ga0070704_101164128 3300005549 Bacteria 702
26 Ga0068855_100045338 3300005563 Bacteria 5200
27 Ga0068855_100123008 3300005563 Bacteria 2968
28 Ga0068855_100161796 3300005563 Bacteria 2540
29 Ga0070664_100032151 3300005564 Bacteria 4388
30 Ga0068857_100113369 3300005577 Bacteria 2438
31 Ga0068854_100035041 3300005578 Bacteria 3511
32 Ga0068854_100067210 3300005578 Bacteria 2611
33 Ga0068852_100019264 3300005616 Bacteria 5396
34 Ga0068859_101064471 3300005617 Bacteria 889
35 Ga0068863_100006355 3300005841 Bacteria 11588
36 Ga0068858_100870852 3300005842 Bacteria 880
37 Ga0081455_10004676 3300005937 Bacteria 15239
38 Ga0081538_10011440 3300005981 Bacteria 7186
39 Ga0081539_10001282 3300005985 Bacteria 44233
40 Ga0081539_10106084 3300005985 Bacteria 1423
41 Ga0075365_10016677 3300006038 Bacteria 4474
42 Ga0075365_10019667 3300006038 Bacteria 4173
43 Ga0075365_10136404 3300006038 Bacteria 1701
44 Ga0075363_100166321 3300006048 Bacteria 1250
45 Ga0075364_10006262 3300006051 Bacteria 6981
46 Ga0075364_10289894 3300006051 Bacteria 1114
47 Ga0075362_10003088 3300006177 Bacteria 5739
48 Ga0075362_10004572 3300006177 Bacteria 4988
49 Ga0075362_10047251 3300006177 Bacteria 1916
50 Ga0075367_10002806 3300006178 Bacteria 8084
51 Ga0075367_10092353 3300006178 Bacteria 1843
52 Ga0075369_10000525 3300006186 Bacteria 12057
53 Ga0075369_10099345 3300006186 Bacteria 1304
54 Ga0075366_10137580 3300006195 Bacteria 1475
55 Ga0075366_10170521 3300006195 Bacteria 1320
56 Ga0075370_10046105 3300006353 Bacteria 2466
57 Ga0075431_100459360 3300006847 Bacteria 1268
58 Ga0075429_101109047 3300006880 Bacteria 691
59 Ga0068865_100236351 3300006881 Bacteria 1436
60 Ga0068865_101333593 3300006881 Bacteria 639
61 Ga0075436_100062335 3300006914 Bacteria 2576
62 Ga0097620_101064344 3300006931 Bacteria 889
63 Ga0105240_10015874 3300009093 Bacteria 10218
64 Ga0105240_10038719 3300009093 Bacteria 6113
65 Ga0105240_10478450 3300009093 Bacteria 1389
66 Ga0105240_11036444 3300009093 Bacteria 876
67 Ga0111539_11708639 3300009094 Bacteria 730
68 Ga0111539_11970921 3300009094 Bacteria 677
69 Ga0105247_10648338 3300009101 Bacteria 789
70 Ga0105241_10065635 3300009174 Bacteria 2805
71 Ga0105237_10005719 3300009545 Bacteria 13977
72 Ga0105237_10200808 3300009545 Bacteria 1994
73 Ga0105237_10677506 3300009545 Bacteria 1038
74 Ga0105237_11288173 3300009545 Bacteria 737
75 Ga0105238_10026734 3300009551 Bacteria 5882
76 Ga0105238_10037952 3300009551 Bacteria 4896
77 Ga0105238_10159842 3300009551 Bacteria 2228
78 Ga0099796_10012051 3300010159 Bacteria 2429
79 Ga0105239_10000061 3300010375 Bacteria 154661
80 Ga0105239_10079246 3300010375 Bacteria 3615
81 Ga0105246_11729585 3300011119 Unclassified 595
82 Ga0157373_10222301 3300013100 Bacteria 1332
83 Ga0157369_10401107 3300013105 Bacteria 1423
84 Ga0157372_10056762 3300013307 Bacteria 4375
85 Ga0157375_12062573 3300013308 Bacteria 678
86 Ga0157375_12815508 3300013308 Bacteria 581
87 Ga0182008_10589092 3300014497 Bacteria 623
88 Ga0157379_10429936 3300014968 Bacteria 1217
89 Ga0163161_10031026 3300017792 Bacteria 3806
90 Ga0163161_11120429 3300017792 Bacteria 677
91 Ga0213872_10000015 3300021361 Bacteria 180923
92 Ga0213872_10028577 3300021361 Bacteria 2556
93 Ga0213872_10052089 3300021361 Bacteria 1857
94 Ga0213872_10122881 3300021361 Bacteria 1147
95 Ga0213872_10123766 3300021361 Bacteria 1142
96 Ga0213875_10000003 3300021388 Bacteria 719367
97 Ga0209025_1042033 3300025294 Bacteria 1948
98 Ga0209758_1048321 3300025297 Bacteria 1514
99 Ga0207647_10307875 3300025904 Bacteria 901
100 Ga0207645_10166913 3300025907 Bacteria 1442
101 Ga0207705_10000988 3300025909 Bacteria 23188
102 Ga0207705_10089421 3300025909 Bacteria 2254
103 Ga0207705_10182174 3300025909 Bacteria 1586
104 Ga0207684_10467669 3300025910 Bacteria 1082
105 Ga0207684_10493652 3300025910 Bacteria 1050
106 Ga0207684_10752784 3300025910 Bacteria 826
107 Ga0207654_10384418 3300025911 Bacteria 973
108 Ga0207707_10495532 3300025912 Bacteria 1042
109 Ga0207695_10046580 3300025913 Bacteria 4596
110 Ga0207671_10012049 3300025914 Bacteria 6985
111 Ga0207671_10277216 3300025914 Bacteria 1322
112 Ga0207657_10000522 3300025919 Bacteria 40660
113 Ga0207657_10023890 3300025919 Bacteria 5677
114 Ga0207646_10932287 3300025922 Bacteria 769
115 Ga0207694_10027415 3300025924 Bacteria 4338
116 Ga0207694_10136632 3300025924 Bacteria 1969
117 Ga0207694_10140720 3300025924 Bacteria 1940
118 Ga0207659_10650761 3300025926 Bacteria 901
119 Ga0207664_10757175 3300025929 Bacteria 873
120 Ga0207690_10323209 3300025932 Bacteria 1213
121 Ga0207704_10467269 3300025938 Bacteria 1010
122 Ga0207691_10073771 3300025940 Bacteria 3078
123 Ga0207689_10251764 3300025942 Bacteria 1460
124 Ga0207667_10218643 3300025949 Bacteria 1952
125 Ga0207667_10316631 3300025949 Bacteria 1593
126 Ga0207667_10334661 3300025949 Bacteria 1545
127 Ga0207668_10830343 3300025972 Bacteria 819
128 Ga0207639_10010574 3300026041 Bacteria 6393
129 Ga0207639_10109120 3300026041 Bacteria 2251
130 Ga0207678_10124386 3300026067 Bacteria 2200
131 Ga0207678_10124681 3300026067 Bacteria 2198
132 Ga0207702_10160682 3300026078 Bacteria 2051
133 Ga0207648_10014268 3300026089 Bacteria 7345
134 Ga0207674_10748775 3300026116 Bacteria 943
135 Ga0207698_10775644 3300026142 Bacteria 959
136 Ga0307517_10460999 3300028786 Bacteria 656
137 Ga0307515_10174715 3300028794 Bacteria 2124
138 Ga0265338_10168032 3300028800 Bacteria 1686
139 Ga0265332_10069010 3300031238 Bacteria 1507
140 Ga0265320_10169942 3300031240 Bacteria 980
141 Ga0265325_10001807 3300031241 Bacteria 14801
142 Ga0265340_10217723 3300031247 Bacteria 856
143 Ga0265316_10073513 3300031344 Bacteria 2633
144 Ga0265316_10601423 3300031344 Bacteria 780
145 Ga0307513_10542012 3300031456 Bacteria 877
146 Ga0265313_10052214 3300031595 Bacteria 1953
147 Ga0265314_10039480 3300031711 Bacteria 3399
148 Ga0265342_10044371 3300031712 Bacteria 2680
149 Ga0307516_10119674 3300031730 Bacteria 2426
150 Ga0307405_10142431 3300031731 Bacteria 1674
151 Ga0307413_11003701 3300031824 Bacteria 716
152 Ga0307410_10158054 3300031852 Bacteria 1695
153 Ga0307410_10180088 3300031852 Bacteria 1600
154 Ga0307410_10489382 3300031852 Bacteria 1010
155 Ga0307407_10235984 3300031903 Bacteria 1245
156 Ga0307409_100300004 3300031995 Bacteria 1494
157 Ga0307409_100503336 3300031995 Bacteria 1180
158 Ga0307416_100108430 3300032002 Bacteria 2440
159 Ga0307414_10050117 3300032004 Bacteria 2891
160 Ga0307414_10078772 3300032004 Bacteria 2403
161 Ga0307411_10016057 3300032005 Bacteria 4228
162 Ga0307411_10428140 3300032005 Bacteria 1101
163 Ga0307415_100226368 3300032126 Bacteria 1503
164 Ga0307510_10352202 3300033180 Bacteria 922
165 Ga0373928_0120752 3300035084 Bacteria 702
166 Ga0373923_0021360 3300035111 Bacteria 2526
167 Ga0373936_0028315 3300035113 Bacteria 2202
168 Ga0373939_0079704 3300035114 Bacteria 1085
169 Ga0373939_0135952 3300035114 Bacteria 882
170 Ga0373941_0268057 3300035115 Bacteria 672
171 Ga0373960_0113565 3300035121 Bacteria 891
172 Ga0373943_0566722 3300035170 Unclassified 667
173 Ga0373962_0239248 3300035242 Bacteria 627
174 Ga0373931_0064304 3300035691 Bacteria 1985
175 Ga0373931_0071494 3300035691 Bacteria 1895
176 Ga0373935_0140053 3300035692 Bacteria 1634
177 Ga0373927_0049431 3300035695 Bacteria 2719
178 Ga0373933_0011680 3300035724 Bacteria 4846
179 Ga0373947_0137098 3300035725 Bacteria 1567
180 Ga0373925_0124005 3300037068 Bacteria 2008
181 Ga0373925_0280703 3300037068 Bacteria 1341
182 Ga0395900_0116359 3300037418 Bacteria 2743
183 Ga0395898_0411303 3300037466 Bacteria 1289
184 Ga0395905_0195883 3300037471 Bacteria 1895
185 Ga0436364_0875435 3300037853 Bacteria 49936
186 Ga0395901_0039328 3300038443 Bacteria 4894
187 Ga0395901_0201977 3300038443 Bacteria 2083
188 Ga0395901_1885567 3300038443 Bacteria 545
189 Ga0436360_1340994 3300039438 Bacteria 1090
190 Ga0436361_0377353 3300039447 Bacteria 2665
191 Ga0436361_0451565 3300039447 Bacteria 25656
192 Ga0436361_0571987 3300039447 Bacteria 1903
193 Ga0436361_0660513 3300039447 Bacteria 2077
194 Ga0436361_0683236 3300039447 Bacteria 1407
195 Ga0436361_1113708 3300039447 Bacteria 1127
196 Ga0436362_0641575 3300039453 Bacteria 818
197 Ga0451851_1029190 3300041507 Bacteria 1016
198 Ga0466961_0208567 3300044693 Bacteria 1207
199 Ga0466967_1301368 3300045976 Bacteria 724
200 Ga0495638_0180779 3300046460 Bacteria 1204
201 Ga0495638_0208729 3300046460 Bacteria 1098
202 Ga0495651_0153032 3300046462 Bacteria 1660
203 Ga0495662_0338396 3300046476 Unclassified 740
204 Ga0495664_0599876 3300046477 Unclassified 654
205 Ga0495608_0425423 3300046511 Unclassified 810
206 Ga0495610_0037325 3300046512 Bacteria 2474
207 Ga0495628_0129629 3300046516 Bacteria 1930
208 Ga0495640_0125876 3300046533 Bacteria 1662
209 Ga0495645_0295070 3300046543 Unclassified 1061
210 Ga0495667_0244772 3300046559 Bacteria 1142
211 Ga0495634_0097664 3300046642 Bacteria 1901
212 Ga0495625_0019688 3300046660 Bacteria 5226
213 Ga0495599_0459269 3300046678 Bacteria 753
214 Ga0495613_0658264 3300046689 Unclassified 692
215 Ga0495600_0334602 3300046809 Unclassified 950
216 Ga0495660_0136727 3300046810 Bacteria 1224
217 Ga0495672_0036395 3300047320 Bacteria 3023
218 Ga0495680_0066729 3300047322 Bacteria 2753
219 Ga0495687_069245 3300047443 Bacteria 1421
220 Ga0495675_0071966 3300047444 Bacteria 2182
221 Ga0495681_0000043 3300047470 Bacteria 115514
222 Ga0495686_0047343 3300047472 Bacteria 2715
223 Ga0495686_0101665 3300047472 Bacteria 1733
224 Ga0495602_0194312 3300048088 Bacteria 1553
225 Ga0496117_0006202 3300048920 Bacteria 12193
226 Ga0496117_0027766 3300048920 Bacteria 4398
227 Ga0496117_0121340 3300048920 Bacteria 1605
228 Ga0496118_0032215 3300048921 Bacteria 4325
229 Ga0496118_0230973 3300048921 Bacteria 1067
230 Ga0496119_0257849 3300048922 Bacteria 876
231 Ga0496121_0000584 3300048924 Bacteria 68507
232 Ga0496122_0006060 3300048925 Bacteria 14088
233 Ga0496123_0008841 3300048926 Bacteria 9178
234 Ga0496124_0176611 3300048927 Bacteria 1648
235 Ga0496125_0587581 3300048928 Bacteria 610
236 Ga0496126_0006167 3300048929 Bacteria 13420
237 Ga0496126_0034262 3300048929 Bacteria 4770
238 Ga0496126_0041144 3300048929 Bacteria 4280
239 Ga0495678_022000 3300049459 Bacteria 2796
240 Ga0501031_0591470 3300049568 Bacteria 714
241 Ga0501032_0078438 3300049569 Bacteria 2199
242 Ga0501032_0211064 3300049569 Bacteria 1266
243 Ga0501033_0156597 3300049570 Bacteria 1641
244 Ga0501033_0600974 3300049570 Bacteria 754
245 Ga0501034_0127310 3300049571 Bacteria 2532
246 Ga0501034_0770084 3300049571 Bacteria 857
247 Ga0501036_0046139 3300049572 Bacteria 3690
248 Ga0501036_0339313 3300049572 Bacteria 1255
249 Ga0501037_0387820 3300049573 Bacteria 959
250 Ga0501038_0099664 3300049574 Bacteria 2422
251 Ga0501038_0208581 3300049574 Bacteria 1564
252 Ga0501038_0618344 3300049574 Bacteria 818
253 Ga0501043_0044415 3300049579 Bacteria 3494
254 Ga0501043_0981554 3300049579 Bacteria 602
255 Ga0501046_0156899 3300049580 Bacteria 1714
256 Ga0501046_0410661 3300049580 Bacteria 977
257 Ga0501046_0549317 3300049580 Bacteria 824
258 Ga0501047_0029914 3300049581 Bacteria 5250
259 Ga0501047_0172834 3300049581 Bacteria 2029
260 Ga0501047_0347702 3300049581 Bacteria 1320
261 Ga0501070_0219589 3300049586 Bacteria 1559
262 Ga0501073_0061095 3300049589 Bacteria 2630
263 Ga0501074_0191526 3300049590 Bacteria 1458
264 Ga0501074_0653622 3300049590 Bacteria 743
265 Ga0501080_0175083 3300049742 Bacteria 1977
266 Ga0501080_0740925 3300049742 Bacteria 865
267 Ga0501241_007322 3300049758 Bacteria 2022
268 Ga0501035_0001226 3300049822 Bacteria 26728
269 Ga0501035_0086484 3300049822 Bacteria 2762
270 Ga0501044_0031558 3300049823 Bacteria 5575
271 Ga0501044_0131848 3300049823 Bacteria 2493
272 Ga0501044_0173501 3300049823 Bacteria 2126
273 Ga0501044_0190735 3300049823 Bacteria 2012
274 Ga0501044_0287062 3300049823 Bacteria 1578
275 Ga0501044_1111509 3300049823 Bacteria 659
276 nmdc:mga03683_23422_c1 3300050489 Bacteria 2404
277 nmdc:mga03683_4592_c1 3300050489 Bacteria 4597
278 nmdc:mga03683_92616_c1 3300050489 Bacteria 1319
279 nmdc:mga03683_9546_c1 3300050489 Bacteria 3456
280 nmdc:mga03n38_175552_c1 3300050490 Bacteria 1094
281 nmdc:mga03n38_36338_c1 3300050490 Bacteria 2117
282 nmdc:mga00v17_5034_c1 3300050491 Bacteria 6940
283 nmdc:mga00v17_78574_c1 3300050491 Bacteria 1344
284 nmdc:mga0yw44_170709_c1 3300050492 Bacteria 1428
285 nmdc:mga0yw44_40821_c1 3300050492 Bacteria 2759
286 nmdc:mga0yw44_7104_c1 3300050492 Bacteria 5481
287 nmdc:mga0k408_156656_c1 3300050493 Bacteria 1356
288 nmdc:mga0k408_88783_c1 3300050493 Bacteria 1815
289 nmdc:mga06z11_131499_c1 3300050494 Bacteria 1406
290 nmdc:mga06z11_5395_c1 3300050494 Bacteria 5124
291 nmdc:mga06z11_887628_c1 3300050494 Bacteria 543
292 nmdc:mga07m45_43136_c1 3300050496 Bacteria 960
293 nmdc:mga06r32_867175_c1 3300050510 Bacteria 861
294 nmdc:mga0sz30_238457_c1 3300050516 Bacteria 809
295 nmdc:mga0sz30_402_c1 3300050516 Bacteria 16495
296 Ga0495612_0491841 3300053078 Bacteria 562
297 Ga0500651_0126498 3300053093 Bacteria 1548
298 Ga0500641_0001304 3300053096 Bacteria 8860
299 Ga0500650_0348368 3300053098 Bacteria 648
300 Ga0500555_002559 3300053103 Bacteria 5238
301 Ga0500556_0000076 3300053104 Bacteria 95452
302 Ga0500556_0000119 3300053104 Bacteria 68528
303 Ga0500617_111371 3300053124 Bacteria 1143
304 Ga0500642_0000001 3300053130 Bacteria 1468402
305 Ga0500577_0000174 3300053142 Bacteria 16504
306 Ga0500622_0008562 3300053156 Bacteria 5712
307 Ga0500622_0089941 3300053156 Bacteria 1525
308 Ga0500636_0021633 3300053177 Bacteria 3807
309 Ga0500645_000625 3300053730 Bacteria 22584
310 Ga0500645_019644 3300053730 Bacteria 2100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_101524767 Ga0068869_1015247671 151
2 3300048929 Ga0496126_0034262 Ga0496126_0034262_4060_4515 151
3 3300013308 Ga0157375_12062573 Ga0157375_120625731 152
4 3300021361 Ga0213872_10000015 Ga0213872_1000001571 152
5 3300021361 Ga0213872_10028577 Ga0213872_100285773 152
6 3300021361 Ga0213872_10052089 Ga0213872_100520892 152
7 3300021361 Ga0213872_10123766 Ga0213872_101237662 152
8 3300021388 Ga0213875_10000003 Ga0213875_10000003106 152
9 3300037853 Ga0436364_0875435 Ga0436364_0875435_13065_13538 152
10 3300039438 Ga0436360_1340994 Ga0436360_1340994_60_518 152
11 3300039447 Ga0436361_0377353 Ga0436361_0377353_835_1293 152
12 3300039447 Ga0436361_0660513 Ga0436361_0660513_250_708 152
13 3300039447 Ga0436361_0683236 Ga0436361_0683236_464_922 152
14 3300039447 Ga0436361_1113708 Ga0436361_1113708_464_922 152
15 3300049822 Ga0501035_0001226 Ga0501035_0001226_1648_2220 152
16 iso_pu_bacteria 2891048133 2891049585 152
17 3300005617 Ga0068859_101064471 Ga0068859_1010644712 154
18 3300006847 Ga0075431_100459360 Ga0075431_1004593602 154
19 3300006880 Ga0075429_101109047 Ga0075429_1011090472 154
20 3300006931 Ga0097620_101064344 Ga0097620_1010643442 154
21 3300009094 Ga0111539_11708639 Ga0111539_117086392 154
22 3300014968 Ga0157379_10429936 Ga0157379_104299362 154
23 3300035111 Ga0373923_0021360 Ga0373923_0021360_770_1333 154
24 3300035170 Ga0373943_0566722 Ga0373943_0566722_78_641 154
25 3300035724 Ga0373933_0011680 Ga0373933_0011680_2290_2754 154
26 3300037068 Ga0373925_0280703 Ga0373925_0280703_10_474 154
27 3300046462 Ga0495651_0153032 Ga0495651_0153032_1044_1508 154
28 3300046476 Ga0495662_0338396 Ga0495662_0338396_100_663 154
29 3300046477 Ga0495664_0599876 Ga0495664_0599876_46_609 154
30 3300046511 Ga0495608_0425423 Ga0495608_0425423_230_793 154
31 3300046516 Ga0495628_0129629 Ga0495628_0129629_1337_1801 154
32 3300046533 Ga0495640_0125876 Ga0495640_0125876_100_564 154
33 3300046543 Ga0495645_0295070 Ga0495645_0295070_331_894 154
34 3300046559 Ga0495667_0244772 Ga0495667_0244772_261_824 154
35 3300046642 Ga0495634_0097664 Ga0495634_0097664_539_1102 154
36 3300046678 Ga0495599_0459269 Ga0495599_0459269_277_741 154
37 3300046689 Ga0495613_0658264 Ga0495613_0658264_195_659 154
38 3300046809 Ga0495600_0334602 Ga0495600_0334602_429_893 154
39 3300047322 Ga0495680_0066729 Ga0495680_0066729_176_739 154
40 3300047444 Ga0495675_0071966 Ga0495675_0071966_1475_1939 154
41 3300048088 Ga0495602_0194312 Ga0495602_0194312_1044_1508 154
42 3300050510 nmdc:mga06r32_867175_c1 nmdc:mga06r32_867175_c1_76_540 154
43 3300005334 Ga0068869_100450762 Ga0068869_1004507621 155
44 3300005445 Ga0070708_100097567 Ga0070708_1000975675 155
45 3300005445 Ga0070708_100115819 Ga0070708_1001158192 155
46 3300005445 Ga0070708_100962747 Ga0070708_1009627472 155
47 3300005467 Ga0070706_100450641 Ga0070706_1004506412 155
48 3300005471 Ga0070698_100005107 Ga0070698_10000510713 155
49 3300005518 Ga0070699_100069522 Ga0070699_1000695226 155
50 3300005536 Ga0070697_100023585 Ga0070697_1000235856 155
51 3300005536 Ga0070697_100089084 Ga0070697_1000890844 155
52 3300005549 Ga0070704_101164128 Ga0070704_1011641281 155
53 3300006177 Ga0075362_10047251 Ga0075362_100472513 155
54 3300006186 Ga0075369_10099345 Ga0075369_100993452 155
55 3300006914 Ga0075436_100062335 Ga0075436_1000623354 155
56 3300009093 Ga0105240_10015874 Ga0105240_100158748 155
57 3300010159 Ga0099796_10012051 Ga0099796_100120512 155
58 3300011119 Ga0105246_11729585 Ga0105246_117295851 155
59 3300021361 Ga0213872_10122881 Ga0213872_101228812 155
60 3300025294 Ga0209025_1042033 Ga0209025_10420333 155
61 3300025910 Ga0207684_10467669 Ga0207684_104676691 155
62 3300025910 Ga0207684_10493652 Ga0207684_104936522 155
63 3300025910 Ga0207684_10752784 Ga0207684_107527842 155
64 3300025922 Ga0207646_10932287 Ga0207646_109322872 155
65 3300025942 Ga0207689_10251764 Ga0207689_102517643 155
66 3300028794 Ga0307515_10174715 Ga0307515_101747153 155
67 3300031238 Ga0265332_10069010 Ga0265332_100690104 155
68 3300031240 Ga0265320_10169942 Ga0265320_101699422 155
69 3300031344 Ga0265316_10601423 Ga0265316_106014232 155
70 3300031456 Ga0307513_10542012 Ga0307513_105420121 155
71 3300032002 Ga0307416_100108430 Ga0307416_1001084305 155
72 3300035692 Ga0373935_0140053 Ga0373935_0140053_629_1096 155
73 3300035695 Ga0373927_0049431 Ga0373927_0049431_1049_1516 155
74 3300035725 Ga0373947_0137098 Ga0373947_0137098_670_1137 155
75 3300038443 Ga0395901_0201977 Ga0395901_0201977_1439_1906 155
76 3300039447 Ga0436361_0451565 Ga0436361_0451565_5312_5779 155
77 3300039447 Ga0436361_0571987 Ga0436361_0571987_1051_1518 155
78 3300045976 Ga0466967_1301368 Ga0466967_1301368_36_503 155
79 3300046460 Ga0495638_0180779 Ga0495638_0180779_544_1011 155
80 3300046512 Ga0495610_0037325 Ga0495610_0037325_200_667 155
81 3300048925 Ga0496122_0006060 Ga0496122_0006060_10560_11138 155
82 3300048926 Ga0496123_0008841 Ga0496123_0008841_2984_3562 155
83 3300048929 Ga0496126_0041144 Ga0496126_0041144_2527_2994 155
84 3300049569 Ga0501032_0078438 Ga0501032_0078438_1065_1532 155
85 3300049570 Ga0501033_0156597 Ga0501033_0156597_713_1180 155
86 3300049571 Ga0501034_0770084 Ga0501034_0770084_259_726 155
87 3300049572 Ga0501036_0339313 Ga0501036_0339313_27_494 155
88 3300049574 Ga0501038_0099664 Ga0501038_0099664_1083_1550 155
89 3300049574 Ga0501038_0618344 Ga0501038_0618344_137_604 155
90 3300049580 Ga0501046_0156899 Ga0501046_0156899_601_1068 155
91 3300049581 Ga0501047_0172834 Ga0501047_0172834_1061_1528 155
92 3300049581 Ga0501047_0347702 Ga0501047_0347702_637_1104 155
93 3300049742 Ga0501080_0740925 Ga0501080_0740925_334_801 155
94 3300049823 Ga0501044_0173501 Ga0501044_0173501_972_1439 155
95 3300049823 Ga0501044_0190735 Ga0501044_0190735_1216_1683 155
96 3300049823 Ga0501044_0287062 Ga0501044_0287062_948_1415 155
97 3300050489 nmdc:mga03683_23422_c1 nmdc:mga03683_23422_c1_887_1354 155
98 3300050493 nmdc:mga0k408_156656_c1 nmdc:mga0k408_156656_c1_475_942 155
99 3300050516 nmdc:mga0sz30_238457_c1 nmdc:mga0sz30_238457_c1_285_752 155
100 3300053093 Ga0500651_0126498 Ga0500651_0126498_616_1083 155
101 3300053096 Ga0500641_0001304 Ga0500641_0001304_557_1024 155
102 3300053103 Ga0500555_002559 Ga0500555_002559_3531_3998 155
103 3300053104 Ga0500556_0000119 Ga0500556_0000119_15283_15750 155
104 3300053156 Ga0500622_0008562 Ga0500622_0008562_1980_2447 155
105 3300053177 Ga0500636_0021633 Ga0500636_0021633_3054_3521 155
106 3300053730 Ga0500645_019644 Ga0500645_019644_813_1280 155
107 3300005339 Ga0070660_100025451 Ga0070660_1000254512 156
108 3300005563 Ga0068855_100045338 Ga0068855_1000453386 156
109 3300005563 Ga0068855_100161796 Ga0068855_1001617962 156
110 3300005985 Ga0081539_10001282 Ga0081539_1000128210 156
111 3300006051 Ga0075364_10006262 Ga0075364_100062626 156
112 3300009093 Ga0105240_10478450 Ga0105240_104784502 156
113 3300009551 Ga0105238_10159842 Ga0105238_101598422 156
114 3300013105 Ga0157369_10401107 Ga0157369_104011072 156
115 3300025904 Ga0207647_10307875 Ga0207647_103078751 156
116 3300025909 Ga0207705_10000988 Ga0207705_1000098821 156
117 3300025912 Ga0207707_10495532 Ga0207707_104955322 156
118 3300025919 Ga0207657_10000522 Ga0207657_100005222 156
119 3300025924 Ga0207694_10140720 Ga0207694_101407202 156
120 3300025949 Ga0207667_10218643 Ga0207667_102186432 156
121 3300025949 Ga0207667_10316631 Ga0207667_103166313 156
122 3300026067 Ga0207678_10124386 Ga0207678_101243862 156
123 3300037418 Ga0395900_0116359 Ga0395900_0116359_1570_2040 156
124 3300037466 Ga0395898_0411303 Ga0395898_0411303_265_735 156
125 3300038443 Ga0395901_0039328 Ga0395901_0039328_1883_2353 156
126 3300038443 Ga0395901_1885567 Ga0395901_1885567_37_507 156
127 3300039453 Ga0436362_0641575 Ga0436362_0641575_289_759 156
128 3300047443 Ga0495687_069245 Ga0495687_069245_317_787 156
129 3300049569 Ga0501032_0211064 Ga0501032_0211064_521_991 156
130 3300049571 Ga0501034_0127310 Ga0501034_0127310_1678_2148 156
131 3300049579 Ga0501043_0981554 Ga0501043_0981554_93_563 156
132 3300049580 Ga0501046_0549317 Ga0501046_0549317_305_775 156
133 3300049590 Ga0501074_0653622 Ga0501074_0653622_85_555 156
134 3300049822 Ga0501035_0086484 Ga0501035_0086484_2201_2671 156
135 3300049823 Ga0501044_0131848 Ga0501044_0131848_1161_1631 156
136 3300049823 Ga0501044_1111509 Ga0501044_1111509_26_496 156
137 3300050489 nmdc:mga03683_92616_c1 nmdc:mga03683_92616_c1_43_513 156
138 3300050491 nmdc:mga00v17_5034_c1 nmdc:mga00v17_5034_c1_55_525 156
139 3300005842 Ga0068858_100870852 Ga0068858_1008708522 157
140 3300005985 Ga0081539_10106084 Ga0081539_101060842 157
141 3300006038 Ga0075365_10019667 Ga0075365_100196675 157
142 3300006048 Ga0075363_100166321 Ga0075363_1001663212 157
143 3300006177 Ga0075362_10003088 Ga0075362_100030885 157
144 3300006178 Ga0075367_10002806 Ga0075367_100028065 157
145 3300006881 Ga0068865_101333593 Ga0068865_1013335932 157
146 3300009094 Ga0111539_11970921 Ga0111539_119709212 157
147 3300028786 Ga0307517_10460999 Ga0307517_104609991 157
148 3300035691 Ga0373931_0064304 Ga0373931_0064304_1473_1946 157
149 3300050489 nmdc:mga03683_4592_c1 nmdc:mga03683_4592_c1_747_1220 157
150 3300050490 nmdc:mga03n38_36338_c1 nmdc:mga03n38_36338_c1_535_1008 157
151 3300050492 nmdc:mga0yw44_7104_c1 nmdc:mga0yw44_7104_c1_3888_4361 157
152 3300050494 nmdc:mga06z11_131499_c1 nmdc:mga06z11_131499_c1_876_1349 157
153 3300053078 Ga0495612_0491841 Ga0495612_0491841_16_489 157
154 3300005327 Ga0070658_10426902 Ga0070658_104269021 158
155 3300005329 Ga0070683_100371401 Ga0070683_1003714012 158
156 3300005338 Ga0068868_100054268 Ga0068868_1000542683 158
157 3300005339 Ga0070660_100062622 Ga0070660_1000626224 158
158 3300005344 Ga0070661_100255005 Ga0070661_1002550052 158
159 3300005364 Ga0070673_100740538 Ga0070673_1007405381 158
160 3300005366 Ga0070659_100020949 Ga0070659_1000209496 158
161 3300005456 Ga0070678_100666258 Ga0070678_1006662581 158
162 3300005535 Ga0070684_100252301 Ga0070684_1002523012 158
163 3300005539 Ga0068853_100028237 Ga0068853_1000282374 158
164 3300005543 Ga0070672_101359143 Ga0070672_1013591432 158
165 3300005563 Ga0068855_100123008 Ga0068855_1001230084 158
166 3300005564 Ga0070664_100032151 Ga0070664_1000321514 158
167 3300005577 Ga0068857_100113369 Ga0068857_1001133693 158
168 3300005578 Ga0068854_100035041 Ga0068854_1000350412 158
169 3300005578 Ga0068854_100067210 Ga0068854_1000672103 158
170 3300005616 Ga0068852_100019264 Ga0068852_1000192646 158
171 3300005981 Ga0081538_10011440 Ga0081538_100114407 158
172 3300006038 Ga0075365_10016677 Ga0075365_100166772 158
173 3300006038 Ga0075365_10136404 Ga0075365_101364043 158
174 3300006051 Ga0075364_10289894 Ga0075364_102898942 158
175 3300006177 Ga0075362_10004572 Ga0075362_100045725 158
176 3300006178 Ga0075367_10092353 Ga0075367_100923533 158
177 3300006186 Ga0075369_10000525 Ga0075369_1000052511 158
178 3300006195 Ga0075366_10137580 Ga0075366_101375804 158
179 3300006195 Ga0075366_10170521 Ga0075366_101705212 158
180 3300006353 Ga0075370_10046105 Ga0075370_100461052 158
181 3300006881 Ga0068865_100236351 Ga0068865_1002363512 158
182 3300009093 Ga0105240_10038719 Ga0105240_100387193 158
183 3300009101 Ga0105247_10648338 Ga0105247_106483382 158
184 3300009174 Ga0105241_10065635 Ga0105241_100656352 158
185 3300009545 Ga0105237_10005719 Ga0105237_100057196 158
186 3300009545 Ga0105237_11288173 Ga0105237_112881732 158
187 3300009551 Ga0105238_10026734 Ga0105238_100267344 158
188 3300010375 Ga0105239_10000061 Ga0105239_1000006151 158
189 3300010375 Ga0105239_10079246 Ga0105239_100792464 158
190 3300013100 Ga0157373_10222301 Ga0157373_102223012 158
191 3300013307 Ga0157372_10056762 Ga0157372_100567624 158
192 3300013308 Ga0157375_12815508 Ga0157375_128155081 158
193 3300014497 Ga0182008_10589092 Ga0182008_105890921 158
194 3300017792 Ga0163161_10031026 Ga0163161_100310263 158
195 3300017792 Ga0163161_11120429 Ga0163161_111204291 158
196 3300025907 Ga0207645_10166913 Ga0207645_101669132 158
197 3300025909 Ga0207705_10089421 Ga0207705_100894214 158
198 3300025911 Ga0207654_10384418 Ga0207654_103844182 158
199 3300025913 Ga0207695_10046580 Ga0207695_100465803 158
200 3300025914 Ga0207671_10012049 Ga0207671_100120493 158
201 3300025919 Ga0207657_10023890 Ga0207657_100238906 158
202 3300025924 Ga0207694_10136632 Ga0207694_101366322 158
203 3300025926 Ga0207659_10650761 Ga0207659_106507612 158
204 3300025932 Ga0207690_10323209 Ga0207690_103232092 158
205 3300025938 Ga0207704_10467269 Ga0207704_104672692 158
206 3300025940 Ga0207691_10073771 Ga0207691_100737712 158
207 3300025949 Ga0207667_10334661 Ga0207667_103346612 158
208 3300025972 Ga0207668_10830343 Ga0207668_108303431 158
209 3300026041 Ga0207639_10109120 Ga0207639_101091202 158
210 3300026067 Ga0207678_10124681 Ga0207678_101246812 158
211 3300026078 Ga0207702_10160682 Ga0207702_101606824 158
212 3300026089 Ga0207648_10014268 Ga0207648_100142688 158
213 3300026116 Ga0207674_10748775 Ga0207674_107487752 158
214 3300026142 Ga0207698_10775644 Ga0207698_107756442 158
215 3300035084 Ga0373928_0120752 Ga0373928_0120752_88_564 158
216 3300035114 Ga0373939_0079704 Ga0373939_0079704_77_553 158
217 3300035115 Ga0373941_0268057 Ga0373941_0268057_92_568 158
218 3300035121 Ga0373960_0113565 Ga0373960_0113565_326_802 158
219 3300035242 Ga0373962_0239248 Ga0373962_0239248_85_561 158
220 3300035691 Ga0373931_0071494 Ga0373931_0071494_383_859 158
221 3300037068 Ga0373925_0124005 Ga0373925_0124005_178_654 158
222 3300037471 Ga0395905_0195883 Ga0395905_0195883_622_1098 158
223 3300041507 Ga0451851_1029190 Ga0451851_1029190_169_645 158
224 3300046810 Ga0495660_0136727 Ga0495660_0136727_445_921 158
225 3300047320 Ga0495672_0036395 Ga0495672_0036395_1861_2337 158
226 3300047470 Ga0495681_0000043 Ga0495681_0000043_58243_58719 158
227 3300047472 Ga0495686_0047343 Ga0495686_0047343_294_770 158
228 3300048920 Ga0496117_0006202 Ga0496117_0006202_8372_8848 158
229 3300048920 Ga0496117_0027766 Ga0496117_0027766_611_1087 158
230 3300048920 Ga0496117_0121340 Ga0496117_0121340_652_1128 158
231 3300048921 Ga0496118_0032215 Ga0496118_0032215_2065_2541 158
232 3300048921 Ga0496118_0230973 Ga0496118_0230973_191_667 158
233 3300048922 Ga0496119_0257849 Ga0496119_0257849_338_814 158
234 3300048924 Ga0496121_0000584 Ga0496121_0000584_38634_39110 158
235 3300048927 Ga0496124_0176611 Ga0496124_0176611_162_638 158
236 3300048928 Ga0496125_0587581 Ga0496125_0587581_58_534 158
237 3300048929 Ga0496126_0006167 Ga0496126_0006167_3557_4033 158
238 3300049459 Ga0495678_022000 Ga0495678_022000_85_561 158
239 3300050489 nmdc:mga03683_9546_c1 nmdc:mga03683_9546_c1_790_1266 158
240 3300050490 nmdc:mga03n38_175552_c1 nmdc:mga03n38_175552_c1_97_573 158
241 3300050491 nmdc:mga00v17_78574_c1 nmdc:mga00v17_78574_c1_557_1069 158
242 3300050492 nmdc:mga0yw44_170709_c1 nmdc:mga0yw44_170709_c1_505_1017 158
243 3300050492 nmdc:mga0yw44_40821_c1 nmdc:mga0yw44_40821_c1_1943_2419 158
244 3300050493 nmdc:mga0k408_88783_c1 nmdc:mga0k408_88783_c1_610_1086 158
245 3300050494 nmdc:mga06z11_5395_c1 nmdc:mga06z11_5395_c1_559_1035 158
246 3300050494 nmdc:mga06z11_887628_c1 nmdc:mga06z11_887628_c1_41_517 158
247 3300050496 nmdc:mga07m45_43136_c1 nmdc:mga07m45_43136_c1_238_714 158
248 3300050516 nmdc:mga0sz30_402_c1 nmdc:mga0sz30_402_c1_7403_7879 158
249 3300053156 Ga0500622_0089941 Ga0500622_0089941_766_1242 158
250 3300031730 Ga0307516_10119674 Ga0307516_101196743 159
251 3300031731 Ga0307405_10142431 Ga0307405_101424312 159
252 3300032004 Ga0307414_10078772 Ga0307414_100787722 159
253 3300035114 Ga0373939_0135952 Ga0373939_0135952_271_768 159
254 3300046460 Ga0495638_0208729 Ga0495638_0208729_570_1049 159
255 3300046660 Ga0495625_0019688 Ga0495625_0019688_532_1011 159
256 3300047472 Ga0495686_0101665 Ga0495686_0101665_1050_1529 159
257 3300049758 Ga0501241_007322 Ga0501241_007322_775_1254 159
258 3300053098 Ga0500650_0348368 Ga0500650_0348368_132_611 159
259 3300053104 Ga0500556_0000076 Ga0500556_0000076_56342_56821 159
260 3300053124 Ga0500617_111371 Ga0500617_111371_337_816 159
261 3300053130 Ga0500642_0000001 Ga0500642_0000001_1327759_1328238 159
262 3300053730 Ga0500645_000625 Ga0500645_000625_15983_16462 159
263 3300009093 Ga0105240_11036444 Ga0105240_110364441 160
264 3300009545 Ga0105237_10200808 Ga0105237_102008082 160
265 3300009551 Ga0105238_10037952 Ga0105238_100379523 160
266 3300025914 Ga0207671_10277216 Ga0207671_102772162 160
267 3300025924 Ga0207694_10027415 Ga0207694_100274152 160
268 3300025929 Ga0207664_10757175 Ga0207664_107571752 160
269 3300031852 Ga0307410_10158054 Ga0307410_101580542 160
270 3300031852 Ga0307410_10180088 Ga0307410_101800882 160
271 3300031852 Ga0307410_10489382 Ga0307410_104893822 160
272 3300031903 Ga0307407_10235984 Ga0307407_102359842 160
273 3300031995 Ga0307409_100300004 Ga0307409_1003000042 160
274 3300031995 Ga0307409_100503336 Ga0307409_1005033362 160
275 3300032004 Ga0307414_10050117 Ga0307414_100501173 160
276 3300032005 Ga0307411_10016057 Ga0307411_100160572 160
277 3300032005 Ga0307411_10428140 Ga0307411_104281402 160
278 3300032126 Ga0307415_100226368 Ga0307415_1002263682 160
279 3300033180 Ga0307510_10352202 Ga0307510_103522022 160
280 3300035113 Ga0373936_0028315 Ga0373936_0028315_1686_2168 160
281 3300025297 Ga0209758_1048321 Ga0209758_10483211 161
282 3300028800 Ga0265338_10168032 Ga0265338_101680323 161
283 3300031241 Ga0265325_10001807 Ga0265325_1000180710 161
284 3300031247 Ga0265340_10217723 Ga0265340_102177232 161
285 3300031344 Ga0265316_10073513 Ga0265316_100735133 161
286 3300031595 Ga0265313_10052214 Ga0265313_100522143 161
287 3300031711 Ga0265314_10039480 Ga0265314_100394802 161
288 3300031712 Ga0265342_10044371 Ga0265342_100443713 161
289 3300031824 Ga0307413_11003701 Ga0307413_110037012 161
290 3300044693 Ga0466961_0208567 Ga0466961_0208567_216_719 161
291 3300005539 Ga0068853_100007846 Ga0068853_1000078464 162
292 3300009545 Ga0105237_10677506 Ga0105237_106775062 162
293 3300025909 Ga0207705_10182174 Ga0207705_101821741 162
294 3300026041 Ga0207639_10010574 Ga0207639_100105744 162
295 3300049568 Ga0501031_0591470 Ga0501031_0591470_134_622 162
296 3300049570 Ga0501033_0600974 Ga0501033_0600974_44_532 162
297 3300049572 Ga0501036_0046139 Ga0501036_0046139_2750_3238 162
298 3300049573 Ga0501037_0387820 Ga0501037_0387820_86_574 162
299 3300049574 Ga0501038_0208581 Ga0501038_0208581_991_1479 162
300 3300049579 Ga0501043_0044415 Ga0501043_0044415_663_1151 162
301 3300049580 Ga0501046_0410661 Ga0501046_0410661_423_911 162
302 3300049581 Ga0501047_0029914 Ga0501047_0029914_2503_2991 162
303 3300049586 Ga0501070_0219589 Ga0501070_0219589_86_574 162
304 3300049589 Ga0501073_0061095 Ga0501073_0061095_1993_2481 162
305 3300049590 Ga0501074_0191526 Ga0501074_0191526_825_1313 162
306 3300049742 Ga0501080_0175083 Ga0501080_0175083_712_1200 162
307 3300049823 Ga0501044_0031558 Ga0501044_0031558_3017_3505 162
308 3300005841 Ga0068863_100006355 Ga0068863_1000063552 163
309 3300053142 Ga0500577_0000174 Ga0500577_0000174_3480_3977 165
310 3300003911 JGI25405J52794_10042996 JGI25405J52794_100429961 167
311 3300005937 Ga0081455_10004676 Ga0081455_1000467615 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

56

174

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wdv-assembly2.cif.gz_B crystal structure of hypothetical protein ape2540 0.9263 5 152
3rij-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9262 3 152
2cx5-assembly3.cif.gz_C crystal structure of a putative trans-editing enzyme for prolyl trna synthetase 0.9208 3 152
3ri0-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9157 3 152
3ri0-assembly1.cif.gz_A epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9119 3 152
ID Description Score Start End Superfamily
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9195 5 152 3.90.960.10
af_Q4D973_68_232_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9171 2 152 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9079 5 152 3.90.960.10
af_P64483_2_166_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8898 2 152 3.90.960.10
3rijC00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.886 3 152 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A4R3Q6G0-F1-model_v4 deleted 0.9962 2 152
AF-A0A4S0QC41-F1-model_v4 YbaK/EbsC family protein 0.9952 56 152 GO:0002161
AF-W1HVC4-F1-model_v4 deleted 0.9924 43 152
AF-A9MRC3-F1-model_v4 YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein 0.9917 1 152 GO:0002161
AF-A0A2X5NU96-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase ybaK 0.9916 32 152 GO:0002161

Feature Viewer

pLDDT pTM Quality
89.96 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map