F401387

General Info

Members Datasets Scaffolds Average Seq Length
311 160 310 199

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0028363|Ga0495672_0028363_2620_3297
Length 225
Sequence LAQLLINLLKKPAGRKKLKINYMRKITVLTMITLDGVLQAPGGPKEDTSGRFKYGGWTAPYGDEAYSKVVQKELKTATDYLLGRKTFEIWAGYWPEHGDFWPGINEGTKYVFSKNMKKSDPIITGWKKSIVIKNVADIKKLKKSKGPDIQVWGSSKLIQLLLKNDLVDELRLKIHPLTLGNGKKLFNNGTIPAAFTLMDSIVTSKGVIIVSYKRAGKVKTGTVGA

Samples

Sample ID Description Type Environment
1 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
133 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
134 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
135 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0
Rhizoplane 0.64
Rhizosphere 95.18
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10004462 3300003322 Bacteria 1578
2 rootL2_10008241 3300003322 Unclassified 2156
3 Ga0065704_10223544 3300005289 Bacteria 1066
4 Ga0065712_10071173 3300005290 Bacteria 5439
5 Ga0065712_10282717 3300005290 Bacteria 874
6 Ga0065712_10412770 3300005290 Bacteria 719
7 Ga0070658_10001614 3300005327 Bacteria 19070
8 Ga0070658_10092299 3300005327 Bacteria 2496
9 Ga0070676_10123414 3300005328 Bacteria 1629
10 Ga0070676_10182922 3300005328 Bacteria 1364
11 Ga0070683_100010096 3300005329 Bacteria 8101
12 Ga0070690_100032549 3300005330 Bacteria 3258
13 Ga0070670_100874785 3300005331 Bacteria 814
14 Ga0068869_100029859 3300005334 Bacteria 3822
15 Ga0070666_10000042 3300005335 Bacteria 112296
16 Ga0070666_10019411 3300005335 Bacteria 4387
17 Ga0070680_100234769 3300005336 Bacteria 1549
18 Ga0070680_100253969 3300005336 Bacteria 1487
19 Ga0070680_100442985 3300005336 Bacteria 1109
20 Ga0070682_100217566 3300005337 Bacteria 1358
21 Ga0068868_100011877 3300005338 Bacteria 6349
22 Ga0068868_100045700 3300005338 Bacteria 3427
23 Ga0070660_100029501 3300005339 Bacteria 4112
24 Ga0070689_100038671 3300005340 Bacteria 3651
25 Ga0070689_100240205 3300005340 Bacteria 1492
26 Ga0070689_100290955 3300005340 Bacteria 1357
27 Ga0070689_100764030 3300005340 Bacteria 848
28 Ga0070687_100021071 3300005343 Bacteria 3057
29 Ga0070687_100091203 3300005343 Bacteria 1686
30 Ga0070661_100001575 3300005344 Bacteria 15817
31 Ga0070661_100170623 3300005344 Bacteria 1652
32 Ga0070668_100372296 3300005347 Bacteria 1214
33 Ga0070669_100483808 3300005353 Bacteria 1025
34 Ga0070671_100360449 3300005355 Unclassified 1241
35 Ga0070671_101232862 3300005355 Bacteria 659
36 Ga0070673_100099673 3300005364 Bacteria 2390
37 Ga0070673_100203878 3300005364 Bacteria 1704
38 Ga0070659_100046549 3300005366 Bacteria 3400
39 Ga0070667_100030009 3300005367 Bacteria 4535
40 Ga0070667_100188830 3300005367 Bacteria 1825
41 Ga0070667_100213764 3300005367 Bacteria 1715
42 Ga0070667_100734416 3300005367 Bacteria 915
43 Ga0070663_100384631 3300005455 Bacteria 1144
44 Ga0070662_100051116 3300005457 Bacteria 2983
45 Ga0070662_100200109 3300005457 Bacteria 1584
46 Ga0070662_100845830 3300005457 Bacteria 779
47 Ga0070681_10323761 3300005458 Bacteria 1451
48 Ga0068867_100232541 3300005459 Bacteria 1491
49 Ga0068867_100543975 3300005459 Bacteria 1005
50 Ga0070685_10020865 3300005466 Bacteria 3551
51 Ga0070679_100002897 3300005530 Bacteria 15586
52 Ga0070684_100047554 3300005535 Bacteria 3717
53 Ga0070684_100503571 3300005535 Bacteria 1122
54 Ga0070684_101341904 3300005535 Bacteria 673
55 Ga0068853_100001770 3300005539 Bacteria 15876
56 Ga0068853_100085615 3300005539 Bacteria 2763
57 Ga0068853_100785633 3300005539 Bacteria 911
58 Ga0070686_100040959 3300005544 Bacteria 2892
59 Ga0070686_100853357 3300005544 Bacteria 738
60 Ga0070693_100144426 3300005547 Unclassified 1501
61 Ga0070693_100265310 3300005547 Bacteria 1144
62 Ga0070693_100547278 3300005547 Bacteria 828
63 Ga0070665_100263958 3300005548 Bacteria 1723
64 Ga0070664_100004100 3300005564 Bacteria 11701
65 Ga0068857_100051054 3300005577 Bacteria 3667
66 Ga0068854_100014699 3300005578 Bacteria 5165
67 Ga0068854_100327778 3300005578 Bacteria 1247
68 Ga0068852_100003800 3300005616 Bacteria 10597
69 Ga0068852_100012047 3300005616 Bacteria 6545
70 Ga0068852_100080329 3300005616 Bacteria 2891
71 Ga0068852_100080971 3300005616 Bacteria 2881
72 Ga0068852_100735717 3300005616 Bacteria 998
73 Ga0068859_100000768 3300005617 Bacteria 32376
74 Ga0068859_100015256 3300005617 Bacteria 7716
75 Ga0068859_100037557 3300005617 Bacteria 4861
76 Ga0068859_100240463 3300005617 Bacteria 1899
77 Ga0068864_100082025 3300005618 Bacteria 2829
78 Ga0068861_100052171 3300005719 Bacteria 3108
79 Ga0068861_100444180 3300005719 Bacteria 1161
80 Ga0068851_10000330 3300005834 Bacteria 21529
81 Ga0068851_10094735 3300005834 Bacteria 1577
82 Ga0068863_100009065 3300005841 Bacteria 9715
83 Ga0068863_100128182 3300005841 Bacteria 2421
84 Ga0068863_100145497 3300005841 Bacteria 2266
85 Ga0068863_100147532 3300005841 Bacteria 2250
86 Ga0068863_100292021 3300005841 Bacteria 1580
87 Ga0068858_100066234 3300005842 Bacteria 3343
88 Ga0068858_100378691 3300005842 Bacteria 1358
89 Ga0068860_100001707 3300005843 Bacteria 23468
90 Ga0068860_100059558 3300005843 Bacteria 3629
91 Ga0068860_100083787 3300005843 Bacteria 3033
92 Ga0068860_100784324 3300005843 Bacteria 966
93 Ga0068862_100152151 3300005844 Bacteria 2060
94 Ga0070715_10016818 3300006163 Bacteria 2757
95 Ga0070715_10045234 3300006163 Bacteria 1865
96 Ga0075366_10001550 3300006195 Bacteria 11493
97 Ga0075366_10110642 3300006195 Bacteria 1652
98 Ga0097621_100013530 3300006237 Bacteria 6084
99 Ga0097621_100055710 3300006237 Bacteria 3229
100 Ga0097621_100319979 3300006237 Bacteria 1374
101 Ga0097621_101063687 3300006237 Bacteria 758
102 Ga0068871_100011948 3300006358 Bacteria 6391
103 Ga0068871_100063065 3300006358 Bacteria 3030
104 Ga0068871_100263580 3300006358 Bacteria 1504
105 Ga0068871_100949480 3300006358 Bacteria 799
106 Ga0075428_100212120 3300006844 Bacteria 2092
107 Ga0068865_100107194 3300006881 Bacteria 2055
108 Ga0097620_100000768 3300006931 Bacteria 32376
109 Ga0097620_100015256 3300006931 Bacteria 7716
110 Ga0097620_100037557 3300006931 Bacteria 4861
111 Ga0097620_100240479 3300006931 Bacteria 1899
112 Ga0105240_10001190 3300009093 Bacteria 45471
113 Ga0105240_10325813 3300009093 Bacteria 1749
114 Ga0105241_10000853 3300009174 Bacteria 23134
115 Ga0105241_10171896 3300009174 Bacteria 1790
116 Ga0105241_10321103 3300009174 Bacteria 1335
117 Ga0105242_10066940 3300009176 Bacteria 2968
118 Ga0105242_10101319 3300009176 Bacteria 2440
119 Ga0105242_10172478 3300009176 Bacteria 1902
120 Ga0105242_10800037 3300009176 Bacteria 933
121 Ga0105242_10950092 3300009176 Bacteria 864
122 Ga0105242_11240169 3300009176 Bacteria 767
123 Ga0105248_10174783 3300009177 Bacteria 2421
124 Ga0105237_10000833 3300009545 Bacteria 42120
125 Ga0105237_10124870 3300009545 Bacteria 2568
126 Ga0105249_10001650 3300009553 Bacteria 19547
127 Ga0105249_10002726 3300009553 Bacteria 15275
128 Ga0105249_10162644 3300009553 Bacteria 2158
129 Ga0105239_10019904 3300010375 Bacteria 7407
130 Ga0105239_10448227 3300010375 Bacteria 1464
131 Ga0105239_10454463 3300010375 Bacteria 1453
132 Ga0105246_10003384 3300011119 Bacteria 9663
133 Ga0105246_10024300 3300011119 Bacteria 3935
134 Ga0105246_10306054 3300011119 Bacteria 1285
135 Ga0157373_10027326 3300013100 Bacteria 4116
136 Ga0157373_10095795 3300013100 Bacteria 2089
137 Ga0157371_10134170 3300013102 Bacteria 1763
138 Ga0157369_10161940 3300013105 Bacteria 2362
139 Ga0157369_11104665 3300013105 Bacteria 810
140 Ga0157374_10317536 3300013296 Unclassified 1543
141 Ga0157374_10874571 3300013296 Bacteria 916
142 Ga0157378_10073750 3300013297 Unclassified 3069
143 Ga0157378_10083322 3300013297 Bacteria 2893
144 Ga0157378_10588883 3300013297 Bacteria 1122
145 Ga0163162_10025120 3300013306 Bacteria 5888
146 Ga0163162_10054907 3300013306 Bacteria 4008
147 Ga0163162_10335311 3300013306 Bacteria 1645
148 Ga0157372_10000683 3300013307 Bacteria 37283
149 Ga0157372_10562779 3300013307 Bacteria 1329
150 Ga0157372_10639775 3300013307 Bacteria 1239
151 Ga0157372_11246969 3300013307 Bacteria 859
152 Ga0157375_10033149 3300013308 Bacteria 4905
153 Ga0157375_10211795 3300013308 Bacteria 2095
154 Ga0157375_10358342 3300013308 Bacteria 1625
155 Ga0157375_10835293 3300013308 Bacteria 1068
156 Ga0163163_10341892 3300014325 Bacteria 1552
157 Ga0163163_10734176 3300014325 Bacteria 1051
158 Ga0163163_11032066 3300014325 Bacteria 886
159 Ga0157380_10301054 3300014326 Bacteria 1477
160 Ga0157380_10381624 3300014326 Bacteria 1330
161 Ga0157377_10013010 3300014745 Bacteria 4201
162 Ga0157379_10738155 3300014968 Bacteria 926
163 Ga0157376_10051608 3300014969 Bacteria 3417
164 Ga0157376_10100474 3300014969 Bacteria 2526
165 Ga0157376_10142939 3300014969 Bacteria 2149
166 Ga0157376_10250581 3300014969 Bacteria 1653
167 Ga0163161_10010043 3300017792 Bacteria 6554
168 Ga0163161_10028739 3300017792 Bacteria 3949
169 Ga0163161_10289904 3300017792 Bacteria 1286
170 Ga0207426_1000002 3300025302 Bacteria 1249660
171 Ga0207656_10000197 3300025321 Bacteria 21633
172 Ga0207688_10457810 3300025901 Bacteria 796
173 Ga0207680_10000448 3300025903 Bacteria 19470
174 Ga0207680_10443268 3300025903 Bacteria 921
175 Ga0207685_10078228 3300025905 Bacteria 1361
176 Ga0207645_10013783 3300025907 Bacteria 5424
177 Ga0207705_10002124 3300025909 Bacteria 15378
178 Ga0207705_10118878 3300025909 Bacteria 1959
179 Ga0207654_10013270 3300025911 Bacteria 4236
180 Ga0207654_10206714 3300025911 Bacteria 1296
181 Ga0207707_10109298 3300025912 Bacteria 2417
182 Ga0207707_10132747 3300025912 Bacteria 2177
183 Ga0207695_10000039 3300025913 Bacteria 454801
184 Ga0207671_10009669 3300025914 Bacteria 8031
185 Ga0207671_10073130 3300025914 Bacteria 2560
186 Ga0207671_10506177 3300025914 Bacteria 963
187 Ga0207660_10020274 3300025917 Bacteria 4458
188 Ga0207660_10231381 3300025917 Bacteria 1453
189 Ga0207662_10131201 3300025918 Bacteria 1580
190 Ga0207662_10222033 3300025918 Bacteria 1231
191 Ga0207657_10019311 3300025919 Bacteria 6476
192 Ga0207649_10005637 3300025920 Bacteria 6775
193 Ga0207649_10234708 3300025920 Bacteria 1313
194 Ga0207652_10000768 3300025921 Bacteria 30720
195 Ga0207644_10074215 3300025931 Bacteria 2496
196 Ga0207644_10653851 3300025931 Bacteria 875
197 Ga0207706_10010475 3300025933 Bacteria 8471
198 Ga0207706_10071782 3300025933 Bacteria 3045
199 Ga0207706_10819825 3300025933 Bacteria 789
200 Ga0207686_10000793 3300025934 Bacteria 19399
201 Ga0207686_10512125 3300025934 Bacteria 933
202 Ga0207686_10628343 3300025934 Bacteria 848
203 Ga0207670_10109205 3300025936 Bacteria 1990
204 Ga0207670_10365686 3300025936 Bacteria 1145
205 Ga0207669_10067624 3300025937 Bacteria 2228
206 Ga0207669_10069749 3300025937 Bacteria 2201
207 Ga0207704_10055389 3300025938 Bacteria 2423
208 Ga0207691_10274068 3300025940 Bacteria 1452
209 Ga0207689_10008911 3300025942 Bacteria 8701
210 Ga0207689_10021899 3300025942 Bacteria 5375
211 Ga0207689_10036403 3300025942 Bacteria 4086
212 Ga0207689_10038760 3300025942 Bacteria 3945
213 Ga0207661_10293603 3300025944 Bacteria 1455
214 Ga0207679_10058769 3300025945 Bacteria 2851
215 Ga0207667_10557014 3300025949 Bacteria 1159
216 Ga0207667_10595993 3300025949 Bacteria 1115
217 Ga0207651_10126863 3300025960 Bacteria 1946
218 Ga0207651_10168375 3300025960 Bacteria 1725
219 Ga0207651_11040361 3300025960 Bacteria 733
220 Ga0207712_10001133 3300025961 Bacteria 18560
221 Ga0207712_10108346 3300025961 Bacteria 2079
222 Ga0207712_10319984 3300025961 Bacteria 1279
223 Ga0207640_10031980 3300025981 Bacteria 3259
224 Ga0207658_10140244 3300025986 Bacteria 1955
225 Ga0207658_10149251 3300025986 Bacteria 1902
226 Ga0207658_10202248 3300025986 Bacteria 1659
227 Ga0207658_10495293 3300025986 Bacteria 1088
228 Ga0207677_10391189 3300026023 Bacteria 1176
229 Ga0207677_10576363 3300026023 Bacteria 984
230 Ga0207703_10006254 3300026035 Bacteria 9523
231 Ga0207639_10128558 3300026041 Bacteria 2094
232 Ga0207639_10284886 3300026041 Bacteria 1454
233 Ga0207639_11460695 3300026041 Bacteria 642
234 Ga0207678_10161683 3300026067 Bacteria 1912
235 Ga0207702_10144818 3300026078 Bacteria 2155
236 Ga0207641_10000368 3300026088 Bacteria 53493
237 Ga0207641_10005736 3300026088 Bacteria 10545
238 Ga0207676_10323393 3300026095 Bacteria 1417
239 Ga0207674_10004912 3300026116 Bacteria 15987
240 Ga0207675_100110326 3300026118 Bacteria 2596
241 Ga0207675_100239392 3300026118 Unclassified 1753
242 Ga0207675_100492450 3300026118 Bacteria 1220
243 Ga0207698_10002653 3300026142 Bacteria 10637
244 Ga0207698_10004090 3300026142 Bacteria 8854
245 Ga0207698_10061191 3300026142 Bacteria 2933
246 Ga0207698_10358490 3300026142 Bacteria 1380
247 Ga0207698_10669487 3300026142 Bacteria 1030
248 Ga0268265_10683737 3300028380 Bacteria 990
249 Ga0268265_10855253 3300028380 Bacteria 890
250 Ga0268264_10002457 3300028381 Bacteria 16284
251 Ga0268264_10395018 3300028381 Bacteria 1327
252 Ga0268264_10411666 3300028381 Bacteria 1302
253 Ga0268264_10558528 3300028381 Bacteria 1124
254 Ga0307515_10000002 3300028794 Bacteria 1231751
255 Ga0265327_10010853 3300031251 Bacteria 6348
256 Ga0265327_10015738 3300031251 Bacteria 4859
257 Ga0307414_10000016 3300032004 Bacteria 249029
258 Ga0307414_10586847 3300032004 Bacteria 998
259 Ga0307414_10742304 3300032004 Bacteria 892
260 Ga0307414_10828237 3300032004 Bacteria 845
261 Ga0373947_0047414 3300035725 Bacteria 2575
262 Ga0373937_0296846 3300036401 Bacteria 1527
263 Ga0373937_1288335 3300036401 Bacteria 679
264 Ga0395899_0114501 3300037312 Unclassified 1936
265 Ga0395899_0285785 3300037312 Bacteria 1120
266 Ga0395900_0224956 3300037418 Bacteria 1889
267 Ga0395900_0289054 3300037418 Unclassified 1628
268 Ga0395898_0138152 3300037466 Unclassified 2333
269 Ga0395898_0200854 3300037466 Bacteria 1903
270 Ga0395898_0976913 3300037466 Bacteria 783
271 Ga0395905_0001555 3300037471 Bacteria 27418
272 Ga0395901_0134469 3300038443 Bacteria 2599
273 Ga0395901_0147077 3300038443 Bacteria 2476
274 Ga0436365_0010910 3300039437 Bacteria 2468
275 Ga0451807_1035199 3300041486 Unclassified 941
276 Ga0451843_1063484 3300041509 Bacteria 711
277 Ga0439454_038792 3300042011 Bacteria 773
278 Ga0450894_008015 3300042131 Bacteria 1365
279 Ga0450898_006538 3300042134 Bacteria 1792
280 Ga0451577_0313638 3300042876 Bacteria 1422
281 Ga0451577_0707696 3300042876 Bacteria 912
282 Ga0453683_0000090 3300044673 Bacteria 137022
283 Ga0453683_0002145 3300044673 Bacteria 15718
284 Ga0453683_0406944 3300044673 Bacteria 877
285 Ga0453684_0001905 3300044712 Bacteria 54154
286 Ga0453684_0104662 3300044712 Bacteria 3454
287 Ga0451576_0032928 3300045051 Bacteria 5511
288 Ga0495638_0287513 3300046460 Bacteria 891
289 Ga0495639_0352357 3300046475 Bacteria 739
290 Ga0495630_0885886 3300046517 Bacteria 680
291 Ga0495586_0462813 3300046535 Bacteria 731
292 Ga0495645_0554388 3300046543 Bacteria 712
293 Ga0495634_0349868 3300046642 Bacteria 885
294 Ga0495635_0162320 3300046663 Bacteria 1521
295 Ga0495658_0526482 3300046683 Bacteria 757
296 Ga0495600_0315648 3300046809 Bacteria 984
297 Ga0495672_0028363 3300047320 Bacteria 3544
298 Ga0495676_0099121 3300047321 Bacteria 2160
299 Ga0495686_0026406 3300047472 Unclassified 3799
300 Ga0496115_0002270 3300048918 Bacteria 13755
301 Ga0501034_0015190 3300049571 Bacteria 7915
302 Ga0501209_162639 3300049656 Bacteria 676
303 Ga0501044_0419037 3300049823 Bacteria 1249
304 nmdc:mga0k408_3656_c1 3300050493 Bacteria 8138
305 nmdc:mga0k408_37528_c1 3300050493 Bacteria 2782
306 nmdc:mga08y16_142949_c1 3300050511 Bacteria 2487
307 nmdc:mga08y16_708958_c1 3300050511 Bacteria 1005
308 Ga0500562_000038 3300053108 Bacteria 72186
309 Ga0500568_0000231 3300053139 Bacteria 47879
310 Ga0500622_0000340 3300053156 Bacteria 45986

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026041 Ga0207639_11460695 Ga0207639_114606951 177
2 3300005340 Ga0070689_100240205 Ga0070689_1002402051 182
3 3300005343 Ga0070687_100021071 Ga0070687_1000210712 182
4 3300005616 Ga0068852_100735717 Ga0068852_1007357171 182
5 3300025918 Ga0207662_10222033 Ga0207662_102220332 182
6 3300025936 Ga0207670_10109205 Ga0207670_101092052 182
7 3300026142 Ga0207698_10669487 Ga0207698_106694871 182
8 3300036401 Ga0373937_1288335 Ga0373937_1288335_12_575 182
9 3300037466 Ga0395898_0976913 Ga0395898_0976913_206_769 182
10 3300042011 Ga0439454_038792 Ga0439454_038792_196_759 182
11 3300044673 Ga0453683_0406944 Ga0453683_0406944_291_863 182
12 3300013296 Ga0157374_10874571 Ga0157374_108745711 184
13 3300003322 rootL2_10008241 rootL2_100082411 188
14 3300005327 Ga0070658_10001614 Ga0070658_1000161410 189
15 3300005327 Ga0070658_10092299 Ga0070658_100922992 189
16 3300005328 Ga0070676_10123414 Ga0070676_101234143 189
17 3300005328 Ga0070676_10182922 Ga0070676_101829222 189
18 3300005329 Ga0070683_100010096 Ga0070683_10001009611 189
19 3300005331 Ga0070670_100874785 Ga0070670_1008747851 189
20 3300005334 Ga0068869_100029859 Ga0068869_1000298593 189
21 3300005335 Ga0070666_10000042 Ga0070666_1000004214 189
22 3300005336 Ga0070680_100234769 Ga0070680_1002347694 189
23 3300005336 Ga0070680_100253969 Ga0070680_1002539692 189
24 3300005336 Ga0070680_100442985 Ga0070680_1004429852 189
25 3300005338 Ga0068868_100011877 Ga0068868_1000118776 189
26 3300005339 Ga0070660_100029501 Ga0070660_1000295012 189
27 3300005340 Ga0070689_100764030 Ga0070689_1007640301 189
28 3300005344 Ga0070661_100001575 Ga0070661_1000015756 189
29 3300005347 Ga0070668_100372296 Ga0070668_1003722962 189
30 3300005355 Ga0070671_100360449 Ga0070671_1003604493 189
31 3300005355 Ga0070671_101232862 Ga0070671_1012328621 189
32 3300005364 Ga0070673_100203878 Ga0070673_1002038782 189
33 3300005366 Ga0070659_100046549 Ga0070659_1000465491 189
34 3300005367 Ga0070667_100213764 Ga0070667_1002137642 189
35 3300005367 Ga0070667_100734416 Ga0070667_1007344161 189
36 3300005455 Ga0070663_100384631 Ga0070663_1003846312 189
37 3300005457 Ga0070662_100200109 Ga0070662_1002001092 189
38 3300005457 Ga0070662_100845830 Ga0070662_1008458301 189
39 3300005458 Ga0070681_10323761 Ga0070681_103237612 189
40 3300005459 Ga0068867_100543975 Ga0068867_1005439751 189
41 3300005530 Ga0070679_100002897 Ga0070679_1000028976 189
42 3300005535 Ga0070684_100047554 Ga0070684_1000475542 189
43 3300005535 Ga0070684_100503571 Ga0070684_1005035712 189
44 3300005535 Ga0070684_101341904 Ga0070684_1013419041 189
45 3300005539 Ga0068853_100001770 Ga0068853_10000177010 189
46 3300005544 Ga0070686_100853357 Ga0070686_1008533571 189
47 3300005547 Ga0070693_100144426 Ga0070693_1001444262 189
48 3300005547 Ga0070693_100265310 Ga0070693_1002653101 189
49 3300005548 Ga0070665_100263958 Ga0070665_1002639583 189
50 3300005564 Ga0070664_100004100 Ga0070664_1000041006 189
51 3300005577 Ga0068857_100051054 Ga0068857_1000510545 189
52 3300005578 Ga0068854_100327778 Ga0068854_1003277783 189
53 3300005616 Ga0068852_100003800 Ga0068852_10000380010 189
54 3300005616 Ga0068852_100012047 Ga0068852_1000120472 189
55 3300005616 Ga0068852_100080971 Ga0068852_1000809714 189
56 3300005617 Ga0068859_100000768 Ga0068859_10000076812 189
57 3300005617 Ga0068859_100037557 Ga0068859_1000375573 189
58 3300005618 Ga0068864_100082025 Ga0068864_1000820253 189
59 3300005719 Ga0068861_100444180 Ga0068861_1004441801 189
60 3300005841 Ga0068863_100128182 Ga0068863_1001281824 189
61 3300005841 Ga0068863_100145497 Ga0068863_1001454975 189
62 3300005842 Ga0068858_100066234 Ga0068858_1000662345 189
63 3300005843 Ga0068860_100001707 Ga0068860_10000170722 189
64 3300005843 Ga0068860_100083787 Ga0068860_1000837873 189
65 3300005843 Ga0068860_100784324 Ga0068860_1007843243 189
66 3300005844 Ga0068862_100152151 Ga0068862_1001521512 189
67 3300006195 Ga0075366_10110642 Ga0075366_101106422 189
68 3300006237 Ga0097621_100319979 Ga0097621_1003199792 189
69 3300006358 Ga0068871_100263580 Ga0068871_1002635802 189
70 3300006931 Ga0097620_100000768 Ga0097620_10000076812 189
71 3300006931 Ga0097620_100037557 Ga0097620_1000375573 189
72 3300009093 Ga0105240_10001190 Ga0105240_1000119020 189
73 3300009093 Ga0105240_10325813 Ga0105240_103258133 189
74 3300009174 Ga0105241_10000853 Ga0105241_100008539 189
75 3300009174 Ga0105241_10171896 Ga0105241_101718961 189
76 3300009174 Ga0105241_10321103 Ga0105241_103211032 189
77 3300009176 Ga0105242_10172478 Ga0105242_101724781 189
78 3300009176 Ga0105242_10950092 Ga0105242_109500921 189
79 3300009545 Ga0105237_10000833 Ga0105237_1000083326 189
80 3300009545 Ga0105237_10124870 Ga0105237_101248702 189
81 3300009553 Ga0105249_10001650 Ga0105249_100016501 189
82 3300010375 Ga0105239_10019904 Ga0105239_100199046 189
83 3300010375 Ga0105239_10448227 Ga0105239_104482272 189
84 3300010375 Ga0105239_10454463 Ga0105239_104544632 189
85 3300011119 Ga0105246_10003384 Ga0105246_1000338413 189
86 3300011119 Ga0105246_10024300 Ga0105246_100243004 189
87 3300011119 Ga0105246_10306054 Ga0105246_103060541 189
88 3300013100 Ga0157373_10027326 Ga0157373_100273262 189
89 3300013100 Ga0157373_10095795 Ga0157373_100957952 189
90 3300013102 Ga0157371_10134170 Ga0157371_101341702 189
91 3300013105 Ga0157369_10161940 Ga0157369_101619402 189
92 3300013105 Ga0157369_11104665 Ga0157369_111046651 189
93 3300013296 Ga0157374_10317536 Ga0157374_103175362 189
94 3300013297 Ga0157378_10073750 Ga0157378_100737503 189
95 3300013306 Ga0163162_10025120 Ga0163162_100251208 189
96 3300013307 Ga0157372_10000683 Ga0157372_1000068310 189
97 3300013307 Ga0157372_10562779 Ga0157372_105627792 189
98 3300013307 Ga0157372_10639775 Ga0157372_106397751 189
99 3300013307 Ga0157372_11246969 Ga0157372_112469692 189
100 3300013308 Ga0157375_10835293 Ga0157375_108352932 189
101 3300014325 Ga0163163_10734176 Ga0163163_107341762 189
102 3300014326 Ga0157380_10301054 Ga0157380_103010542 189
103 3300014745 Ga0157377_10013010 Ga0157377_100130102 189
104 3300014968 Ga0157379_10738155 Ga0157379_107381551 189
105 3300014969 Ga0157376_10142939 Ga0157376_101429391 189
106 3300014969 Ga0157376_10250581 Ga0157376_102505812 189
107 3300025901 Ga0207688_10457810 Ga0207688_104578101 189
108 3300025903 Ga0207680_10000448 Ga0207680_1000044814 189
109 3300025903 Ga0207680_10443268 Ga0207680_104432681 189
110 3300025907 Ga0207645_10013783 Ga0207645_100137834 189
111 3300025909 Ga0207705_10002124 Ga0207705_1000212424 189
112 3300025909 Ga0207705_10118878 Ga0207705_101188782 189
113 3300025911 Ga0207654_10013270 Ga0207654_100132702 189
114 3300025911 Ga0207654_10206714 Ga0207654_102067142 189
115 3300025912 Ga0207707_10109298 Ga0207707_101092981 189
116 3300025912 Ga0207707_10132747 Ga0207707_101327472 189
117 3300025913 Ga0207695_10000039 Ga0207695_10000039194 189
118 3300025914 Ga0207671_10009669 Ga0207671_100096697 189
119 3300025914 Ga0207671_10073130 Ga0207671_100731302 189
120 3300025914 Ga0207671_10506177 Ga0207671_105061771 189
121 3300025917 Ga0207660_10020274 Ga0207660_100202743 189
122 3300025917 Ga0207660_10231381 Ga0207660_102313812 189
123 3300025919 Ga0207657_10019311 Ga0207657_100193114 189
124 3300025920 Ga0207649_10005637 Ga0207649_100056379 189
125 3300025921 Ga0207652_10000768 Ga0207652_100007686 189
126 3300025931 Ga0207644_10653851 Ga0207644_106538511 189
127 3300025933 Ga0207706_10071782 Ga0207706_100717825 189
128 3300025933 Ga0207706_10819825 Ga0207706_108198252 189
129 3300025934 Ga0207686_10628343 Ga0207686_106283431 189
130 3300025937 Ga0207669_10067624 Ga0207669_100676243 189
131 3300025937 Ga0207669_10069749 Ga0207669_100697492 189
132 3300025942 Ga0207689_10008911 Ga0207689_100089116 189
133 3300025942 Ga0207689_10036403 Ga0207689_100364032 189
134 3300025942 Ga0207689_10038760 Ga0207689_100387605 189
135 3300025944 Ga0207661_10293603 Ga0207661_102936032 189
136 3300025945 Ga0207679_10058769 Ga0207679_100587694 189
137 3300025949 Ga0207667_10557014 Ga0207667_105570141 189
138 3300025949 Ga0207667_10595993 Ga0207667_105959932 189
139 3300025960 Ga0207651_10126863 Ga0207651_101268632 189
140 3300025960 Ga0207651_11040361 Ga0207651_110403611 189
141 3300025961 Ga0207712_10108346 Ga0207712_101083463 189
142 3300025986 Ga0207658_10149251 Ga0207658_101492513 189
143 3300025986 Ga0207658_10202248 Ga0207658_102022482 189
144 3300026023 Ga0207677_10391189 Ga0207677_103911892 189
145 3300026035 Ga0207703_10006254 Ga0207703_1000625414 189
146 3300026067 Ga0207678_10161683 Ga0207678_101616833 189
147 3300026078 Ga0207702_10144818 Ga0207702_101448182 189
148 3300026088 Ga0207641_10005736 Ga0207641_100057367 189
149 3300026116 Ga0207674_10004912 Ga0207674_1000491220 189
150 3300026118 Ga0207675_100239392 Ga0207675_1002393921 189
151 3300026118 Ga0207675_100492450 Ga0207675_1004924502 189
152 3300026142 Ga0207698_10002653 Ga0207698_100026537 189
153 3300026142 Ga0207698_10004090 Ga0207698_100040907 189
154 3300026142 Ga0207698_10061191 Ga0207698_100611911 189
155 3300028380 Ga0268265_10855253 Ga0268265_108552532 189
156 3300028381 Ga0268264_10002457 Ga0268264_100024578 189
157 3300028381 Ga0268264_10395018 Ga0268264_103950182 189
158 3300032004 Ga0307414_10000016 Ga0307414_10000016173 189
159 3300032004 Ga0307414_10586847 Ga0307414_105868472 189
160 3300032004 Ga0307414_10742304 Ga0307414_107423041 189
161 3300032004 Ga0307414_10828237 Ga0307414_108282371 189
162 3300035725 Ga0373947_0047414 Ga0373947_0047414_630_1247 189
163 3300036401 Ga0373937_0296846 Ga0373937_0296846_498_1106 189
164 3300037312 Ga0395899_0114501 Ga0395899_0114501_784_1392 189
165 3300037312 Ga0395899_0285785 Ga0395899_0285785_413_1021 189
166 3300037418 Ga0395900_0224956 Ga0395900_0224956_847_1455 189
167 3300037418 Ga0395900_0289054 Ga0395900_0289054_232_840 189
168 3300037466 Ga0395898_0138152 Ga0395898_0138152_1336_1944 189
169 3300037466 Ga0395898_0200854 Ga0395898_0200854_435_1043 189
170 3300037471 Ga0395905_0001555 Ga0395905_0001555_17278_17886 189
171 3300038443 Ga0395901_0134469 Ga0395901_0134469_1084_1692 189
172 3300038443 Ga0395901_0147077 Ga0395901_0147077_324_932 189
173 3300041509 Ga0451843_1063484 Ga0451843_1063484_74_682 189
174 3300042131 Ga0450894_008015 Ga0450894_008015_675_1283 189
175 3300042134 Ga0450898_006538 Ga0450898_006538_1155_1763 189
176 3300042876 Ga0451577_0313638 Ga0451577_0313638_752_1360 189
177 3300042876 Ga0451577_0707696 Ga0451577_0707696_146_763 189
178 3300044673 Ga0453683_0002145 Ga0453683_0002145_243_866 189
179 3300044712 Ga0453684_0001905 Ga0453684_0001905_40016_40585 189
180 3300044712 Ga0453684_0104662 Ga0453684_0104662_641_1264 189
181 3300045051 Ga0451576_0032928 Ga0451576_0032928_2956_3579 189
182 3300046460 Ga0495638_0287513 Ga0495638_0287513_16_624 189
183 3300046475 Ga0495639_0352357 Ga0495639_0352357_66_683 189
184 3300046535 Ga0495586_0462813 Ga0495586_0462813_137_721 189
185 3300046543 Ga0495645_0554388 Ga0495645_0554388_80_688 189
186 3300046642 Ga0495634_0349868 Ga0495634_0349868_159_782 189
187 3300046663 Ga0495635_0162320 Ga0495635_0162320_212_835 189
188 3300046809 Ga0495600_0315648 Ga0495600_0315648_314_922 189
189 3300047321 Ga0495676_0099121 Ga0495676_0099121_899_1516 189
190 3300049571 Ga0501034_0015190 Ga0501034_0015190_4817_5425 189
191 3300049656 Ga0501209_162639 Ga0501209_162639_64_666 189
192 3300049823 Ga0501044_0419037 Ga0501044_0419037_204_812 189
193 3300050493 nmdc:mga0k408_3656_c1 nmdc:mga0k408_3656_c1_1589_2197 189
194 3300053108 Ga0500562_000038 Ga0500562_000038_29054_29647 189
195 3300053139 Ga0500568_0000231 Ga0500568_0000231_294_902 189
196 3300053156 Ga0500622_0000340 Ga0500622_0000340_21079_21648 189
197 iso_pu_bacteria 2881359912 2881362129 189
198 3300003322 rootL2_10004462 rootL2_100044622 190
199 3300005289 Ga0065704_10223544 Ga0065704_102235441 190
200 3300005290 Ga0065712_10071173 Ga0065712_100711732 190
201 3300005290 Ga0065712_10282717 Ga0065712_102827171 190
202 3300005290 Ga0065712_10412770 Ga0065712_104127701 190
203 3300005330 Ga0070690_100032549 Ga0070690_1000325493 190
204 3300005335 Ga0070666_10019411 Ga0070666_100194113 190
205 3300005337 Ga0070682_100217566 Ga0070682_1002175663 190
206 3300005338 Ga0068868_100045700 Ga0068868_1000457002 190
207 3300005340 Ga0070689_100038671 Ga0070689_1000386712 190
208 3300005340 Ga0070689_100290955 Ga0070689_1002909551 190
209 3300005343 Ga0070687_100091203 Ga0070687_1000912032 190
210 3300005344 Ga0070661_100170623 Ga0070661_1001706233 190
211 3300005353 Ga0070669_100483808 Ga0070669_1004838081 190
212 3300005364 Ga0070673_100099673 Ga0070673_1000996732 190
213 3300005367 Ga0070667_100030009 Ga0070667_1000300093 190
214 3300005367 Ga0070667_100188830 Ga0070667_1001888302 190
215 3300005457 Ga0070662_100051116 Ga0070662_1000511163 190
216 3300005459 Ga0068867_100232541 Ga0068867_1002325414 190
217 3300005466 Ga0070685_10020865 Ga0070685_100208652 190
218 3300005539 Ga0068853_100085615 Ga0068853_1000856152 190
219 3300005539 Ga0068853_100785633 Ga0068853_1007856331 190
220 3300005544 Ga0070686_100040959 Ga0070686_1000409593 190
221 3300005547 Ga0070693_100547278 Ga0070693_1005472781 190
222 3300005578 Ga0068854_100014699 Ga0068854_1000146999 190
223 3300005616 Ga0068852_100080329 Ga0068852_1000803293 190
224 3300005617 Ga0068859_100015256 Ga0068859_1000152566 190
225 3300005617 Ga0068859_100240463 Ga0068859_1002404631 190
226 3300005719 Ga0068861_100052171 Ga0068861_1000521712 190
227 3300005834 Ga0068851_10000330 Ga0068851_100003308 190
228 3300005834 Ga0068851_10094735 Ga0068851_100947352 190
229 3300005841 Ga0068863_100009065 Ga0068863_1000090654 190
230 3300005841 Ga0068863_100147532 Ga0068863_1001475322 190
231 3300005841 Ga0068863_100292021 Ga0068863_1002920213 190
232 3300005842 Ga0068858_100378691 Ga0068858_1003786912 190
233 3300005843 Ga0068860_100059558 Ga0068860_1000595584 190
234 3300006163 Ga0070715_10016818 Ga0070715_100168183 190
235 3300006163 Ga0070715_10045234 Ga0070715_100452343 190
236 3300006195 Ga0075366_10001550 Ga0075366_1000155013 190
237 3300006237 Ga0097621_100013530 Ga0097621_1000135303 190
238 3300006237 Ga0097621_100055710 Ga0097621_1000557103 190
239 3300006237 Ga0097621_101063687 Ga0097621_1010636871 190
240 3300006358 Ga0068871_100011948 Ga0068871_1000119484 190
241 3300006358 Ga0068871_100063065 Ga0068871_1000630654 190
242 3300006358 Ga0068871_100949480 Ga0068871_1009494801 190
243 3300006844 Ga0075428_100212120 Ga0075428_1002121202 190
244 3300006881 Ga0068865_100107194 Ga0068865_1001071944 190
245 3300006931 Ga0097620_100015256 Ga0097620_1000152566 190
246 3300006931 Ga0097620_100240479 Ga0097620_1002404791 190
247 3300009176 Ga0105242_10066940 Ga0105242_100669405 190
248 3300009176 Ga0105242_10101319 Ga0105242_101013192 190
249 3300009176 Ga0105242_10800037 Ga0105242_108000372 190
250 3300009176 Ga0105242_11240169 Ga0105242_112401691 190
251 3300009177 Ga0105248_10174783 Ga0105248_101747831 190
252 3300009553 Ga0105249_10002726 Ga0105249_1000272619 190
253 3300009553 Ga0105249_10162644 Ga0105249_101626441 190
254 3300013297 Ga0157378_10083322 Ga0157378_100833223 190
255 3300013297 Ga0157378_10588883 Ga0157378_105888831 190
256 3300013306 Ga0163162_10054907 Ga0163162_100549076 190
257 3300013306 Ga0163162_10335311 Ga0163162_103353112 190
258 3300013308 Ga0157375_10033149 Ga0157375_100331497 190
259 3300013308 Ga0157375_10211795 Ga0157375_102117954 190
260 3300013308 Ga0157375_10358342 Ga0157375_103583421 190
261 3300014325 Ga0163163_10341892 Ga0163163_103418922 190
262 3300014325 Ga0163163_11032066 Ga0163163_110320661 190
263 3300014326 Ga0157380_10381624 Ga0157380_103816241 190
264 3300014969 Ga0157376_10051608 Ga0157376_100516084 190
265 3300014969 Ga0157376_10100474 Ga0157376_101004743 190
266 3300017792 Ga0163161_10010043 Ga0163161_100100434 190
267 3300017792 Ga0163161_10028739 Ga0163161_100287397 190
268 3300017792 Ga0163161_10289904 Ga0163161_102899042 190
269 3300025302 Ga0207426_1000002 Ga0207426_1000002366 190
270 3300025321 Ga0207656_10000197 Ga0207656_100001978 190
271 3300025905 Ga0207685_10078228 Ga0207685_100782282 190
272 3300025918 Ga0207662_10131201 Ga0207662_101312012 190
273 3300025920 Ga0207649_10234708 Ga0207649_102347081 190
274 3300025931 Ga0207644_10074215 Ga0207644_100742152 190
275 3300025933 Ga0207706_10010475 Ga0207706_100104758 190
276 3300025934 Ga0207686_10000793 Ga0207686_100007937 190
277 3300025934 Ga0207686_10512125 Ga0207686_105121252 190
278 3300025936 Ga0207670_10365686 Ga0207670_103656862 190
279 3300025938 Ga0207704_10055389 Ga0207704_100553892 190
280 3300025940 Ga0207691_10274068 Ga0207691_102740682 190
281 3300025942 Ga0207689_10021899 Ga0207689_1002189910 190
282 3300025960 Ga0207651_10168375 Ga0207651_101683752 190
283 3300025961 Ga0207712_10001133 Ga0207712_1000113319 190
284 3300025961 Ga0207712_10319984 Ga0207712_103199842 190
285 3300025981 Ga0207640_10031980 Ga0207640_100319802 190
286 3300025986 Ga0207658_10140244 Ga0207658_101402443 190
287 3300025986 Ga0207658_10495293 Ga0207658_104952932 190
288 3300026023 Ga0207677_10576363 Ga0207677_105763631 190
289 3300026041 Ga0207639_10128558 Ga0207639_101285582 190
290 3300026041 Ga0207639_10284886 Ga0207639_102848862 190
291 3300026088 Ga0207641_10000368 Ga0207641_1000036811 190
292 3300026095 Ga0207676_10323393 Ga0207676_103233931 190
293 3300026118 Ga0207675_100110326 Ga0207675_1001103262 190
294 3300026142 Ga0207698_10358490 Ga0207698_103584902 190
295 3300028380 Ga0268265_10683737 Ga0268265_106837371 190
296 3300028381 Ga0268264_10411666 Ga0268264_104116662 190
297 3300028381 Ga0268264_10558528 Ga0268264_105585282 190
298 3300028794 Ga0307515_10000002 Ga0307515_10000002277 190
299 3300031251 Ga0265327_10010853 Ga0265327_1001085310 190
300 3300031251 Ga0265327_10015738 Ga0265327_100157383 190
301 3300039437 Ga0436365_0010910 Ga0436365_0010910_582_1274 190
302 3300041486 Ga0451807_1035199 Ga0451807_1035199_308_919 190
303 3300044673 Ga0453683_0000090 Ga0453683_0000090_14590_15201 190
304 3300046517 Ga0495630_0885886 Ga0495630_0885886_18_650 190
305 3300046683 Ga0495658_0526482 Ga0495658_0526482_119_730 190
306 3300047320 Ga0495672_0028363 Ga0495672_0028363_2620_3297 190
307 3300047472 Ga0495686_0026406 Ga0495686_0026406_1268_1879 190
308 3300048918 Ga0496115_0002270 Ga0496115_0002270_304_891 190
309 3300050493 nmdc:mga0k408_37528_c1 nmdc:mga0k408_37528_c1_1499_2110 190
310 3300050511 nmdc:mga08y16_142949_c1 nmdc:mga08y16_142949_c1_926_1537 190
311 3300050511 nmdc:mga08y16_708958_c1 nmdc:mga08y16_708958_c1_161_772 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

24

209

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqb-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with folate 0.7407 30 179
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7371 2 179
2jyb-assembly1.cif.gz_A binary hvdhfr1:folate complex 0.731 2 184
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.7179 2 180
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7177 2 179
ID Description Score Start End Superfamily
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7497 25 179 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7179 2 180 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.715 2 184 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7117 2 177 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7062 2 180 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A3N5K9Y5-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9163 47 181 GO:0008703
GO:0009231
AF-A0A537J602-F1-model_v4 Deaminase 0.9055 85 182 GO:0008703
GO:0009231
AF-A0A1I2JP79-F1-model_v4 RibD C-terminal domain-containing protein 0.903 100 182 GO:0008703
GO:0009231
AF-A0A538J2D1-F1-model_v4 Dihydrofolate reductase 0.9026 34 182 GO:0008703
GO:0009231
AF-A0A534PLK5-F1-model_v4 Dihydrofolate reductase 0.9012 87 182 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
80.38 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map