F401387
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 311 | 160 | 310 | 199 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0028363|Ga0495672_0028363_2620_3297 |
| Length | 225 |
| Sequence | LAQLLINLLKKPAGRKKLKINYMRKITVLTMITLDGVLQAPGGPKEDTSGRFKYGGWTAPYGDEAYSKVVQKELKTATDYLLGRKTFEIWAGYWPEHGDFWPGINEGTKYVFSKNMKKSDPIITGWKKSIVIKNVADIKKLKKSKGPDIQVWGSSKLIQLLLKNDLVDELRLKIHPLTLGNGKKLFNNGTIPAAFTLMDSIVTSKGVIIVSYKRAGKVKTGTVGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 121 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 123 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 130 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 131 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 132 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 133 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 134 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 135 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 136 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 137 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 138 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 139 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 140 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 155 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 157 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 159 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 160 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0 |
| Isolates | 0.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.57 |
| Nodule | 0 |
| Rhizoplane | 0.64 |
| Rhizosphere | 95.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10004462 | 3300003322 | Bacteria | 1578 |
| 2 | rootL2_10008241 | 3300003322 | Unclassified | 2156 |
| 3 | Ga0065704_10223544 | 3300005289 | Bacteria | 1066 |
| 4 | Ga0065712_10071173 | 3300005290 | Bacteria | 5439 |
| 5 | Ga0065712_10282717 | 3300005290 | Bacteria | 874 |
| 6 | Ga0065712_10412770 | 3300005290 | Bacteria | 719 |
| 7 | Ga0070658_10001614 | 3300005327 | Bacteria | 19070 |
| 8 | Ga0070658_10092299 | 3300005327 | Bacteria | 2496 |
| 9 | Ga0070676_10123414 | 3300005328 | Bacteria | 1629 |
| 10 | Ga0070676_10182922 | 3300005328 | Bacteria | 1364 |
| 11 | Ga0070683_100010096 | 3300005329 | Bacteria | 8101 |
| 12 | Ga0070690_100032549 | 3300005330 | Bacteria | 3258 |
| 13 | Ga0070670_100874785 | 3300005331 | Bacteria | 814 |
| 14 | Ga0068869_100029859 | 3300005334 | Bacteria | 3822 |
| 15 | Ga0070666_10000042 | 3300005335 | Bacteria | 112296 |
| 16 | Ga0070666_10019411 | 3300005335 | Bacteria | 4387 |
| 17 | Ga0070680_100234769 | 3300005336 | Bacteria | 1549 |
| 18 | Ga0070680_100253969 | 3300005336 | Bacteria | 1487 |
| 19 | Ga0070680_100442985 | 3300005336 | Bacteria | 1109 |
| 20 | Ga0070682_100217566 | 3300005337 | Bacteria | 1358 |
| 21 | Ga0068868_100011877 | 3300005338 | Bacteria | 6349 |
| 22 | Ga0068868_100045700 | 3300005338 | Bacteria | 3427 |
| 23 | Ga0070660_100029501 | 3300005339 | Bacteria | 4112 |
| 24 | Ga0070689_100038671 | 3300005340 | Bacteria | 3651 |
| 25 | Ga0070689_100240205 | 3300005340 | Bacteria | 1492 |
| 26 | Ga0070689_100290955 | 3300005340 | Bacteria | 1357 |
| 27 | Ga0070689_100764030 | 3300005340 | Bacteria | 848 |
| 28 | Ga0070687_100021071 | 3300005343 | Bacteria | 3057 |
| 29 | Ga0070687_100091203 | 3300005343 | Bacteria | 1686 |
| 30 | Ga0070661_100001575 | 3300005344 | Bacteria | 15817 |
| 31 | Ga0070661_100170623 | 3300005344 | Bacteria | 1652 |
| 32 | Ga0070668_100372296 | 3300005347 | Bacteria | 1214 |
| 33 | Ga0070669_100483808 | 3300005353 | Bacteria | 1025 |
| 34 | Ga0070671_100360449 | 3300005355 | Unclassified | 1241 |
| 35 | Ga0070671_101232862 | 3300005355 | Bacteria | 659 |
| 36 | Ga0070673_100099673 | 3300005364 | Bacteria | 2390 |
| 37 | Ga0070673_100203878 | 3300005364 | Bacteria | 1704 |
| 38 | Ga0070659_100046549 | 3300005366 | Bacteria | 3400 |
| 39 | Ga0070667_100030009 | 3300005367 | Bacteria | 4535 |
| 40 | Ga0070667_100188830 | 3300005367 | Bacteria | 1825 |
| 41 | Ga0070667_100213764 | 3300005367 | Bacteria | 1715 |
| 42 | Ga0070667_100734416 | 3300005367 | Bacteria | 915 |
| 43 | Ga0070663_100384631 | 3300005455 | Bacteria | 1144 |
| 44 | Ga0070662_100051116 | 3300005457 | Bacteria | 2983 |
| 45 | Ga0070662_100200109 | 3300005457 | Bacteria | 1584 |
| 46 | Ga0070662_100845830 | 3300005457 | Bacteria | 779 |
| 47 | Ga0070681_10323761 | 3300005458 | Bacteria | 1451 |
| 48 | Ga0068867_100232541 | 3300005459 | Bacteria | 1491 |
| 49 | Ga0068867_100543975 | 3300005459 | Bacteria | 1005 |
| 50 | Ga0070685_10020865 | 3300005466 | Bacteria | 3551 |
| 51 | Ga0070679_100002897 | 3300005530 | Bacteria | 15586 |
| 52 | Ga0070684_100047554 | 3300005535 | Bacteria | 3717 |
| 53 | Ga0070684_100503571 | 3300005535 | Bacteria | 1122 |
| 54 | Ga0070684_101341904 | 3300005535 | Bacteria | 673 |
| 55 | Ga0068853_100001770 | 3300005539 | Bacteria | 15876 |
| 56 | Ga0068853_100085615 | 3300005539 | Bacteria | 2763 |
| 57 | Ga0068853_100785633 | 3300005539 | Bacteria | 911 |
| 58 | Ga0070686_100040959 | 3300005544 | Bacteria | 2892 |
| 59 | Ga0070686_100853357 | 3300005544 | Bacteria | 738 |
| 60 | Ga0070693_100144426 | 3300005547 | Unclassified | 1501 |
| 61 | Ga0070693_100265310 | 3300005547 | Bacteria | 1144 |
| 62 | Ga0070693_100547278 | 3300005547 | Bacteria | 828 |
| 63 | Ga0070665_100263958 | 3300005548 | Bacteria | 1723 |
| 64 | Ga0070664_100004100 | 3300005564 | Bacteria | 11701 |
| 65 | Ga0068857_100051054 | 3300005577 | Bacteria | 3667 |
| 66 | Ga0068854_100014699 | 3300005578 | Bacteria | 5165 |
| 67 | Ga0068854_100327778 | 3300005578 | Bacteria | 1247 |
| 68 | Ga0068852_100003800 | 3300005616 | Bacteria | 10597 |
| 69 | Ga0068852_100012047 | 3300005616 | Bacteria | 6545 |
| 70 | Ga0068852_100080329 | 3300005616 | Bacteria | 2891 |
| 71 | Ga0068852_100080971 | 3300005616 | Bacteria | 2881 |
| 72 | Ga0068852_100735717 | 3300005616 | Bacteria | 998 |
| 73 | Ga0068859_100000768 | 3300005617 | Bacteria | 32376 |
| 74 | Ga0068859_100015256 | 3300005617 | Bacteria | 7716 |
| 75 | Ga0068859_100037557 | 3300005617 | Bacteria | 4861 |
| 76 | Ga0068859_100240463 | 3300005617 | Bacteria | 1899 |
| 77 | Ga0068864_100082025 | 3300005618 | Bacteria | 2829 |
| 78 | Ga0068861_100052171 | 3300005719 | Bacteria | 3108 |
| 79 | Ga0068861_100444180 | 3300005719 | Bacteria | 1161 |
| 80 | Ga0068851_10000330 | 3300005834 | Bacteria | 21529 |
| 81 | Ga0068851_10094735 | 3300005834 | Bacteria | 1577 |
| 82 | Ga0068863_100009065 | 3300005841 | Bacteria | 9715 |
| 83 | Ga0068863_100128182 | 3300005841 | Bacteria | 2421 |
| 84 | Ga0068863_100145497 | 3300005841 | Bacteria | 2266 |
| 85 | Ga0068863_100147532 | 3300005841 | Bacteria | 2250 |
| 86 | Ga0068863_100292021 | 3300005841 | Bacteria | 1580 |
| 87 | Ga0068858_100066234 | 3300005842 | Bacteria | 3343 |
| 88 | Ga0068858_100378691 | 3300005842 | Bacteria | 1358 |
| 89 | Ga0068860_100001707 | 3300005843 | Bacteria | 23468 |
| 90 | Ga0068860_100059558 | 3300005843 | Bacteria | 3629 |
| 91 | Ga0068860_100083787 | 3300005843 | Bacteria | 3033 |
| 92 | Ga0068860_100784324 | 3300005843 | Bacteria | 966 |
| 93 | Ga0068862_100152151 | 3300005844 | Bacteria | 2060 |
| 94 | Ga0070715_10016818 | 3300006163 | Bacteria | 2757 |
| 95 | Ga0070715_10045234 | 3300006163 | Bacteria | 1865 |
| 96 | Ga0075366_10001550 | 3300006195 | Bacteria | 11493 |
| 97 | Ga0075366_10110642 | 3300006195 | Bacteria | 1652 |
| 98 | Ga0097621_100013530 | 3300006237 | Bacteria | 6084 |
| 99 | Ga0097621_100055710 | 3300006237 | Bacteria | 3229 |
| 100 | Ga0097621_100319979 | 3300006237 | Bacteria | 1374 |
| 101 | Ga0097621_101063687 | 3300006237 | Bacteria | 758 |
| 102 | Ga0068871_100011948 | 3300006358 | Bacteria | 6391 |
| 103 | Ga0068871_100063065 | 3300006358 | Bacteria | 3030 |
| 104 | Ga0068871_100263580 | 3300006358 | Bacteria | 1504 |
| 105 | Ga0068871_100949480 | 3300006358 | Bacteria | 799 |
| 106 | Ga0075428_100212120 | 3300006844 | Bacteria | 2092 |
| 107 | Ga0068865_100107194 | 3300006881 | Bacteria | 2055 |
| 108 | Ga0097620_100000768 | 3300006931 | Bacteria | 32376 |
| 109 | Ga0097620_100015256 | 3300006931 | Bacteria | 7716 |
| 110 | Ga0097620_100037557 | 3300006931 | Bacteria | 4861 |
| 111 | Ga0097620_100240479 | 3300006931 | Bacteria | 1899 |
| 112 | Ga0105240_10001190 | 3300009093 | Bacteria | 45471 |
| 113 | Ga0105240_10325813 | 3300009093 | Bacteria | 1749 |
| 114 | Ga0105241_10000853 | 3300009174 | Bacteria | 23134 |
| 115 | Ga0105241_10171896 | 3300009174 | Bacteria | 1790 |
| 116 | Ga0105241_10321103 | 3300009174 | Bacteria | 1335 |
| 117 | Ga0105242_10066940 | 3300009176 | Bacteria | 2968 |
| 118 | Ga0105242_10101319 | 3300009176 | Bacteria | 2440 |
| 119 | Ga0105242_10172478 | 3300009176 | Bacteria | 1902 |
| 120 | Ga0105242_10800037 | 3300009176 | Bacteria | 933 |
| 121 | Ga0105242_10950092 | 3300009176 | Bacteria | 864 |
| 122 | Ga0105242_11240169 | 3300009176 | Bacteria | 767 |
| 123 | Ga0105248_10174783 | 3300009177 | Bacteria | 2421 |
| 124 | Ga0105237_10000833 | 3300009545 | Bacteria | 42120 |
| 125 | Ga0105237_10124870 | 3300009545 | Bacteria | 2568 |
| 126 | Ga0105249_10001650 | 3300009553 | Bacteria | 19547 |
| 127 | Ga0105249_10002726 | 3300009553 | Bacteria | 15275 |
| 128 | Ga0105249_10162644 | 3300009553 | Bacteria | 2158 |
| 129 | Ga0105239_10019904 | 3300010375 | Bacteria | 7407 |
| 130 | Ga0105239_10448227 | 3300010375 | Bacteria | 1464 |
| 131 | Ga0105239_10454463 | 3300010375 | Bacteria | 1453 |
| 132 | Ga0105246_10003384 | 3300011119 | Bacteria | 9663 |
| 133 | Ga0105246_10024300 | 3300011119 | Bacteria | 3935 |
| 134 | Ga0105246_10306054 | 3300011119 | Bacteria | 1285 |
| 135 | Ga0157373_10027326 | 3300013100 | Bacteria | 4116 |
| 136 | Ga0157373_10095795 | 3300013100 | Bacteria | 2089 |
| 137 | Ga0157371_10134170 | 3300013102 | Bacteria | 1763 |
| 138 | Ga0157369_10161940 | 3300013105 | Bacteria | 2362 |
| 139 | Ga0157369_11104665 | 3300013105 | Bacteria | 810 |
| 140 | Ga0157374_10317536 | 3300013296 | Unclassified | 1543 |
| 141 | Ga0157374_10874571 | 3300013296 | Bacteria | 916 |
| 142 | Ga0157378_10073750 | 3300013297 | Unclassified | 3069 |
| 143 | Ga0157378_10083322 | 3300013297 | Bacteria | 2893 |
| 144 | Ga0157378_10588883 | 3300013297 | Bacteria | 1122 |
| 145 | Ga0163162_10025120 | 3300013306 | Bacteria | 5888 |
| 146 | Ga0163162_10054907 | 3300013306 | Bacteria | 4008 |
| 147 | Ga0163162_10335311 | 3300013306 | Bacteria | 1645 |
| 148 | Ga0157372_10000683 | 3300013307 | Bacteria | 37283 |
| 149 | Ga0157372_10562779 | 3300013307 | Bacteria | 1329 |
| 150 | Ga0157372_10639775 | 3300013307 | Bacteria | 1239 |
| 151 | Ga0157372_11246969 | 3300013307 | Bacteria | 859 |
| 152 | Ga0157375_10033149 | 3300013308 | Bacteria | 4905 |
| 153 | Ga0157375_10211795 | 3300013308 | Bacteria | 2095 |
| 154 | Ga0157375_10358342 | 3300013308 | Bacteria | 1625 |
| 155 | Ga0157375_10835293 | 3300013308 | Bacteria | 1068 |
| 156 | Ga0163163_10341892 | 3300014325 | Bacteria | 1552 |
| 157 | Ga0163163_10734176 | 3300014325 | Bacteria | 1051 |
| 158 | Ga0163163_11032066 | 3300014325 | Bacteria | 886 |
| 159 | Ga0157380_10301054 | 3300014326 | Bacteria | 1477 |
| 160 | Ga0157380_10381624 | 3300014326 | Bacteria | 1330 |
| 161 | Ga0157377_10013010 | 3300014745 | Bacteria | 4201 |
| 162 | Ga0157379_10738155 | 3300014968 | Bacteria | 926 |
| 163 | Ga0157376_10051608 | 3300014969 | Bacteria | 3417 |
| 164 | Ga0157376_10100474 | 3300014969 | Bacteria | 2526 |
| 165 | Ga0157376_10142939 | 3300014969 | Bacteria | 2149 |
| 166 | Ga0157376_10250581 | 3300014969 | Bacteria | 1653 |
| 167 | Ga0163161_10010043 | 3300017792 | Bacteria | 6554 |
| 168 | Ga0163161_10028739 | 3300017792 | Bacteria | 3949 |
| 169 | Ga0163161_10289904 | 3300017792 | Bacteria | 1286 |
| 170 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 171 | Ga0207656_10000197 | 3300025321 | Bacteria | 21633 |
| 172 | Ga0207688_10457810 | 3300025901 | Bacteria | 796 |
| 173 | Ga0207680_10000448 | 3300025903 | Bacteria | 19470 |
| 174 | Ga0207680_10443268 | 3300025903 | Bacteria | 921 |
| 175 | Ga0207685_10078228 | 3300025905 | Bacteria | 1361 |
| 176 | Ga0207645_10013783 | 3300025907 | Bacteria | 5424 |
| 177 | Ga0207705_10002124 | 3300025909 | Bacteria | 15378 |
| 178 | Ga0207705_10118878 | 3300025909 | Bacteria | 1959 |
| 179 | Ga0207654_10013270 | 3300025911 | Bacteria | 4236 |
| 180 | Ga0207654_10206714 | 3300025911 | Bacteria | 1296 |
| 181 | Ga0207707_10109298 | 3300025912 | Bacteria | 2417 |
| 182 | Ga0207707_10132747 | 3300025912 | Bacteria | 2177 |
| 183 | Ga0207695_10000039 | 3300025913 | Bacteria | 454801 |
| 184 | Ga0207671_10009669 | 3300025914 | Bacteria | 8031 |
| 185 | Ga0207671_10073130 | 3300025914 | Bacteria | 2560 |
| 186 | Ga0207671_10506177 | 3300025914 | Bacteria | 963 |
| 187 | Ga0207660_10020274 | 3300025917 | Bacteria | 4458 |
| 188 | Ga0207660_10231381 | 3300025917 | Bacteria | 1453 |
| 189 | Ga0207662_10131201 | 3300025918 | Bacteria | 1580 |
| 190 | Ga0207662_10222033 | 3300025918 | Bacteria | 1231 |
| 191 | Ga0207657_10019311 | 3300025919 | Bacteria | 6476 |
| 192 | Ga0207649_10005637 | 3300025920 | Bacteria | 6775 |
| 193 | Ga0207649_10234708 | 3300025920 | Bacteria | 1313 |
| 194 | Ga0207652_10000768 | 3300025921 | Bacteria | 30720 |
| 195 | Ga0207644_10074215 | 3300025931 | Bacteria | 2496 |
| 196 | Ga0207644_10653851 | 3300025931 | Bacteria | 875 |
| 197 | Ga0207706_10010475 | 3300025933 | Bacteria | 8471 |
| 198 | Ga0207706_10071782 | 3300025933 | Bacteria | 3045 |
| 199 | Ga0207706_10819825 | 3300025933 | Bacteria | 789 |
| 200 | Ga0207686_10000793 | 3300025934 | Bacteria | 19399 |
| 201 | Ga0207686_10512125 | 3300025934 | Bacteria | 933 |
| 202 | Ga0207686_10628343 | 3300025934 | Bacteria | 848 |
| 203 | Ga0207670_10109205 | 3300025936 | Bacteria | 1990 |
| 204 | Ga0207670_10365686 | 3300025936 | Bacteria | 1145 |
| 205 | Ga0207669_10067624 | 3300025937 | Bacteria | 2228 |
| 206 | Ga0207669_10069749 | 3300025937 | Bacteria | 2201 |
| 207 | Ga0207704_10055389 | 3300025938 | Bacteria | 2423 |
| 208 | Ga0207691_10274068 | 3300025940 | Bacteria | 1452 |
| 209 | Ga0207689_10008911 | 3300025942 | Bacteria | 8701 |
| 210 | Ga0207689_10021899 | 3300025942 | Bacteria | 5375 |
| 211 | Ga0207689_10036403 | 3300025942 | Bacteria | 4086 |
| 212 | Ga0207689_10038760 | 3300025942 | Bacteria | 3945 |
| 213 | Ga0207661_10293603 | 3300025944 | Bacteria | 1455 |
| 214 | Ga0207679_10058769 | 3300025945 | Bacteria | 2851 |
| 215 | Ga0207667_10557014 | 3300025949 | Bacteria | 1159 |
| 216 | Ga0207667_10595993 | 3300025949 | Bacteria | 1115 |
| 217 | Ga0207651_10126863 | 3300025960 | Bacteria | 1946 |
| 218 | Ga0207651_10168375 | 3300025960 | Bacteria | 1725 |
| 219 | Ga0207651_11040361 | 3300025960 | Bacteria | 733 |
| 220 | Ga0207712_10001133 | 3300025961 | Bacteria | 18560 |
| 221 | Ga0207712_10108346 | 3300025961 | Bacteria | 2079 |
| 222 | Ga0207712_10319984 | 3300025961 | Bacteria | 1279 |
| 223 | Ga0207640_10031980 | 3300025981 | Bacteria | 3259 |
| 224 | Ga0207658_10140244 | 3300025986 | Bacteria | 1955 |
| 225 | Ga0207658_10149251 | 3300025986 | Bacteria | 1902 |
| 226 | Ga0207658_10202248 | 3300025986 | Bacteria | 1659 |
| 227 | Ga0207658_10495293 | 3300025986 | Bacteria | 1088 |
| 228 | Ga0207677_10391189 | 3300026023 | Bacteria | 1176 |
| 229 | Ga0207677_10576363 | 3300026023 | Bacteria | 984 |
| 230 | Ga0207703_10006254 | 3300026035 | Bacteria | 9523 |
| 231 | Ga0207639_10128558 | 3300026041 | Bacteria | 2094 |
| 232 | Ga0207639_10284886 | 3300026041 | Bacteria | 1454 |
| 233 | Ga0207639_11460695 | 3300026041 | Bacteria | 642 |
| 234 | Ga0207678_10161683 | 3300026067 | Bacteria | 1912 |
| 235 | Ga0207702_10144818 | 3300026078 | Bacteria | 2155 |
| 236 | Ga0207641_10000368 | 3300026088 | Bacteria | 53493 |
| 237 | Ga0207641_10005736 | 3300026088 | Bacteria | 10545 |
| 238 | Ga0207676_10323393 | 3300026095 | Bacteria | 1417 |
| 239 | Ga0207674_10004912 | 3300026116 | Bacteria | 15987 |
| 240 | Ga0207675_100110326 | 3300026118 | Bacteria | 2596 |
| 241 | Ga0207675_100239392 | 3300026118 | Unclassified | 1753 |
| 242 | Ga0207675_100492450 | 3300026118 | Bacteria | 1220 |
| 243 | Ga0207698_10002653 | 3300026142 | Bacteria | 10637 |
| 244 | Ga0207698_10004090 | 3300026142 | Bacteria | 8854 |
| 245 | Ga0207698_10061191 | 3300026142 | Bacteria | 2933 |
| 246 | Ga0207698_10358490 | 3300026142 | Bacteria | 1380 |
| 247 | Ga0207698_10669487 | 3300026142 | Bacteria | 1030 |
| 248 | Ga0268265_10683737 | 3300028380 | Bacteria | 990 |
| 249 | Ga0268265_10855253 | 3300028380 | Bacteria | 890 |
| 250 | Ga0268264_10002457 | 3300028381 | Bacteria | 16284 |
| 251 | Ga0268264_10395018 | 3300028381 | Bacteria | 1327 |
| 252 | Ga0268264_10411666 | 3300028381 | Bacteria | 1302 |
| 253 | Ga0268264_10558528 | 3300028381 | Bacteria | 1124 |
| 254 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 255 | Ga0265327_10010853 | 3300031251 | Bacteria | 6348 |
| 256 | Ga0265327_10015738 | 3300031251 | Bacteria | 4859 |
| 257 | Ga0307414_10000016 | 3300032004 | Bacteria | 249029 |
| 258 | Ga0307414_10586847 | 3300032004 | Bacteria | 998 |
| 259 | Ga0307414_10742304 | 3300032004 | Bacteria | 892 |
| 260 | Ga0307414_10828237 | 3300032004 | Bacteria | 845 |
| 261 | Ga0373947_0047414 | 3300035725 | Bacteria | 2575 |
| 262 | Ga0373937_0296846 | 3300036401 | Bacteria | 1527 |
| 263 | Ga0373937_1288335 | 3300036401 | Bacteria | 679 |
| 264 | Ga0395899_0114501 | 3300037312 | Unclassified | 1936 |
| 265 | Ga0395899_0285785 | 3300037312 | Bacteria | 1120 |
| 266 | Ga0395900_0224956 | 3300037418 | Bacteria | 1889 |
| 267 | Ga0395900_0289054 | 3300037418 | Unclassified | 1628 |
| 268 | Ga0395898_0138152 | 3300037466 | Unclassified | 2333 |
| 269 | Ga0395898_0200854 | 3300037466 | Bacteria | 1903 |
| 270 | Ga0395898_0976913 | 3300037466 | Bacteria | 783 |
| 271 | Ga0395905_0001555 | 3300037471 | Bacteria | 27418 |
| 272 | Ga0395901_0134469 | 3300038443 | Bacteria | 2599 |
| 273 | Ga0395901_0147077 | 3300038443 | Bacteria | 2476 |
| 274 | Ga0436365_0010910 | 3300039437 | Bacteria | 2468 |
| 275 | Ga0451807_1035199 | 3300041486 | Unclassified | 941 |
| 276 | Ga0451843_1063484 | 3300041509 | Bacteria | 711 |
| 277 | Ga0439454_038792 | 3300042011 | Bacteria | 773 |
| 278 | Ga0450894_008015 | 3300042131 | Bacteria | 1365 |
| 279 | Ga0450898_006538 | 3300042134 | Bacteria | 1792 |
| 280 | Ga0451577_0313638 | 3300042876 | Bacteria | 1422 |
| 281 | Ga0451577_0707696 | 3300042876 | Bacteria | 912 |
| 282 | Ga0453683_0000090 | 3300044673 | Bacteria | 137022 |
| 283 | Ga0453683_0002145 | 3300044673 | Bacteria | 15718 |
| 284 | Ga0453683_0406944 | 3300044673 | Bacteria | 877 |
| 285 | Ga0453684_0001905 | 3300044712 | Bacteria | 54154 |
| 286 | Ga0453684_0104662 | 3300044712 | Bacteria | 3454 |
| 287 | Ga0451576_0032928 | 3300045051 | Bacteria | 5511 |
| 288 | Ga0495638_0287513 | 3300046460 | Bacteria | 891 |
| 289 | Ga0495639_0352357 | 3300046475 | Bacteria | 739 |
| 290 | Ga0495630_0885886 | 3300046517 | Bacteria | 680 |
| 291 | Ga0495586_0462813 | 3300046535 | Bacteria | 731 |
| 292 | Ga0495645_0554388 | 3300046543 | Bacteria | 712 |
| 293 | Ga0495634_0349868 | 3300046642 | Bacteria | 885 |
| 294 | Ga0495635_0162320 | 3300046663 | Bacteria | 1521 |
| 295 | Ga0495658_0526482 | 3300046683 | Bacteria | 757 |
| 296 | Ga0495600_0315648 | 3300046809 | Bacteria | 984 |
| 297 | Ga0495672_0028363 | 3300047320 | Bacteria | 3544 |
| 298 | Ga0495676_0099121 | 3300047321 | Bacteria | 2160 |
| 299 | Ga0495686_0026406 | 3300047472 | Unclassified | 3799 |
| 300 | Ga0496115_0002270 | 3300048918 | Bacteria | 13755 |
| 301 | Ga0501034_0015190 | 3300049571 | Bacteria | 7915 |
| 302 | Ga0501209_162639 | 3300049656 | Bacteria | 676 |
| 303 | Ga0501044_0419037 | 3300049823 | Bacteria | 1249 |
| 304 | nmdc:mga0k408_3656_c1 | 3300050493 | Bacteria | 8138 |
| 305 | nmdc:mga0k408_37528_c1 | 3300050493 | Bacteria | 2782 |
| 306 | nmdc:mga08y16_142949_c1 | 3300050511 | Bacteria | 2487 |
| 307 | nmdc:mga08y16_708958_c1 | 3300050511 | Bacteria | 1005 |
| 308 | Ga0500562_000038 | 3300053108 | Bacteria | 72186 |
| 309 | Ga0500568_0000231 | 3300053139 | Bacteria | 47879 |
| 310 | Ga0500622_0000340 | 3300053156 | Bacteria | 45986 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026041 | Ga0207639_11460695 | Ga0207639_114606951 | 177 |
| 2 | 3300005340 | Ga0070689_100240205 | Ga0070689_1002402051 | 182 |
| 3 | 3300005343 | Ga0070687_100021071 | Ga0070687_1000210712 | 182 |
| 4 | 3300005616 | Ga0068852_100735717 | Ga0068852_1007357171 | 182 |
| 5 | 3300025918 | Ga0207662_10222033 | Ga0207662_102220332 | 182 |
| 6 | 3300025936 | Ga0207670_10109205 | Ga0207670_101092052 | 182 |
| 7 | 3300026142 | Ga0207698_10669487 | Ga0207698_106694871 | 182 |
| 8 | 3300036401 | Ga0373937_1288335 | Ga0373937_1288335_12_575 | 182 |
| 9 | 3300037466 | Ga0395898_0976913 | Ga0395898_0976913_206_769 | 182 |
| 10 | 3300042011 | Ga0439454_038792 | Ga0439454_038792_196_759 | 182 |
| 11 | 3300044673 | Ga0453683_0406944 | Ga0453683_0406944_291_863 | 182 |
| 12 | 3300013296 | Ga0157374_10874571 | Ga0157374_108745711 | 184 |
| 13 | 3300003322 | rootL2_10008241 | rootL2_100082411 | 188 |
| 14 | 3300005327 | Ga0070658_10001614 | Ga0070658_1000161410 | 189 |
| 15 | 3300005327 | Ga0070658_10092299 | Ga0070658_100922992 | 189 |
| 16 | 3300005328 | Ga0070676_10123414 | Ga0070676_101234143 | 189 |
| 17 | 3300005328 | Ga0070676_10182922 | Ga0070676_101829222 | 189 |
| 18 | 3300005329 | Ga0070683_100010096 | Ga0070683_10001009611 | 189 |
| 19 | 3300005331 | Ga0070670_100874785 | Ga0070670_1008747851 | 189 |
| 20 | 3300005334 | Ga0068869_100029859 | Ga0068869_1000298593 | 189 |
| 21 | 3300005335 | Ga0070666_10000042 | Ga0070666_1000004214 | 189 |
| 22 | 3300005336 | Ga0070680_100234769 | Ga0070680_1002347694 | 189 |
| 23 | 3300005336 | Ga0070680_100253969 | Ga0070680_1002539692 | 189 |
| 24 | 3300005336 | Ga0070680_100442985 | Ga0070680_1004429852 | 189 |
| 25 | 3300005338 | Ga0068868_100011877 | Ga0068868_1000118776 | 189 |
| 26 | 3300005339 | Ga0070660_100029501 | Ga0070660_1000295012 | 189 |
| 27 | 3300005340 | Ga0070689_100764030 | Ga0070689_1007640301 | 189 |
| 28 | 3300005344 | Ga0070661_100001575 | Ga0070661_1000015756 | 189 |
| 29 | 3300005347 | Ga0070668_100372296 | Ga0070668_1003722962 | 189 |
| 30 | 3300005355 | Ga0070671_100360449 | Ga0070671_1003604493 | 189 |
| 31 | 3300005355 | Ga0070671_101232862 | Ga0070671_1012328621 | 189 |
| 32 | 3300005364 | Ga0070673_100203878 | Ga0070673_1002038782 | 189 |
| 33 | 3300005366 | Ga0070659_100046549 | Ga0070659_1000465491 | 189 |
| 34 | 3300005367 | Ga0070667_100213764 | Ga0070667_1002137642 | 189 |
| 35 | 3300005367 | Ga0070667_100734416 | Ga0070667_1007344161 | 189 |
| 36 | 3300005455 | Ga0070663_100384631 | Ga0070663_1003846312 | 189 |
| 37 | 3300005457 | Ga0070662_100200109 | Ga0070662_1002001092 | 189 |
| 38 | 3300005457 | Ga0070662_100845830 | Ga0070662_1008458301 | 189 |
| 39 | 3300005458 | Ga0070681_10323761 | Ga0070681_103237612 | 189 |
| 40 | 3300005459 | Ga0068867_100543975 | Ga0068867_1005439751 | 189 |
| 41 | 3300005530 | Ga0070679_100002897 | Ga0070679_1000028976 | 189 |
| 42 | 3300005535 | Ga0070684_100047554 | Ga0070684_1000475542 | 189 |
| 43 | 3300005535 | Ga0070684_100503571 | Ga0070684_1005035712 | 189 |
| 44 | 3300005535 | Ga0070684_101341904 | Ga0070684_1013419041 | 189 |
| 45 | 3300005539 | Ga0068853_100001770 | Ga0068853_10000177010 | 189 |
| 46 | 3300005544 | Ga0070686_100853357 | Ga0070686_1008533571 | 189 |
| 47 | 3300005547 | Ga0070693_100144426 | Ga0070693_1001444262 | 189 |
| 48 | 3300005547 | Ga0070693_100265310 | Ga0070693_1002653101 | 189 |
| 49 | 3300005548 | Ga0070665_100263958 | Ga0070665_1002639583 | 189 |
| 50 | 3300005564 | Ga0070664_100004100 | Ga0070664_1000041006 | 189 |
| 51 | 3300005577 | Ga0068857_100051054 | Ga0068857_1000510545 | 189 |
| 52 | 3300005578 | Ga0068854_100327778 | Ga0068854_1003277783 | 189 |
| 53 | 3300005616 | Ga0068852_100003800 | Ga0068852_10000380010 | 189 |
| 54 | 3300005616 | Ga0068852_100012047 | Ga0068852_1000120472 | 189 |
| 55 | 3300005616 | Ga0068852_100080971 | Ga0068852_1000809714 | 189 |
| 56 | 3300005617 | Ga0068859_100000768 | Ga0068859_10000076812 | 189 |
| 57 | 3300005617 | Ga0068859_100037557 | Ga0068859_1000375573 | 189 |
| 58 | 3300005618 | Ga0068864_100082025 | Ga0068864_1000820253 | 189 |
| 59 | 3300005719 | Ga0068861_100444180 | Ga0068861_1004441801 | 189 |
| 60 | 3300005841 | Ga0068863_100128182 | Ga0068863_1001281824 | 189 |
| 61 | 3300005841 | Ga0068863_100145497 | Ga0068863_1001454975 | 189 |
| 62 | 3300005842 | Ga0068858_100066234 | Ga0068858_1000662345 | 189 |
| 63 | 3300005843 | Ga0068860_100001707 | Ga0068860_10000170722 | 189 |
| 64 | 3300005843 | Ga0068860_100083787 | Ga0068860_1000837873 | 189 |
| 65 | 3300005843 | Ga0068860_100784324 | Ga0068860_1007843243 | 189 |
| 66 | 3300005844 | Ga0068862_100152151 | Ga0068862_1001521512 | 189 |
| 67 | 3300006195 | Ga0075366_10110642 | Ga0075366_101106422 | 189 |
| 68 | 3300006237 | Ga0097621_100319979 | Ga0097621_1003199792 | 189 |
| 69 | 3300006358 | Ga0068871_100263580 | Ga0068871_1002635802 | 189 |
| 70 | 3300006931 | Ga0097620_100000768 | Ga0097620_10000076812 | 189 |
| 71 | 3300006931 | Ga0097620_100037557 | Ga0097620_1000375573 | 189 |
| 72 | 3300009093 | Ga0105240_10001190 | Ga0105240_1000119020 | 189 |
| 73 | 3300009093 | Ga0105240_10325813 | Ga0105240_103258133 | 189 |
| 74 | 3300009174 | Ga0105241_10000853 | Ga0105241_100008539 | 189 |
| 75 | 3300009174 | Ga0105241_10171896 | Ga0105241_101718961 | 189 |
| 76 | 3300009174 | Ga0105241_10321103 | Ga0105241_103211032 | 189 |
| 77 | 3300009176 | Ga0105242_10172478 | Ga0105242_101724781 | 189 |
| 78 | 3300009176 | Ga0105242_10950092 | Ga0105242_109500921 | 189 |
| 79 | 3300009545 | Ga0105237_10000833 | Ga0105237_1000083326 | 189 |
| 80 | 3300009545 | Ga0105237_10124870 | Ga0105237_101248702 | 189 |
| 81 | 3300009553 | Ga0105249_10001650 | Ga0105249_100016501 | 189 |
| 82 | 3300010375 | Ga0105239_10019904 | Ga0105239_100199046 | 189 |
| 83 | 3300010375 | Ga0105239_10448227 | Ga0105239_104482272 | 189 |
| 84 | 3300010375 | Ga0105239_10454463 | Ga0105239_104544632 | 189 |
| 85 | 3300011119 | Ga0105246_10003384 | Ga0105246_1000338413 | 189 |
| 86 | 3300011119 | Ga0105246_10024300 | Ga0105246_100243004 | 189 |
| 87 | 3300011119 | Ga0105246_10306054 | Ga0105246_103060541 | 189 |
| 88 | 3300013100 | Ga0157373_10027326 | Ga0157373_100273262 | 189 |
| 89 | 3300013100 | Ga0157373_10095795 | Ga0157373_100957952 | 189 |
| 90 | 3300013102 | Ga0157371_10134170 | Ga0157371_101341702 | 189 |
| 91 | 3300013105 | Ga0157369_10161940 | Ga0157369_101619402 | 189 |
| 92 | 3300013105 | Ga0157369_11104665 | Ga0157369_111046651 | 189 |
| 93 | 3300013296 | Ga0157374_10317536 | Ga0157374_103175362 | 189 |
| 94 | 3300013297 | Ga0157378_10073750 | Ga0157378_100737503 | 189 |
| 95 | 3300013306 | Ga0163162_10025120 | Ga0163162_100251208 | 189 |
| 96 | 3300013307 | Ga0157372_10000683 | Ga0157372_1000068310 | 189 |
| 97 | 3300013307 | Ga0157372_10562779 | Ga0157372_105627792 | 189 |
| 98 | 3300013307 | Ga0157372_10639775 | Ga0157372_106397751 | 189 |
| 99 | 3300013307 | Ga0157372_11246969 | Ga0157372_112469692 | 189 |
| 100 | 3300013308 | Ga0157375_10835293 | Ga0157375_108352932 | 189 |
| 101 | 3300014325 | Ga0163163_10734176 | Ga0163163_107341762 | 189 |
| 102 | 3300014326 | Ga0157380_10301054 | Ga0157380_103010542 | 189 |
| 103 | 3300014745 | Ga0157377_10013010 | Ga0157377_100130102 | 189 |
| 104 | 3300014968 | Ga0157379_10738155 | Ga0157379_107381551 | 189 |
| 105 | 3300014969 | Ga0157376_10142939 | Ga0157376_101429391 | 189 |
| 106 | 3300014969 | Ga0157376_10250581 | Ga0157376_102505812 | 189 |
| 107 | 3300025901 | Ga0207688_10457810 | Ga0207688_104578101 | 189 |
| 108 | 3300025903 | Ga0207680_10000448 | Ga0207680_1000044814 | 189 |
| 109 | 3300025903 | Ga0207680_10443268 | Ga0207680_104432681 | 189 |
| 110 | 3300025907 | Ga0207645_10013783 | Ga0207645_100137834 | 189 |
| 111 | 3300025909 | Ga0207705_10002124 | Ga0207705_1000212424 | 189 |
| 112 | 3300025909 | Ga0207705_10118878 | Ga0207705_101188782 | 189 |
| 113 | 3300025911 | Ga0207654_10013270 | Ga0207654_100132702 | 189 |
| 114 | 3300025911 | Ga0207654_10206714 | Ga0207654_102067142 | 189 |
| 115 | 3300025912 | Ga0207707_10109298 | Ga0207707_101092981 | 189 |
| 116 | 3300025912 | Ga0207707_10132747 | Ga0207707_101327472 | 189 |
| 117 | 3300025913 | Ga0207695_10000039 | Ga0207695_10000039194 | 189 |
| 118 | 3300025914 | Ga0207671_10009669 | Ga0207671_100096697 | 189 |
| 119 | 3300025914 | Ga0207671_10073130 | Ga0207671_100731302 | 189 |
| 120 | 3300025914 | Ga0207671_10506177 | Ga0207671_105061771 | 189 |
| 121 | 3300025917 | Ga0207660_10020274 | Ga0207660_100202743 | 189 |
| 122 | 3300025917 | Ga0207660_10231381 | Ga0207660_102313812 | 189 |
| 123 | 3300025919 | Ga0207657_10019311 | Ga0207657_100193114 | 189 |
| 124 | 3300025920 | Ga0207649_10005637 | Ga0207649_100056379 | 189 |
| 125 | 3300025921 | Ga0207652_10000768 | Ga0207652_100007686 | 189 |
| 126 | 3300025931 | Ga0207644_10653851 | Ga0207644_106538511 | 189 |
| 127 | 3300025933 | Ga0207706_10071782 | Ga0207706_100717825 | 189 |
| 128 | 3300025933 | Ga0207706_10819825 | Ga0207706_108198252 | 189 |
| 129 | 3300025934 | Ga0207686_10628343 | Ga0207686_106283431 | 189 |
| 130 | 3300025937 | Ga0207669_10067624 | Ga0207669_100676243 | 189 |
| 131 | 3300025937 | Ga0207669_10069749 | Ga0207669_100697492 | 189 |
| 132 | 3300025942 | Ga0207689_10008911 | Ga0207689_100089116 | 189 |
| 133 | 3300025942 | Ga0207689_10036403 | Ga0207689_100364032 | 189 |
| 134 | 3300025942 | Ga0207689_10038760 | Ga0207689_100387605 | 189 |
| 135 | 3300025944 | Ga0207661_10293603 | Ga0207661_102936032 | 189 |
| 136 | 3300025945 | Ga0207679_10058769 | Ga0207679_100587694 | 189 |
| 137 | 3300025949 | Ga0207667_10557014 | Ga0207667_105570141 | 189 |
| 138 | 3300025949 | Ga0207667_10595993 | Ga0207667_105959932 | 189 |
| 139 | 3300025960 | Ga0207651_10126863 | Ga0207651_101268632 | 189 |
| 140 | 3300025960 | Ga0207651_11040361 | Ga0207651_110403611 | 189 |
| 141 | 3300025961 | Ga0207712_10108346 | Ga0207712_101083463 | 189 |
| 142 | 3300025986 | Ga0207658_10149251 | Ga0207658_101492513 | 189 |
| 143 | 3300025986 | Ga0207658_10202248 | Ga0207658_102022482 | 189 |
| 144 | 3300026023 | Ga0207677_10391189 | Ga0207677_103911892 | 189 |
| 145 | 3300026035 | Ga0207703_10006254 | Ga0207703_1000625414 | 189 |
| 146 | 3300026067 | Ga0207678_10161683 | Ga0207678_101616833 | 189 |
| 147 | 3300026078 | Ga0207702_10144818 | Ga0207702_101448182 | 189 |
| 148 | 3300026088 | Ga0207641_10005736 | Ga0207641_100057367 | 189 |
| 149 | 3300026116 | Ga0207674_10004912 | Ga0207674_1000491220 | 189 |
| 150 | 3300026118 | Ga0207675_100239392 | Ga0207675_1002393921 | 189 |
| 151 | 3300026118 | Ga0207675_100492450 | Ga0207675_1004924502 | 189 |
| 152 | 3300026142 | Ga0207698_10002653 | Ga0207698_100026537 | 189 |
| 153 | 3300026142 | Ga0207698_10004090 | Ga0207698_100040907 | 189 |
| 154 | 3300026142 | Ga0207698_10061191 | Ga0207698_100611911 | 189 |
| 155 | 3300028380 | Ga0268265_10855253 | Ga0268265_108552532 | 189 |
| 156 | 3300028381 | Ga0268264_10002457 | Ga0268264_100024578 | 189 |
| 157 | 3300028381 | Ga0268264_10395018 | Ga0268264_103950182 | 189 |
| 158 | 3300032004 | Ga0307414_10000016 | Ga0307414_10000016173 | 189 |
| 159 | 3300032004 | Ga0307414_10586847 | Ga0307414_105868472 | 189 |
| 160 | 3300032004 | Ga0307414_10742304 | Ga0307414_107423041 | 189 |
| 161 | 3300032004 | Ga0307414_10828237 | Ga0307414_108282371 | 189 |
| 162 | 3300035725 | Ga0373947_0047414 | Ga0373947_0047414_630_1247 | 189 |
| 163 | 3300036401 | Ga0373937_0296846 | Ga0373937_0296846_498_1106 | 189 |
| 164 | 3300037312 | Ga0395899_0114501 | Ga0395899_0114501_784_1392 | 189 |
| 165 | 3300037312 | Ga0395899_0285785 | Ga0395899_0285785_413_1021 | 189 |
| 166 | 3300037418 | Ga0395900_0224956 | Ga0395900_0224956_847_1455 | 189 |
| 167 | 3300037418 | Ga0395900_0289054 | Ga0395900_0289054_232_840 | 189 |
| 168 | 3300037466 | Ga0395898_0138152 | Ga0395898_0138152_1336_1944 | 189 |
| 169 | 3300037466 | Ga0395898_0200854 | Ga0395898_0200854_435_1043 | 189 |
| 170 | 3300037471 | Ga0395905_0001555 | Ga0395905_0001555_17278_17886 | 189 |
| 171 | 3300038443 | Ga0395901_0134469 | Ga0395901_0134469_1084_1692 | 189 |
| 172 | 3300038443 | Ga0395901_0147077 | Ga0395901_0147077_324_932 | 189 |
| 173 | 3300041509 | Ga0451843_1063484 | Ga0451843_1063484_74_682 | 189 |
| 174 | 3300042131 | Ga0450894_008015 | Ga0450894_008015_675_1283 | 189 |
| 175 | 3300042134 | Ga0450898_006538 | Ga0450898_006538_1155_1763 | 189 |
| 176 | 3300042876 | Ga0451577_0313638 | Ga0451577_0313638_752_1360 | 189 |
| 177 | 3300042876 | Ga0451577_0707696 | Ga0451577_0707696_146_763 | 189 |
| 178 | 3300044673 | Ga0453683_0002145 | Ga0453683_0002145_243_866 | 189 |
| 179 | 3300044712 | Ga0453684_0001905 | Ga0453684_0001905_40016_40585 | 189 |
| 180 | 3300044712 | Ga0453684_0104662 | Ga0453684_0104662_641_1264 | 189 |
| 181 | 3300045051 | Ga0451576_0032928 | Ga0451576_0032928_2956_3579 | 189 |
| 182 | 3300046460 | Ga0495638_0287513 | Ga0495638_0287513_16_624 | 189 |
| 183 | 3300046475 | Ga0495639_0352357 | Ga0495639_0352357_66_683 | 189 |
| 184 | 3300046535 | Ga0495586_0462813 | Ga0495586_0462813_137_721 | 189 |
| 185 | 3300046543 | Ga0495645_0554388 | Ga0495645_0554388_80_688 | 189 |
| 186 | 3300046642 | Ga0495634_0349868 | Ga0495634_0349868_159_782 | 189 |
| 187 | 3300046663 | Ga0495635_0162320 | Ga0495635_0162320_212_835 | 189 |
| 188 | 3300046809 | Ga0495600_0315648 | Ga0495600_0315648_314_922 | 189 |
| 189 | 3300047321 | Ga0495676_0099121 | Ga0495676_0099121_899_1516 | 189 |
| 190 | 3300049571 | Ga0501034_0015190 | Ga0501034_0015190_4817_5425 | 189 |
| 191 | 3300049656 | Ga0501209_162639 | Ga0501209_162639_64_666 | 189 |
| 192 | 3300049823 | Ga0501044_0419037 | Ga0501044_0419037_204_812 | 189 |
| 193 | 3300050493 | nmdc:mga0k408_3656_c1 | nmdc:mga0k408_3656_c1_1589_2197 | 189 |
| 194 | 3300053108 | Ga0500562_000038 | Ga0500562_000038_29054_29647 | 189 |
| 195 | 3300053139 | Ga0500568_0000231 | Ga0500568_0000231_294_902 | 189 |
| 196 | 3300053156 | Ga0500622_0000340 | Ga0500622_0000340_21079_21648 | 189 |
| 197 | iso_pu_bacteria | 2881359912 | 2881362129 | 189 |
| 198 | 3300003322 | rootL2_10004462 | rootL2_100044622 | 190 |
| 199 | 3300005289 | Ga0065704_10223544 | Ga0065704_102235441 | 190 |
| 200 | 3300005290 | Ga0065712_10071173 | Ga0065712_100711732 | 190 |
| 201 | 3300005290 | Ga0065712_10282717 | Ga0065712_102827171 | 190 |
| 202 | 3300005290 | Ga0065712_10412770 | Ga0065712_104127701 | 190 |
| 203 | 3300005330 | Ga0070690_100032549 | Ga0070690_1000325493 | 190 |
| 204 | 3300005335 | Ga0070666_10019411 | Ga0070666_100194113 | 190 |
| 205 | 3300005337 | Ga0070682_100217566 | Ga0070682_1002175663 | 190 |
| 206 | 3300005338 | Ga0068868_100045700 | Ga0068868_1000457002 | 190 |
| 207 | 3300005340 | Ga0070689_100038671 | Ga0070689_1000386712 | 190 |
| 208 | 3300005340 | Ga0070689_100290955 | Ga0070689_1002909551 | 190 |
| 209 | 3300005343 | Ga0070687_100091203 | Ga0070687_1000912032 | 190 |
| 210 | 3300005344 | Ga0070661_100170623 | Ga0070661_1001706233 | 190 |
| 211 | 3300005353 | Ga0070669_100483808 | Ga0070669_1004838081 | 190 |
| 212 | 3300005364 | Ga0070673_100099673 | Ga0070673_1000996732 | 190 |
| 213 | 3300005367 | Ga0070667_100030009 | Ga0070667_1000300093 | 190 |
| 214 | 3300005367 | Ga0070667_100188830 | Ga0070667_1001888302 | 190 |
| 215 | 3300005457 | Ga0070662_100051116 | Ga0070662_1000511163 | 190 |
| 216 | 3300005459 | Ga0068867_100232541 | Ga0068867_1002325414 | 190 |
| 217 | 3300005466 | Ga0070685_10020865 | Ga0070685_100208652 | 190 |
| 218 | 3300005539 | Ga0068853_100085615 | Ga0068853_1000856152 | 190 |
| 219 | 3300005539 | Ga0068853_100785633 | Ga0068853_1007856331 | 190 |
| 220 | 3300005544 | Ga0070686_100040959 | Ga0070686_1000409593 | 190 |
| 221 | 3300005547 | Ga0070693_100547278 | Ga0070693_1005472781 | 190 |
| 222 | 3300005578 | Ga0068854_100014699 | Ga0068854_1000146999 | 190 |
| 223 | 3300005616 | Ga0068852_100080329 | Ga0068852_1000803293 | 190 |
| 224 | 3300005617 | Ga0068859_100015256 | Ga0068859_1000152566 | 190 |
| 225 | 3300005617 | Ga0068859_100240463 | Ga0068859_1002404631 | 190 |
| 226 | 3300005719 | Ga0068861_100052171 | Ga0068861_1000521712 | 190 |
| 227 | 3300005834 | Ga0068851_10000330 | Ga0068851_100003308 | 190 |
| 228 | 3300005834 | Ga0068851_10094735 | Ga0068851_100947352 | 190 |
| 229 | 3300005841 | Ga0068863_100009065 | Ga0068863_1000090654 | 190 |
| 230 | 3300005841 | Ga0068863_100147532 | Ga0068863_1001475322 | 190 |
| 231 | 3300005841 | Ga0068863_100292021 | Ga0068863_1002920213 | 190 |
| 232 | 3300005842 | Ga0068858_100378691 | Ga0068858_1003786912 | 190 |
| 233 | 3300005843 | Ga0068860_100059558 | Ga0068860_1000595584 | 190 |
| 234 | 3300006163 | Ga0070715_10016818 | Ga0070715_100168183 | 190 |
| 235 | 3300006163 | Ga0070715_10045234 | Ga0070715_100452343 | 190 |
| 236 | 3300006195 | Ga0075366_10001550 | Ga0075366_1000155013 | 190 |
| 237 | 3300006237 | Ga0097621_100013530 | Ga0097621_1000135303 | 190 |
| 238 | 3300006237 | Ga0097621_100055710 | Ga0097621_1000557103 | 190 |
| 239 | 3300006237 | Ga0097621_101063687 | Ga0097621_1010636871 | 190 |
| 240 | 3300006358 | Ga0068871_100011948 | Ga0068871_1000119484 | 190 |
| 241 | 3300006358 | Ga0068871_100063065 | Ga0068871_1000630654 | 190 |
| 242 | 3300006358 | Ga0068871_100949480 | Ga0068871_1009494801 | 190 |
| 243 | 3300006844 | Ga0075428_100212120 | Ga0075428_1002121202 | 190 |
| 244 | 3300006881 | Ga0068865_100107194 | Ga0068865_1001071944 | 190 |
| 245 | 3300006931 | Ga0097620_100015256 | Ga0097620_1000152566 | 190 |
| 246 | 3300006931 | Ga0097620_100240479 | Ga0097620_1002404791 | 190 |
| 247 | 3300009176 | Ga0105242_10066940 | Ga0105242_100669405 | 190 |
| 248 | 3300009176 | Ga0105242_10101319 | Ga0105242_101013192 | 190 |
| 249 | 3300009176 | Ga0105242_10800037 | Ga0105242_108000372 | 190 |
| 250 | 3300009176 | Ga0105242_11240169 | Ga0105242_112401691 | 190 |
| 251 | 3300009177 | Ga0105248_10174783 | Ga0105248_101747831 | 190 |
| 252 | 3300009553 | Ga0105249_10002726 | Ga0105249_1000272619 | 190 |
| 253 | 3300009553 | Ga0105249_10162644 | Ga0105249_101626441 | 190 |
| 254 | 3300013297 | Ga0157378_10083322 | Ga0157378_100833223 | 190 |
| 255 | 3300013297 | Ga0157378_10588883 | Ga0157378_105888831 | 190 |
| 256 | 3300013306 | Ga0163162_10054907 | Ga0163162_100549076 | 190 |
| 257 | 3300013306 | Ga0163162_10335311 | Ga0163162_103353112 | 190 |
| 258 | 3300013308 | Ga0157375_10033149 | Ga0157375_100331497 | 190 |
| 259 | 3300013308 | Ga0157375_10211795 | Ga0157375_102117954 | 190 |
| 260 | 3300013308 | Ga0157375_10358342 | Ga0157375_103583421 | 190 |
| 261 | 3300014325 | Ga0163163_10341892 | Ga0163163_103418922 | 190 |
| 262 | 3300014325 | Ga0163163_11032066 | Ga0163163_110320661 | 190 |
| 263 | 3300014326 | Ga0157380_10381624 | Ga0157380_103816241 | 190 |
| 264 | 3300014969 | Ga0157376_10051608 | Ga0157376_100516084 | 190 |
| 265 | 3300014969 | Ga0157376_10100474 | Ga0157376_101004743 | 190 |
| 266 | 3300017792 | Ga0163161_10010043 | Ga0163161_100100434 | 190 |
| 267 | 3300017792 | Ga0163161_10028739 | Ga0163161_100287397 | 190 |
| 268 | 3300017792 | Ga0163161_10289904 | Ga0163161_102899042 | 190 |
| 269 | 3300025302 | Ga0207426_1000002 | Ga0207426_1000002366 | 190 |
| 270 | 3300025321 | Ga0207656_10000197 | Ga0207656_100001978 | 190 |
| 271 | 3300025905 | Ga0207685_10078228 | Ga0207685_100782282 | 190 |
| 272 | 3300025918 | Ga0207662_10131201 | Ga0207662_101312012 | 190 |
| 273 | 3300025920 | Ga0207649_10234708 | Ga0207649_102347081 | 190 |
| 274 | 3300025931 | Ga0207644_10074215 | Ga0207644_100742152 | 190 |
| 275 | 3300025933 | Ga0207706_10010475 | Ga0207706_100104758 | 190 |
| 276 | 3300025934 | Ga0207686_10000793 | Ga0207686_100007937 | 190 |
| 277 | 3300025934 | Ga0207686_10512125 | Ga0207686_105121252 | 190 |
| 278 | 3300025936 | Ga0207670_10365686 | Ga0207670_103656862 | 190 |
| 279 | 3300025938 | Ga0207704_10055389 | Ga0207704_100553892 | 190 |
| 280 | 3300025940 | Ga0207691_10274068 | Ga0207691_102740682 | 190 |
| 281 | 3300025942 | Ga0207689_10021899 | Ga0207689_1002189910 | 190 |
| 282 | 3300025960 | Ga0207651_10168375 | Ga0207651_101683752 | 190 |
| 283 | 3300025961 | Ga0207712_10001133 | Ga0207712_1000113319 | 190 |
| 284 | 3300025961 | Ga0207712_10319984 | Ga0207712_103199842 | 190 |
| 285 | 3300025981 | Ga0207640_10031980 | Ga0207640_100319802 | 190 |
| 286 | 3300025986 | Ga0207658_10140244 | Ga0207658_101402443 | 190 |
| 287 | 3300025986 | Ga0207658_10495293 | Ga0207658_104952932 | 190 |
| 288 | 3300026023 | Ga0207677_10576363 | Ga0207677_105763631 | 190 |
| 289 | 3300026041 | Ga0207639_10128558 | Ga0207639_101285582 | 190 |
| 290 | 3300026041 | Ga0207639_10284886 | Ga0207639_102848862 | 190 |
| 291 | 3300026088 | Ga0207641_10000368 | Ga0207641_1000036811 | 190 |
| 292 | 3300026095 | Ga0207676_10323393 | Ga0207676_103233931 | 190 |
| 293 | 3300026118 | Ga0207675_100110326 | Ga0207675_1001103262 | 190 |
| 294 | 3300026142 | Ga0207698_10358490 | Ga0207698_103584902 | 190 |
| 295 | 3300028380 | Ga0268265_10683737 | Ga0268265_106837371 | 190 |
| 296 | 3300028381 | Ga0268264_10411666 | Ga0268264_104116662 | 190 |
| 297 | 3300028381 | Ga0268264_10558528 | Ga0268264_105585282 | 190 |
| 298 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002277 | 190 |
| 299 | 3300031251 | Ga0265327_10010853 | Ga0265327_1001085310 | 190 |
| 300 | 3300031251 | Ga0265327_10015738 | Ga0265327_100157383 | 190 |
| 301 | 3300039437 | Ga0436365_0010910 | Ga0436365_0010910_582_1274 | 190 |
| 302 | 3300041486 | Ga0451807_1035199 | Ga0451807_1035199_308_919 | 190 |
| 303 | 3300044673 | Ga0453683_0000090 | Ga0453683_0000090_14590_15201 | 190 |
| 304 | 3300046517 | Ga0495630_0885886 | Ga0495630_0885886_18_650 | 190 |
| 305 | 3300046683 | Ga0495658_0526482 | Ga0495658_0526482_119_730 | 190 |
| 306 | 3300047320 | Ga0495672_0028363 | Ga0495672_0028363_2620_3297 | 190 |
| 307 | 3300047472 | Ga0495686_0026406 | Ga0495686_0026406_1268_1879 | 190 |
| 308 | 3300048918 | Ga0496115_0002270 | Ga0496115_0002270_304_891 | 190 |
| 309 | 3300050493 | nmdc:mga0k408_37528_c1 | nmdc:mga0k408_37528_c1_1499_2110 | 190 |
| 310 | 3300050511 | nmdc:mga08y16_142949_c1 | nmdc:mga08y16_142949_c1_926_1537 | 190 |
| 311 | 3300050511 | nmdc:mga08y16_708958_c1 | nmdc:mga08y16_708958_c1_161_772 | 190 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tqb-assembly1.cif.gz_A | structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with folate | 0.7407 | 30 | 179 |
| 2gd9-assembly1.cif.gz_B | crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution | 0.7371 | 2 | 179 |
| 2jyb-assembly1.cif.gz_A | binary hvdhfr1:folate complex | 0.731 | 2 | 184 |
| 1vdr-assembly1.cif.gz_A | dihydrofolate reductase | 0.7179 | 2 | 180 |
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.7177 | 2 | 179 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3kgyB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7497 | 25 | 179 | 3.40.430.10 |
| 1vdrA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7179 | 2 | 180 | 3.40.430.10 |
| 1cz3B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.715 | 2 | 184 | 3.40.430.10 |
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7117 | 2 | 177 | 3.40.430.10 |
| 1vdrA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7062 | 2 | 180 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5K9Y5-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.9163 | 47 | 181 |
GO:0008703
GO:0009231 |
| AF-A0A537J602-F1-model_v4 | Deaminase | 0.9055 | 85 | 182 |
GO:0008703
GO:0009231 |
| AF-A0A1I2JP79-F1-model_v4 | RibD C-terminal domain-containing protein | 0.903 | 100 | 182 |
GO:0008703
GO:0009231 |
| AF-A0A538J2D1-F1-model_v4 | Dihydrofolate reductase | 0.9026 | 34 | 182 |
GO:0008703
GO:0009231 |
| AF-A0A534PLK5-F1-model_v4 | Dihydrofolate reductase | 0.9012 | 87 | 182 |
GO:0008703
GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar