F401485

General Info

Members Datasets Scaffolds Average Seq Length
311 245 622 187

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3002141150|3002141200
Length 202
Sequence STALPAETVMVKLNKIYTRTGDDGTTGLGSGDRRLKHDLRVEAYGTVDEANSCIGLARLYTEKEFPDIDAMLVRIQNDLFDLGADLATPDTCKKLDYEPLRIIDSQVLRVEADIDLLNEKLAPLRSFVLPGGSPASAALHLARTVARRAERHMVELVQKPDEIVTPAALKYINRVSDFLFVAARAVNDNGAKDVLWVPGKNR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
174 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
175 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
180 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
181 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
182 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
183 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
184 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
185 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
186 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
187 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
188 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
189 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
190 2643221558 Rhizobium sp. Root149 Isolate Unclassified
191 2643221582 Rhizobium sp. Root651 Isolate Unclassified
192 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
193 2643221693 Rhizobium sp. Root491 Isolate Unclassified
194 2643221719 Rhizobium sp. Root274 Isolate Unclassified
195 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
196 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
197 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
198 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
199 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
200 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
201 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
202 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
203 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
204 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
205 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
206 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
207 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
208 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
209 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
210 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
211 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
212 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
213 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
214 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
215 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
216 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
217 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
218 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
219 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
220 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
221 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
222 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
223 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
224 2902330777 Methylobacterium sp. 2A Isolate Unclassified
225 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
226 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
227 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
228 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
229 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
230 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
231 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
232 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
233 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
234 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
235 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
236 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
237 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
238 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
239 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
240 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
241 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
242 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
243 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
244 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
245 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.46
Metatranscriptomes 0
Isolates 21.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9
Nodule 9.32
Rhizoplane 2.57
Rhizosphere 61.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000006 3300001979 Bacteria 86112
2 JGI25155J39150_1000010 3300002704 Bacteria 207717
3 JGI25156J39149_1000033 3300002705 Bacteria 114688
4 JGI25156J39149_1000186 3300002705 Bacteria 45132
5 JGI25162J39368_1000413 3300002737 Bacteria 34872
6 JGI25154J39366_1000058 3300002738 Bacteria 107363
7 JGI25154J39366_1000187 3300002738 Bacteria 46590
8 JGI25157J39369_1000009 3300002741 Bacteria 207868
9 JGI25151J46595_10011077 3300003187 Bacteria 4160
10 JGI25165J46597_1000675 3300003214 Bacteria 27458
11 rootL2_10034535 3300003322 Bacteria 3661
12 Ga0055539_1005928 3300003752 Bacteria 1574
13 Ga0058692_1003402 3300003856 Bacteria 4918
14 Ga0058692_1003685 3300003856 Bacteria 4680
15 Ga0070683_100454455 3300005329 Bacteria 1222
16 Ga0070691_10000521 3300005341 Bacteria 14493
17 Ga0070709_10001436 3300005434 Bacteria 12862
18 Ga0070709_10304499 3300005434 Bacteria 1165
19 Ga0070714_100148562 3300005435 Bacteria 2109
20 Ga0070714_100487092 3300005435 Bacteria 1175
21 Ga0070713_100000199 3300005436 Bacteria 40083
22 Ga0070711_100025595 3300005439 Bacteria 3863
23 Ga0070711_100046190 3300005439 Bacteria 2966
24 Ga0070711_101322009 3300005439 Bacteria 626
25 Ga0070705_100112226 3300005440 Bacteria 1744
26 Ga0070663_100047823 3300005455 Bacteria 3031
27 Ga0070707_100269915 3300005468 Bacteria 1654
28 Ga0070707_100564782 3300005468 Bacteria 1100
29 Ga0070697_100331637 3300005536 Bacteria 1312
30 Ga0068853_100019990 3300005539 Bacteria 5563
31 Ga0070695_100010283 3300005545 Bacteria 5584
32 Ga0070693_100083144 3300005547 Bacteria 1913
33 Ga0070693_100203620 3300005547 Bacteria 1287
34 Ga0070665_100624043 3300005548 Bacteria 1091
35 Ga0068857_100002551 3300005577 Bacteria 14915
36 Ga0068854_100249107 3300005578 Bacteria 1418
37 Ga0068854_100280608 3300005578 Bacteria 1341
38 Ga0068856_100004606 3300005614 Bacteria 13715
39 Ga0068856_100010174 3300005614 Bacteria 9143
40 Ga0068856_100491763 3300005614 Bacteria 1248
41 Ga0068852_100030992 3300005616 Bacteria 4407
42 Ga0068858_100048518 3300005842 Bacteria 3934
43 Ga0081540_1001433 3300005983 Bacteria 20635
44 Ga0075365_10136635 3300006038 Bacteria 1699
45 Ga0075368_10008184 3300006042 Bacteria 3716
46 Ga0075368_10158851 3300006042 Bacteria 946
47 Ga0070712_100013632 3300006175 Bacteria 5197
48 Ga0070712_100155236 3300006175 Bacteria 1762
49 Ga0075367_10030893 3300006178 Bacteria 3074
50 Ga0075369_10058771 3300006186 Bacteria 1674
51 Ga0075430_100260944 3300006846 Bacteria 1435
52 Ga0075434_100065293 3300006871 Bacteria 3625
53 Ga0075434_100150428 3300006871 Bacteria 2348
54 Ga0075436_100006588 3300006914 Bacteria 7957
55 Ga0099826_10004861 3300006948 Bacteria 9505
56 Ga0099826_10016860 3300006948 Bacteria 5520
57 Ga0105240_10000013 3300009093 Bacteria 483458
58 Ga0105240_10054675 3300009093 Bacteria 5002
59 Ga0105243_10252111 3300009148 Bacteria 1576
60 Ga0105241_10020835 3300009174 Bacteria 4846
61 Ga0105241_10025795 3300009174 Bacteria 4369
62 Ga0105248_10828238 3300009177 Bacteria 1044
63 Ga0105237_10008030 3300009545 Bacteria 11482
64 Ga0105237_10014957 3300009545 Bacteria 8089
65 Ga0105238_10005724 3300009551 Bacteria 12287
66 Ga0105239_10014384 3300010375 Bacteria 8779
67 Ga0157373_10143042 3300013100 Bacteria 1682
68 Ga0157370_10006398 3300013104 Bacteria 12990
69 Ga0157370_10020300 3300013104 Bacteria 6636
70 Ga0157369_10357325 3300013105 Bacteria 1517
71 Ga0157374_10503636 3300013296 Bacteria 1216
72 Ga0157378_10033076 3300013297 Bacteria 4570
73 Ga0163162_10680648 3300013306 Bacteria 1151
74 Ga0163162_11114346 3300013306 Bacteria 894
75 Ga0157372_10028084 3300013307 Bacteria 6137
76 Ga0163163_10343841 3300014325 Bacteria 1547
77 Ga0182008_10291762 3300014497 Bacteria 851
78 Ga0157379_10001860 3300014968 Bacteria 17473
79 Ga0157379_10018635 3300014968 Bacteria 6120
80 Ga0157379_10052091 3300014968 Bacteria 3655
81 Ga0182007_10002724 3300015262 Bacteria 8647
82 Ga0182005_1031683 3300015265 Bacteria 1440
83 Ga0209435_100009 3300025206 Bacteria 476614
84 Ga0209437_100057 3300025233 Bacteria 362922
85 Ga0209646_1000018 3300025246 Bacteria 476716
86 Ga0209646_1025538 3300025246 Bacteria 824
87 Ga0209026_1000068 3300025250 Bacteria 207601
88 Ga0209677_100629 3300025253 Bacteria 18933
89 Ga0209148_1023078 3300025254 Bacteria 993
90 Ga0209759_1000007 3300025256 Bacteria 476614
91 Ga0209759_1026980 3300025256 Bacteria 1194
92 Ga0209233_1000134 3300025261 Bacteria 202535
93 Ga0209233_1000353 3300025261 Bacteria 42997
94 Ga0209455_1016472 3300025272 Bacteria 1587
95 Ga0209025_1000581 3300025294 Bacteria 66321
96 Ga0209025_1060852 3300025294 Bacteria 1414
97 Ga0207699_10000124 3300025906 Bacteria 54948
98 Ga0207699_10176715 3300025906 Bacteria 1432
99 Ga0207699_10211652 3300025906 Bacteria 1319
100 Ga0207654_10022969 3300025911 Bacteria 3335
101 Ga0207654_10029205 3300025911 Bacteria 3015
102 Ga0207671_10000364 3300025914 Bacteria 64550
103 Ga0207671_10005935 3300025914 Bacteria 11071
104 Ga0207693_10006235 3300025915 Bacteria 9892
105 Ga0207693_10101597 3300025915 Bacteria 2255
106 Ga0207663_10003545 3300025916 Bacteria 7653
107 Ga0207663_10016101 3300025916 Bacteria 4138
108 Ga0207694_10030459 3300025924 Bacteria 4121
109 Ga0207700_10000026 3300025928 Bacteria 139690
110 Ga0207664_10116458 3300025929 Bacteria 2230
111 Ga0207664_10123941 3300025929 Bacteria 2167
112 Ga0207709_10050313 3300025935 Bacteria 2548
113 Ga0207661_10687316 3300025944 Bacteria 941
114 Ga0207667_10041930 3300025949 Bacteria 4867
115 Ga0207640_10123355 3300025981 Bacteria 1860
116 Ga0207640_10254003 3300025981 Bacteria 1366
117 Ga0207658_10086500 3300025986 Bacteria 2418
118 Ga0207703_10030660 3300026035 Bacteria 4251
119 Ga0207678_10663389 3300026067 Bacteria 917
120 Ga0207702_10000021 3300026078 Bacteria 196115
121 Ga0207702_10417400 3300026078 Bacteria 1297
122 Ga0207676_10722180 3300026095 Bacteria 967
123 Ga0207674_10000898 3300026116 Bacteria 38900
124 Ga0209371_1000996 3300027312 Bacteria 21749
125 Ga0209371_1001537 3300027312 Bacteria 15275
126 Ga0209282_1003524 3300027666 Bacteria 9310
127 Ga0209282_1030549 3300027666 Bacteria 3314
128 Ga0265318_10000115 3300028577 Bacteria 74110
129 Ga0265338_10019251 3300028800 Bacteria 7260
130 Ga0265338_10093376 3300028800 Bacteria 2479
131 Ga0265338_10440474 3300028800 Bacteria 924
132 Ga0268256_1000728 3300030500 Bacteria 24256
133 Ga0268256_1001520 3300030500 Bacteria 13708
134 Ga0265328_10000085 3300031239 Bacteria 48380
135 Ga0265320_10000477 3300031240 Bacteria 31277
136 Ga0265325_10000067 3300031241 Bacteria 72846
137 Ga0265340_10034608 3300031247 Bacteria 2511
138 Ga0265339_10002397 3300031249 Bacteria 13434
139 Ga0265339_10030163 3300031249 Bacteria 3072
140 Ga0265331_10056729 3300031250 Bacteria 1859
141 Ga0265316_10008995 3300031344 Bacteria 9211
142 Ga0265316_10152654 3300031344 Bacteria 1730
143 Ga0307513_10055409 3300031456 Bacteria 4243
144 Ga0307408_100893362 3300031548 Bacteria 813
145 Ga0265313_10002160 3300031595 Bacteria 17462
146 Ga0265314_10011835 3300031711 Bacteria 7167
147 Ga0265314_10074190 3300031711 Bacteria 2266
148 Ga0265314_10296199 3300031711 Bacteria 909
149 Ga0265342_10082003 3300031712 Bacteria 1862
150 Ga0265342_10124080 3300031712 Bacteria 1452
151 Ga0307516_10185565 3300031730 Bacteria 1810
152 Ga0307405_11043531 3300031731 Bacteria 700
153 Ga0307410_10495974 3300031852 Bacteria 1004
154 Ga0307409_100571853 3300031995 Bacteria 1113
155 Ga0307409_100928455 3300031995 Bacteria 885
156 Ga0373926_0132188 3300035083 Bacteria 945
157 Ga0373944_0037474 3300035089 Bacteria 1485
158 Ga0373932_0063067 3300035112 Bacteria 1131
159 Ga0373943_0019854 3300035170 Bacteria 3094
160 Ga0373946_0140116 3300035171 Bacteria 1120
161 Ga0373955_0008291 3300035172 Bacteria 4820
162 Ga0373935_0006310 3300035692 Bacteria 7065
163 Ga0373935_0074770 3300035692 Bacteria 2191
164 Ga0373927_0331310 3300035695 Bacteria 1003
165 Ga0373933_0050112 3300035724 Bacteria 2491
166 Ga0373933_0203032 3300035724 Bacteria 1269
167 Ga0373947_0003799 3300035725 Bacteria 8905
168 Ga0373947_0127568 3300035725 Bacteria 1622
169 Ga0373947_0429397 3300035725 Bacteria 893
170 Ga0373937_0000477 3300036401 Bacteria 36794
171 Ga0373937_0539866 3300036401 Bacteria 1108
172 Ga0373937_1019240 3300036401 Bacteria 776
173 Ga0373925_0001546 3300037068 Bacteria 19580
174 Ga0373925_0079589 3300037068 Bacteria 2490
175 Ga0373925_0302634 3300037068 Bacteria 1291
176 Ga0395899_0000107 3300037312 Bacteria 144087
177 Ga0395900_0000101 3300037418 Bacteria 153550
178 Ga0395900_0292634 3300037418 Bacteria 1617
179 Ga0395898_0000043 3300037466 Bacteria 301783
180 Ga0395905_0000101 3300037471 Bacteria 144115
181 Ga0395901_0000068 3300038443 Bacteria 144095
182 Ga0395901_0138022 3300038443 Bacteria 2563
183 Ga0436365_0186666 3300039437 Bacteria 1085
184 Ga0436365_0772433 3300039437 Bacteria 2583
185 Ga0436365_1070125 3300039437 Bacteria 29375
186 Ga0466963_0074512 3300044694 Bacteria 2289
187 Ga0466971_0307571 3300044719 Bacteria 762
188 Ga0466970_0008038 3300044765 Bacteria 5295
189 Ga0466959_0394320 3300045049 Bacteria 941
190 Ga0466958_0030801 3300045836 Bacteria 3188
191 Ga0495629_0174860 3300046459 Bacteria 1489
192 Ga0495580_0033396 3300046472 Bacteria 3708
193 Ga0495580_0066436 3300046472 Bacteria 2524
194 Ga0495664_0595254 3300046477 Bacteria 657
195 Ga0495625_0031485 3300046660 Bacteria 3945
196 Ga0495588_0001014 3300046674 Bacteria 12199
197 Ga0495623_0145289 3300046679 Bacteria 1407
198 Ga0495658_0007243 3300046683 Bacteria 5482
199 Ga0495613_0337493 3300046689 Bacteria 1037
200 Ga0495581_0467119 3300047315 Bacteria 734
201 Ga0495674_0061971 3300047319 Bacteria 3258
202 Ga0495681_0015189 3300047470 Bacteria 4367
203 Ga0495602_0098133 3300048088 Bacteria 2412
204 Ga0496100_0061578 3300048903 Bacteria 2473
205 Ga0496103_0294871 3300048906 Bacteria 1043
206 Ga0496110_0673196 3300048913 Bacteria 935
207 Ga0496116_0021780 3300048919 Bacteria 4824
208 Ga0496117_0047305 3300048920 Bacteria 3086
209 Ga0496118_0019261 3300048921 Bacteria 6108
210 Ga0496119_0017910 3300048922 Bacteria 5304
211 Ga0496119_0040907 3300048922 Bacteria 2958
212 Ga0496120_0038778 3300048923 Bacteria 2816
213 Ga0496121_0006814 3300048924 Bacteria 13991
214 Ga0496121_0407047 3300048924 Bacteria 889
215 Ga0496123_0013339 3300048926 Bacteria 6911
216 Ga0496124_0013703 3300048927 Bacteria 7896
217 Ga0496124_0084160 3300048927 Bacteria 2609
218 Ga0496125_0046864 3300048928 Bacteria 3622
219 Ga0496125_0160779 3300048928 Bacteria 1526
220 Ga0501038_0044495 3300049574 Bacteria 3856
221 Ga0501047_0690305 3300049581 Bacteria 839
222 Ga0501067_0338306 3300049583 Bacteria 839
223 Ga0501070_0100289 3300049586 Bacteria 2395
224 Ga0501074_0653548 3300049590 Bacteria 743
225 Ga0501080_1130697 3300049742 Bacteria 675
226 Ga0501081_0625083 3300049743 Bacteria 807
227 Ga0501280_003445 3300049776 Bacteria 2433
228 nmdc:mga00v17_202747_c1 3300050491 Bacteria 1282
229 nmdc:mga0yw44_353544_c1 3300050492 Bacteria 989
230 nmdc:mga06z11_20784_c1 3300050494 Bacteria 3040
231 nmdc:mga04h51_3830_c1 3300050495 Bacteria 3693
232 nmdc:mga0qj67_266178_c1 3300050509 Bacteria 1390
233 nmdc:mga0n895_21759_c1 3300050512 Bacteria 6002
234 nmdc:mga0n895_92286_c1 3300050512 Bacteria 3031
235 nmdc:mga0rr50_14023_c1 3300050513 Bacteria 5240
236 nmdc:mga08x19_54_c1 3300050514 Bacteria 121662
237 nmdc:mga0sz30_35204_c1 3300050516 Bacteria 2088
238 nmdc:mga0sz30_52420_c2 3300050516 Bacteria 1068
239 Ga0500643_043218 3300053087 Bacteria 1315
240 Ga0500651_0112391 3300053093 Bacteria 1661
241 Ga0500560_000603 3300053107 Bacteria 5231
242 Ga0500616_0099629 3300053153 Bacteria 1423
243 Ga0500624_012080 3300053157 Bacteria 1271
244 Ga0501084_0000366 3300054114 Bacteria 34534
245 3002141200 3002141150 Bacteria 5254435
246 2510843507 2510461069 Bacteria 5505000
247 2511392244 2511231027 Bacteria 5013807
248 2537874183 2537561587 Bacteria 5425293
249 2554245310 2554235003 Bacteria 5877155
250 2559296860 2558860242 Bacteria 5568029
251 2586002206 2585427634 Bacteria 6455027
252 2599604550 2599185210 Bacteria 5624189
253 2601610259 2600255279 Bacteria 5605316
254 2601747411 2600255308 Bacteria 5611129
255 2616557762 2615840698 Bacteria 7319877
256 2643813592 2643221558 Bacteria 5460675
257 2643917053 2643221582 Bacteria 5804683
258 2644300049 2643221653 Bacteria 4569637
259 2644520989 2643221693 Bacteria 5513853
260 2644658275 2643221719 Bacteria 4568197
261 2765467925 2765235802 Bacteria 5618596
262 2770198576 2767802442 Bacteria 5747986
263 2776270106 2775506902 Bacteria 6208009
264 2776281231 2775506904 Bacteria 5954060
265 2808987318 2808606387 Bacteria 5697198
266 2819243618 2818991272 Bacteria 4622173
267 2838030762 2838029111 Bacteria 6603031
268 2838678149 2838675328 Bacteria 4909118
269 2838716944 2838714209 Bacteria 5525906
270 2838722445 2838719591 Bacteria 5523910
271 2838727694 2838724970 Bacteria 4908691
272 2839997888 2839993093 Bacteria 5512535
273 2840765525 2840764183 Bacteria 6358399
274 2841849350 2841846520 Bacteria 5345850
275 2842127901 2842124991 Bacteria 5346824
276 2842133042 2842130223 Bacteria 4909145
277 2842155036 2842152218 Bacteria 4908957
278 2842173535 2842170452 Bacteria 5525737
279 2842178657 2842175837 Bacteria 4908771
280 2842190052 2842187318 Bacteria 5524014
281 2842214366 2842211629 Bacteria 5523832
282 2842227085 2842224351 Bacteria 5524473
283 2842477494 2842475841 Bacteria 6603183
284 2842504633 2842502639 Bacteria 6604161
285 2842511886 2842509118 Bacteria 6850950
286 2842875877 2842871566 Bacteria 4827117
287 2876396149 2876392853 Bacteria 6660880
288 2899792719 2899792073 Bacteria 4926588
289 2899845603 2899845264 Bacteria 5672268
290 2902336626 2902330777 Bacteria 6395352
291 2904662925 2904659560 Bacteria 6685615
292 2919117201 2919114240 Bacteria 5700270
293 2926758649 2926754445 Bacteria 5964435
294 2926763817 2926760298 Bacteria 5505990
295 2928526638 2928521798 Bacteria 4960112
296 2933009584 2933006813 Bacteria 4912075
297 2933595563 2933594066 Bacteria 5594265
298 2954013372 2954011201 Bacteria 4762601
299 2961117951 2961114664 Bacteria 6680456
300 2968114012 2968110612 Bacteria 6814636
301 2979091141 2979089926 Bacteria 5670289
302 2979096667 2979095461 Bacteria 5669583
303 2989779891 2989776772 Bacteria 4843317
304 2996341280 2996336353 Bacteria 5511628
305 3003930852 3003930520 Bacteria 5667563
306 650843283 650716007 Bacteria 5573770
307 8003572860 8003570095 Bacteria 5747666
308 8005660642 8005658619 Bacteria 4500593
309 8005687633 8005682033 Bacteria 6726518
310 8018154552 8018150411 Bacteria 5549903
311 8055435751 8055431914 Bacteria 4551896
312 JGI24740J21852_10000006
313 JGI25155J39150_1000010
314 JGI25156J39149_1000033
315 JGI25156J39149_1000186
316 JGI25162J39368_1000413
317 JGI25154J39366_1000058
318 JGI25154J39366_1000187
319 JGI25157J39369_1000009
320 JGI25151J46595_10011077
321 JGI25165J46597_1000675
322 rootL2_10034535
323 Ga0055539_1005928
324 Ga0058692_1003402
325 Ga0058692_1003685
326 Ga0070683_100454455
327 Ga0070691_10000521
328 Ga0070709_10001436
329 Ga0070709_10304499
330 Ga0070714_100148562
331 Ga0070714_100487092
332 Ga0070713_100000199
333 Ga0070711_100025595
334 Ga0070711_100046190
335 Ga0070711_101322009
336 Ga0070705_100112226
337 Ga0070663_100047823
338 Ga0070707_100269915
339 Ga0070707_100564782
340 Ga0070697_100331637
341 Ga0068853_100019990
342 Ga0070695_100010283
343 Ga0070693_100083144
344 Ga0070693_100203620
345 Ga0070665_100624043
346 Ga0068857_100002551
347 Ga0068854_100249107
348 Ga0068854_100280608
349 Ga0068856_100004606
350 Ga0068856_100010174
351 Ga0068856_100491763
352 Ga0068852_100030992
353 Ga0068858_100048518
354 Ga0081540_1001433
355 Ga0075365_10136635
356 Ga0075368_10008184
357 Ga0075368_10158851
358 Ga0070712_100013632
359 Ga0070712_100155236
360 Ga0075367_10030893
361 Ga0075369_10058771
362 Ga0075430_100260944
363 Ga0075434_100065293
364 Ga0075434_100150428
365 Ga0075436_100006588
366 Ga0099826_10004861
367 Ga0099826_10016860
368 Ga0105240_10000013
369 Ga0105240_10054675
370 Ga0105243_10252111
371 Ga0105241_10020835
372 Ga0105241_10025795
373 Ga0105248_10828238
374 Ga0105237_10008030
375 Ga0105237_10014957
376 Ga0105238_10005724
377 Ga0105239_10014384
378 Ga0157373_10143042
379 Ga0157370_10006398
380 Ga0157370_10020300
381 Ga0157369_10357325
382 Ga0157374_10503636
383 Ga0157378_10033076
384 Ga0163162_10680648
385 Ga0163162_11114346
386 Ga0157372_10028084
387 Ga0163163_10343841
388 Ga0182008_10291762
389 Ga0157379_10001860
390 Ga0157379_10018635
391 Ga0157379_10052091
392 Ga0182007_10002724
393 Ga0182005_1031683
394 Ga0209435_100009
395 Ga0209437_100057
396 Ga0209646_1000018
397 Ga0209646_1025538
398 Ga0209026_1000068
399 Ga0209677_100629
400 Ga0209148_1023078
401 Ga0209759_1000007
402 Ga0209759_1026980
403 Ga0209233_1000134
404 Ga0209233_1000353
405 Ga0209455_1016472
406 Ga0209025_1000581
407 Ga0209025_1060852
408 Ga0207699_10000124
409 Ga0207699_10176715
410 Ga0207699_10211652
411 Ga0207654_10022969
412 Ga0207654_10029205
413 Ga0207671_10000364
414 Ga0207671_10005935
415 Ga0207693_10006235
416 Ga0207693_10101597
417 Ga0207663_10003545
418 Ga0207663_10016101
419 Ga0207694_10030459
420 Ga0207700_10000026
421 Ga0207664_10116458
422 Ga0207664_10123941
423 Ga0207709_10050313
424 Ga0207661_10687316
425 Ga0207667_10041930
426 Ga0207640_10123355
427 Ga0207640_10254003
428 Ga0207658_10086500
429 Ga0207703_10030660
430 Ga0207678_10663389
431 Ga0207702_10000021
432 Ga0207702_10417400
433 Ga0207676_10722180
434 Ga0207674_10000898
435 Ga0209371_1000996
436 Ga0209371_1001537
437 Ga0209282_1003524
438 Ga0209282_1030549
439 Ga0265318_10000115
440 Ga0265338_10019251
441 Ga0265338_10093376
442 Ga0265338_10440474
443 Ga0268256_1000728
444 Ga0268256_1001520
445 Ga0265328_10000085
446 Ga0265320_10000477
447 Ga0265325_10000067
448 Ga0265340_10034608
449 Ga0265339_10002397
450 Ga0265339_10030163
451 Ga0265331_10056729
452 Ga0265316_10008995
453 Ga0265316_10152654
454 Ga0307513_10055409
455 Ga0307408_100893362
456 Ga0265313_10002160
457 Ga0265314_10011835
458 Ga0265314_10074190
459 Ga0265314_10296199
460 Ga0265342_10082003
461 Ga0265342_10124080
462 Ga0307516_10185565
463 Ga0307405_11043531
464 Ga0307410_10495974
465 Ga0307409_100571853
466 Ga0307409_100928455
467 Ga0373926_0132188
468 Ga0373944_0037474
469 Ga0373932_0063067
470 Ga0373943_0019854
471 Ga0373946_0140116
472 Ga0373955_0008291
473 Ga0373935_0006310
474 Ga0373935_0074770
475 Ga0373927_0331310
476 Ga0373933_0050112
477 Ga0373933_0203032
478 Ga0373947_0003799
479 Ga0373947_0127568
480 Ga0373947_0429397
481 Ga0373937_0000477
482 Ga0373937_0539866
483 Ga0373937_1019240
484 Ga0373925_0001546
485 Ga0373925_0079589
486 Ga0373925_0302634
487 Ga0395899_0000107
488 Ga0395900_0000101
489 Ga0395900_0292634
490 Ga0395898_0000043
491 Ga0395905_0000101
492 Ga0395901_0000068
493 Ga0395901_0138022
494 Ga0436365_0186666
495 Ga0436365_0772433
496 Ga0436365_1070125
497 Ga0466963_0074512
498 Ga0466971_0307571
499 Ga0466970_0008038
500 Ga0466959_0394320
501 Ga0466958_0030801
502 Ga0495629_0174860
503 Ga0495580_0033396
504 Ga0495580_0066436
505 Ga0495664_0595254
506 Ga0495625_0031485
507 Ga0495588_0001014
508 Ga0495623_0145289
509 Ga0495658_0007243
510 Ga0495613_0337493
511 Ga0495581_0467119
512 Ga0495674_0061971
513 Ga0495681_0015189
514 Ga0495602_0098133
515 Ga0496100_0061578
516 Ga0496103_0294871
517 Ga0496110_0673196
518 Ga0496116_0021780
519 Ga0496117_0047305
520 Ga0496118_0019261
521 Ga0496119_0017910
522 Ga0496119_0040907
523 Ga0496120_0038778
524 Ga0496121_0006814
525 Ga0496121_0407047
526 Ga0496123_0013339
527 Ga0496124_0013703
528 Ga0496124_0084160
529 Ga0496125_0046864
530 Ga0496125_0160779
531 Ga0501038_0044495
532 Ga0501047_0690305
533 Ga0501067_0338306
534 Ga0501070_0100289
535 Ga0501074_0653548
536 Ga0501080_1130697
537 Ga0501081_0625083
538 Ga0501280_003445
539 nmdc:mga00v17_202747_c1
540 nmdc:mga0yw44_353544_c1
541 nmdc:mga06z11_20784_c1
542 nmdc:mga04h51_3830_c1
543 nmdc:mga0qj67_266178_c1
544 nmdc:mga0n895_21759_c1
545 nmdc:mga0n895_92286_c1
546 nmdc:mga0rr50_14023_c1
547 nmdc:mga08x19_54_c1
548 nmdc:mga0sz30_35204_c1
549 nmdc:mga0sz30_52420_c2
550 Ga0500643_043218
551 Ga0500651_0112391
552 Ga0500560_000603
553 Ga0500616_0099629
554 Ga0500624_012080
555 Ga0501084_0000366
556 3002141200
557 2510843507
558 2511392244
559 2537874183
560 2554245310
561 2559296860
562 2586002206
563 2599604550
564 2601610259
565 2601747411
566 2616557762
567 2643813592
568 2643917053
569 2644300049
570 2644520989
571 2644658275
572 2765467925
573 2770198576
574 2776270106
575 2776281231
576 2808987318
577 2819243618
578 2838030762
579 2838678149
580 2838716944
581 2838722445
582 2838727694
583 2839997888
584 2840765525
585 2841849350
586 2842127901
587 2842133042
588 2842155036
589 2842173535
590 2842178657
591 2842190052
592 2842214366
593 2842227085
594 2842477494
595 2842504633
596 2842511886
597 2842875877
598 2876396149
599 2899792719
600 2899845603
601 2902336626
602 2904662925
603 2919117201
604 2926758649
605 2926763817
606 2928526638
607 2933009584
608 2933595563
609 2954013372
610 2961117951
611 2968114012
612 2979091141
613 2979096667
614 2989779891
615 2996341280
616 3003930852
617 650843283
618 8003572860
619 8005660642
620 8005687633
621 8018154552
622 8055435751

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01923

Cob_adeno_trans

Cobalamin adenosyltransferase

16

186

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gah-assembly1.cif.gz_A structure of a f112h variant pduo-type atp:corrinoid adenosyltransferase from lactobacillus reuteri complexed with cobalamin and atp 0.7965 6 165
2r6x-assembly1.cif.gz_A structure of a d35n variant pduo-type atp:co(i)rrinoid adenosyltransferase from lactobacillus reuteri complexed with atp 0.7959 6 165
3ci1-assembly1.cif.gz_A structure of the pduo-type atp:co(i)rrinoid adenosyltransferase from lactobacillus reuteri complexed with four-coordinate cob(ii)alamin and atp 0.7952 6 165
3gai-assembly1.cif.gz_A structure of a f112a variant pduo-type atp:corrinoid adenosyltransferase from lactobacillus reuteri complexed with cobalamin and atp 0.7949 6 165
6wgs-assembly1.cif.gz_A mycobacterium tuberculosis pduo-type atp:cobalamin adenosyltransferase bound to adenosylcobalamin 0.7831 12 174
ID Description Score Start End Superfamily
af_A4I133_189_375_1.20.1200.10 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.7891 22 163 1.20.1200.10
2idxB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.7823 17 164 1.20.1200.10
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.7812 16 171 1.20.1200.10
af_Q18218_22_209_1.20.1200.10 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.7777 17 165 1.20.1200.10
af_Q54W51_39_259_1.20.1200.10 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.7766 17 162 1.20.1200.10
ID Description Score Start End GO Terms
AF-A0A2N3DWJ5-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.889 1 79 GO:0005524
GO:0008817
GO:0009236
AF-A0A2N3DWJ5-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.8801 1 79 GO:0005524
GO:0008817
GO:0009236
AF-A0A3B9RGR1-F1-model_v4 deleted 0.88 1 80
AF-A0A7S1NF66-F1-model_v4 Cobalamin adenosyltransferase-like domain-containing protein 0.8676 4 83 GO:0005524
GO:0008817
AF-A0A7G1I9X7-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.8606 1 79 GO:0005524
GO:0008817
GO:0009236

Map