F401522

General Info

Members Datasets Scaffolds Average Seq Length
312 179 624 266

Family's Representative Sequence

Representative Sequence 3300004803|Ga0058862_10112396|Ga0058862_101123961
Length 305
Sequence VTLGETGTNGRTAGEQGAHRPLGPAPDTNMTPDTNTKMADTATDNVLELRHVSKSFGGVHALHDVSLQLGAGEVLGLVGDNGAGKSTLIKIITGYHPPDSGEVLFHGTRVDNLTVRQARALGVETVYQERALADQQSLWRNIFMGRPITRPGGMLDVGKMRRITAELMQESMGFTSAILTPDTPVTGLSGGERQGLAIVRALHFEANIIILDEPTMGLSLSETEKCLNFVRDIRAKGKSAIFIDHNIFHVYSIADRIVMIDRGRVAGEFPTSRYTLDEVTAIMREVAATGHFTEPDRPARSGGIA

Samples

Sample ID Description Type Environment
1 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
55 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
86 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
97 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
100 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
101 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
102 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
103 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
104 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
105 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
121 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 2.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0
Rhizoplane 9.94
Rhizosphere 87.18
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058862_10112396 3300004803 Bacteria 1527
2 JGI25165J46597_1004509 3300003214 Bacteria 2960
3 rootH1_10083039 3300003323 Bacteria 5942
4 Ga0070690_100089568 3300005330 Bacteria 2024
5 Ga0068869_100188485 3300005334 Bacteria 1621
6 Ga0070680_100011733 3300005336 Bacteria 6793
7 Ga0068868_100086083 3300005338 Bacteria 2526
8 Ga0070660_100002752 3300005339 Bacteria 12084
9 Ga0070673_100071181 3300005364 Bacteria 2793
10 Ga0070667_100357737 3300005367 Bacteria 1323
11 Ga0070713_100037338 3300005436 Bacteria 3927
12 Ga0070711_100348237 3300005439 Bacteria 1191
13 Ga0070705_100138138 3300005440 Bacteria 1600
14 Ga0070700_100083592 3300005441 Bacteria 2067
15 Ga0070663_100064858 3300005455 Bacteria 2641
16 Ga0070663_100246318 3300005455 Bacteria 1413
17 Ga0070678_100028407 3300005456 Bacteria 3814
18 Ga0070681_10062996 3300005458 Bacteria 3681
19 Ga0068867_100163863 3300005459 Bacteria 1755
20 Ga0068867_100248302 3300005459 Bacteria 1446
21 Ga0070698_100015424 3300005471 Bacteria 8072
22 Ga0070698_100517946 3300005471 Bacteria 1131
23 Ga0070699_100093510 3300005518 Bacteria 2631
24 Ga0070679_100008114 3300005530 Bacteria 9862
25 Ga0070684_100000699 3300005535 Bacteria 23127
26 Ga0070684_100111759 3300005535 Bacteria 2450
27 Ga0068853_100031201 3300005539 Bacteria 4507
28 Ga0068853_100201193 3300005539 Bacteria 1813
29 Ga0070686_100146608 3300005544 Bacteria 1648
30 Ga0070693_100027100 3300005547 Bacteria 3101
31 Ga0070665_100185194 3300005548 Bacteria 2083
32 Ga0068855_100035668 3300005563 Bacteria 5923
33 Ga0070664_100131336 3300005564 Bacteria 2200
34 Ga0068854_100057208 3300005578 Bacteria 2812
35 Ga0068854_100554079 3300005578 Bacteria 976
36 Ga0068856_100005974 3300005614 Bacteria 11982
37 Ga0068852_100017164 3300005616 Bacteria 5672
38 Ga0068864_100102008 3300005618 Bacteria 2546
39 Ga0081455_10002601 3300005937 Bacteria 21408
40 Ga0081539_10017442 3300005985 Bacteria 5042
41 Ga0097621_100114135 3300006237 Bacteria 2285
42 Ga0068871_100130913 3300006358 Bacteria 2127
43 Ga0105240_10057722 3300009093 Bacteria 4847
44 Ga0105240_10305524 3300009093 Bacteria 1818
45 Ga0105245_10003557 3300009098 Bacteria 13902
46 Ga0105248_10228552 3300009177 Bacteria 2094
47 Ga0105248_10287490 3300009177 Bacteria 1851
48 Ga0105248_10580993 3300009177 Bacteria 1264
49 Ga0105238_10072308 3300009551 Bacteria 3445
50 Ga0105246_10188721 3300011119 Bacteria 1594
51 Ga0105246_10193501 3300011119 Bacteria 1576
52 Ga0105246_10446938 3300011119 Bacteria 1085
53 Ga0157373_10311188 3300013100 Bacteria 1119
54 Ga0157371_10004839 3300013102 Bacteria 11582
55 Ga0157371_10176743 3300013102 Bacteria 1526
56 Ga0157370_10034677 3300013104 Bacteria 4910
57 Ga0157370_10087543 3300013104 Bacteria 2926
58 Ga0157369_10200129 3300013105 Bacteria 2097
59 Ga0157369_10392053 3300013105 Bacteria 1441
60 Ga0157374_10007589 3300013296 Bacteria 9255
61 Ga0157374_10057726 3300013296 Bacteria 3626
62 Ga0157374_10240858 3300013296 Bacteria 1779
63 Ga0157378_10290919 3300013297 Bacteria 1578
64 Ga0163162_10443287 3300013306 Bacteria 1431
65 Ga0157375_10048244 3300013308 Bacteria 4164
66 Ga0163163_10193487 3300014325 Bacteria 2082
67 Ga0163163_10314038 3300014325 Bacteria 1620
68 Ga0157379_10035715 3300014968 Bacteria 4432
69 Ga0157379_10098488 3300014968 Bacteria 2625
70 Ga0157376_10016683 3300014969 Bacteria 5583
71 Ga0157376_10151906 3300014969 Bacteria 2089
72 Ga0163161_10293487 3300017792 Bacteria 1278
73 Ga0213873_10054344 3300021358 Bacteria 1069
74 Ga0207427_103274 3300025231 Bacteria 3519
75 Ga0209148_1000478 3300025254 Bacteria 42159
76 Ga0209233_1000208 3300025261 Bacteria 115633
77 Ga0209455_1001109 3300025272 Bacteria 13197
78 Ga0207705_10006182 3300025909 Bacteria 8907
79 Ga0207707_10027014 3300025912 Bacteria 5017
80 Ga0207695_10087030 3300025913 Bacteria 3148
81 Ga0207663_10107773 3300025916 Bacteria 1885
82 Ga0207660_10016083 3300025917 Bacteria 4946
83 Ga0207660_10278868 3300025917 Bacteria 1326
84 Ga0207657_10002273 3300025919 Bacteria 20836
85 Ga0207652_10015767 3300025921 Bacteria 6156
86 Ga0207652_10185410 3300025921 Bacteria 1871
87 Ga0207694_10140662 3300025924 Bacteria 1941
88 Ga0207687_10006722 3300025927 Bacteria 7586
89 Ga0207687_10107150 3300025927 Bacteria 2067
90 Ga0207687_10252147 3300025927 Bacteria 1403
91 Ga0207700_10015924 3300025928 Bacteria 4979
92 Ga0207664_10017318 3300025929 Bacteria 5280
93 Ga0207711_10058205 3300025941 Bacteria 3325
94 Ga0207711_10262828 3300025941 Bacteria 1587
95 Ga0207661_10012212 3300025944 Bacteria 6238
96 Ga0207667_10018736 3300025949 Bacteria 7753
97 Ga0207667_10149791 3300025949 Bacteria 2402
98 Ga0207667_10548474 3300025949 Bacteria 1169
99 Ga0207651_10119468 3300025960 Bacteria 1996
100 Ga0207640_10024475 3300025981 Bacteria 3643
101 Ga0207703_10160756 3300026035 Bacteria 1967
102 Ga0207678_10019070 3300026067 Bacteria 6023
103 Ga0207678_10069835 3300026067 Bacteria 3012
104 Ga0207708_10114198 3300026075 Bacteria 2099
105 Ga0207702_10012327 3300026078 Bacteria 7115
106 Ga0207702_10288611 3300026078 Bacteria 1554
107 Ga0207641_10071712 3300026088 Bacteria 2981
108 Ga0207676_10085134 3300026095 Bacteria 2579
109 Ga0207676_10090794 3300026095 Bacteria 2508
110 Ga0207674_10404981 3300026116 Bacteria 1318
111 Ga0207683_10003192 3300026121 Bacteria 14299
112 Ga0207683_10025369 3300026121 Bacteria 5113
113 Ga0268264_10133691 3300028381 Bacteria 2203
114 Ga0268264_10395164 3300028381 Bacteria 1327
115 Ga0265337_1012354 3300028556 Bacteria 2906
116 Ga0265318_10107535 3300028577 Bacteria 1025
117 Ga0265322_10004531 3300028654 Bacteria 4132
118 Ga0265338_10367427 3300028800 Bacteria 1031
119 Ga0265330_10002372 3300031235 Bacteria 10327
120 Ga0265325_10005449 3300031241 Bacteria 7852
121 Ga0265340_10013402 3300031247 Bacteria 4303
122 Ga0265340_10016635 3300031247 Bacteria 3806
123 Ga0265340_10075221 3300031247 Bacteria 1596
124 Ga0265339_10003247 3300031249 Bacteria 11394
125 Ga0265339_10027992 3300031249 Bacteria 3209
126 Ga0265339_10028029 3300031249 Bacteria 3207
127 Ga0265331_10084956 3300031250 Bacteria 1467
128 Ga0265331_10175177 3300031250 Bacteria 970
129 Ga0265327_10018110 3300031251 Bacteria 4381
130 Ga0265316_10000865 3300031344 Bacteria 33365
131 Ga0265316_10026943 3300031344 Bacteria 4770
132 Ga0265316_10094051 3300031344 Bacteria 2284
133 Ga0265313_10008573 3300031595 Bacteria 6770
134 Ga0265313_10017620 3300031595 Bacteria 4047
135 Ga0316575_10052650 3300031665 Bacteria 1621
136 Ga0316579_10014555 3300031691 Bacteria 3404
137 Ga0265342_10003452 3300031712 Bacteria 12961
138 Ga0265342_10004478 3300031712 Bacteria 10978
139 Ga0316576_10001800 3300031727 Bacteria 11871
140 Ga0316576_10012177 3300031727 Bacteria 5674
141 Ga0316576_10013274 3300031727 Bacteria 5468
142 Ga0316576_10108501 3300031727 Bacteria 2080
143 Ga0316576_10452298 3300031727 Bacteria 948
144 Ga0316578_10003013 3300031728 Bacteria 7588
145 Ga0316578_10054249 3300031728 Unclassified 2350
146 Ga0316578_10079535 3300031728 Bacteria 1949
147 Ga0316577_10000941 3300031733 Bacteria 12927
148 Ga0316577_10001640 3300031733 Bacteria 10698
149 Ga0316577_10044329 3300031733 Bacteria 2487
150 Ga0316577_10052687 3300031733 Bacteria 2271
151 Ga0316577_10068381 3300031733 Bacteria 1984
152 Ga0316577_10133150 3300031733 Bacteria 1399
153 Ga0316583_10002444 3300032133 Bacteria 6447
154 Ga0316583_10014200 3300032133 Bacteria 2873
155 Ga0316585_10000491 3300032137 Bacteria 9356
156 Ga0316580_10000559 3300032139 Bacteria 8693
157 Ga0316580_10010202 3300032139 Bacteria 2832
158 Ga0316593_10003374 3300032168 Bacteria 3955
159 Ga0316593_10017900 3300032168 Bacteria 2168
160 Ga0316592_1001501 3300033524 Bacteria 3781
161 Ga0316586_1001130 3300033527 Bacteria 2923
162 Ga0316588_1000053 3300033528 Bacteria 9391
163 Ga0316588_1003671 3300033528 Bacteria 2831
164 Ga0316596_1000050 3300033541 Bacteria 12727
165 Ga0316596_1002044 3300033541 Bacteria 4251
166 Ga0316574_0000513 3300035398 Bacteria 15771
167 Ga0316574_0010555 3300035398 Bacteria 5225
168 Ga0316574_0031058 3300035398 Bacteria 3239
169 Ga0316574_0069967 3300035398 Bacteria 2216
170 Ga0316574_0093280 3300035398 Bacteria 1922
171 Ga0316574_0103748 3300035398 Bacteria 1820
172 Ga0373937_0031703 3300036401 Bacteria 4791
173 Ga0316582_0002592 3300036647 Bacteria 8572
174 Ga0316582_0015029 3300036647 Bacteria 4412
175 Ga0316582_0120934 3300036647 Bacteria 1752
176 Ga0316582_0149388 3300036647 Bacteria 1579
177 Ga0316582_0186100 3300036647 Bacteria 1414
178 Ga0316582_0213638 3300036647 Bacteria 1318
179 Ga0316584_0002927 3300036712 Bacteria 10973
180 Ga0316584_0012701 3300036712 Bacteria 5942
181 Ga0316584_0093289 3300036712 Bacteria 2254
182 Ga0316584_0106107 3300036712 Bacteria 2102
183 Ga0316584_0171716 3300036712 Bacteria 1608
184 Ga0316584_0186339 3300036712 Bacteria 1535
185 Ga0395899_0020598 3300037312 Bacteria 4999
186 Ga0395899_0029163 3300037312 Bacteria 4150
187 Ga0395900_0064448 3300037418 Bacteria 3765
188 Ga0395900_0178650 3300037418 Bacteria 2158
189 Ga0395900_0477692 3300037418 Bacteria 1199
190 Ga0395898_0084462 3300037466 Bacteria 3060
191 Ga0395898_0114082 3300037466 Bacteria 2589
192 Ga0395898_0149155 3300037466 Bacteria 2238
193 Ga0395898_0388635 3300037466 Bacteria 1330
194 Ga0395905_0359322 3300037471 Bacteria 1349
195 Ga0316581_0004127 3300037588 Bacteria 3674
196 Ga0316581_0023836 3300037588 Bacteria 1812
197 Ga0395901_0055098 3300038443 Bacteria 4134
198 Ga0395901_0177408 3300038443 Bacteria 2234
199 Ga0395901_0535458 3300038443 Bacteria 1188
200 Ga0395901_0790349 3300038443 Bacteria 939
201 Ga0400484_04286 3300038725 Bacteria 7780
202 Ga0400487_20834 3300039110 Bacteria 3275
203 Ga0436362_0148168 3300039453 Bacteria 1486
204 Ga0453683_0016603 3300044673 Bacteria 4748
205 Ga0466966_0278117 3300044684 Bacteria 1007
206 Ga0453684_0316875 3300044712 Bacteria 1768
207 Ga0495592_0264579 3300046454 Bacteria 1131
208 Ga0495603_0052273 3300046455 Bacteria 2426
209 Ga0495629_0238550 3300046459 Bacteria 1252
210 Ga0495651_0152032 3300046462 Bacteria 1667
211 Ga0495653_0154644 3300046463 Bacteria 1599
212 Ga0495594_0078438 3300046499 Bacteria 1843
213 Ga0495645_0064229 3300046543 Bacteria 2657
214 Ga0495634_0030695 3300046642 Bacteria 3709
215 Ga0495613_0044932 3300046689 Bacteria 3267
216 Ga0495600_0259189 3300046809 Bacteria 1105
217 Ga0495680_0069083 3300047322 Bacteria 2697
218 Ga0495684_0089353 3300047471 Bacteria 2334
219 Ga0496102_0001096 3300048905 Bacteria 25032
220 Ga0496103_0003372 3300048906 Bacteria 9763
221 Ga0496104_0000526 3300048907 Bacteria 32863
222 Ga0496104_0038631 3300048907 Bacteria 4467
223 Ga0496105_0002094 3300048908 Bacteria 14434
224 Ga0496107_0047986 3300048910 Bacteria 3075
225 Ga0496107_0094285 3300048910 Bacteria 2190
226 Ga0496107_0270061 3300048910 Bacteria 1266
227 Ga0496108_0000633 3300048911 Bacteria 27456
228 Ga0496108_0113158 3300048911 Bacteria 2322
229 Ga0496108_0160671 3300048911 Bacteria 1941
230 Ga0496109_0008687 3300048912 Bacteria 8646
231 Ga0496109_0012619 3300048912 Bacteria 7296
232 Ga0496109_0136017 3300048912 Bacteria 2296
233 Ga0496109_0143705 3300048912 Bacteria 2231
234 Ga0496109_0719131 3300048912 Bacteria 936
235 Ga0496110_0000483 3300048913 Bacteria 27059
236 Ga0496110_0001244 3300048913 Bacteria 18182
237 Ga0496110_0006600 3300048913 Bacteria 9217
238 Ga0496111_0000682 3300048914 Bacteria 17861
239 Ga0496111_0003626 3300048914 Bacteria 9572
240 Ga0496111_0007637 3300048914 Bacteria 7106
241 Ga0496112_0006905 3300048915 Bacteria 10015
242 Ga0496112_0805521 3300048915 Bacteria 864
243 Ga0496113_0001374 3300048916 Bacteria 13487
244 Ga0496113_0002578 3300048916 Bacteria 10585
245 Ga0496113_0070267 3300048916 Bacteria 2661
246 Ga0496114_0015991 3300048917 Bacteria 6038
247 Ga0496114_0035203 3300048917 Bacteria 4134
248 Ga0496114_0297449 3300048917 Bacteria 1425
249 Ga0496115_0034141 3300048918 Bacteria 4020
250 Ga0501031_0011150 3300049568 Bacteria 5858
251 Ga0501031_0045681 3300049568 Bacteria 2858
252 Ga0501031_0140343 3300049568 Bacteria 1579
253 Ga0501032_0000665 3300049569 Bacteria 27915
254 Ga0501032_0062145 3300049569 Bacteria 2503
255 Ga0501032_0175775 3300049569 Bacteria 1403
256 Ga0501033_0000761 3300049570 Bacteria 29642
257 Ga0501033_0023142 3300049570 Bacteria 4685
258 Ga0501033_0074608 3300049570 Bacteria 2490
259 Ga0501034_0655486 3300049571 Bacteria 951
260 Ga0501037_0000053 3300049573 Bacteria 110672
261 Ga0501037_0024991 3300049573 Bacteria 4415
262 Ga0501037_0060892 3300049573 Bacteria 2753
263 Ga0501037_0234659 3300049573 Bacteria 1287
264 Ga0501038_0087451 3300049574 Bacteria 2617
265 Ga0501038_0098340 3300049574 Bacteria 2440
266 Ga0501039_0268548 3300049575 Bacteria 1341
267 Ga0501043_0000124 3300049579 Bacteria 70977
268 Ga0501043_0187576 3300049579 Bacteria 1609
269 Ga0501046_0021738 3300049580 Bacteria 5290
270 Ga0501047_0065582 3300049581 Bacteria 3500
271 Ga0501047_0559431 3300049581 Bacteria 967
272 Ga0501048_0136644 3300049582 Bacteria 1733
273 Ga0501067_0007214 3300049583 Bacteria 6175
274 Ga0501068_0051343 3300049584 Bacteria 2494
275 Ga0501069_0000004 3300049585 Bacteria 192353
276 Ga0501070_0000148 3300049586 Bacteria 64874
277 Ga0501070_0000480 3300049586 Bacteria 36323
278 Ga0501070_0001686 3300049586 Bacteria 19584
279 Ga0501070_0003555 3300049586 Bacteria 13484
280 Ga0501070_0058806 3300049586 Bacteria 3186
281 Ga0501070_0116430 3300049586 Bacteria 2207
282 Ga0501070_0258577 3300049586 Bacteria 1423
283 Ga0501071_0007794 3300049587 Bacteria 7061
284 Ga0501073_0028009 3300049589 Bacteria 4025
285 Ga0501073_0033375 3300049589 Bacteria 3665
286 Ga0501074_0000006 3300049590 Bacteria 112293
287 Ga0501074_0116039 3300049590 Bacteria 1915
288 Ga0501077_0007256 3300049593 Bacteria 6835
289 Ga0501080_0000509 3300049742 Bacteria 30549
290 Ga0501080_0001624 3300049742 Bacteria 19125
291 Ga0501080_0017871 3300049742 Bacteria 6563
292 Ga0501080_0096677 3300049742 Bacteria 2742
293 Ga0501080_0200873 3300049742 Bacteria 1830
294 Ga0501080_0538784 3300049742 Bacteria 1040
295 Ga0501083_0000066 3300049744 Bacteria 71496
296 Ga0501083_0000787 3300049744 Bacteria 20811
297 Ga0501035_0000011 3300049822 Bacteria 305794
298 Ga0501035_0002757 3300049822 Bacteria 17033
299 Ga0501035_0012419 3300049822 Bacteria 7872
300 Ga0501035_0032168 3300049822 Bacteria 4774
301 Ga0501035_0051044 3300049822 Bacteria 3704
302 Ga0501044_0000803 3300049823 Bacteria 37863
303 Ga0501044_0030888 3300049823 Bacteria 5642
304 Ga0501044_0083871 3300049823 Bacteria 3221
305 Ga0501044_0104314 3300049823 Bacteria 2849
306 Ga0495601_0032835 3300053077 Bacteria 3232
307 Ga0495595_0003507 3300053084 Bacteria 6227
308 Ga0495619_0007392 3300053085 Bacteria 6959
309 Ga0500577_0018369 3300053142 Bacteria 2247
310 Ga0501084_0418291 3300054114 Bacteria 1133
311 Ga0501082_0026290 3300060353 Bacteria 5015
312 Ga0501082_0593605 3300060353 Bacteria 969
313 Ga0058862_10112396
314 JGI25165J46597_1004509
315 rootH1_10083039
316 Ga0070690_100089568
317 Ga0068869_100188485
318 Ga0070680_100011733
319 Ga0068868_100086083
320 Ga0070660_100002752
321 Ga0070673_100071181
322 Ga0070667_100357737
323 Ga0070713_100037338
324 Ga0070711_100348237
325 Ga0070705_100138138
326 Ga0070700_100083592
327 Ga0070663_100064858
328 Ga0070663_100246318
329 Ga0070678_100028407
330 Ga0070681_10062996
331 Ga0068867_100163863
332 Ga0068867_100248302
333 Ga0070698_100015424
334 Ga0070698_100517946
335 Ga0070699_100093510
336 Ga0070679_100008114
337 Ga0070684_100000699
338 Ga0070684_100111759
339 Ga0068853_100031201
340 Ga0068853_100201193
341 Ga0070686_100146608
342 Ga0070693_100027100
343 Ga0070665_100185194
344 Ga0068855_100035668
345 Ga0070664_100131336
346 Ga0068854_100057208
347 Ga0068854_100554079
348 Ga0068856_100005974
349 Ga0068852_100017164
350 Ga0068864_100102008
351 Ga0081455_10002601
352 Ga0081539_10017442
353 Ga0097621_100114135
354 Ga0068871_100130913
355 Ga0105240_10057722
356 Ga0105240_10305524
357 Ga0105245_10003557
358 Ga0105248_10228552
359 Ga0105248_10287490
360 Ga0105248_10580993
361 Ga0105238_10072308
362 Ga0105246_10188721
363 Ga0105246_10193501
364 Ga0105246_10446938
365 Ga0157373_10311188
366 Ga0157371_10004839
367 Ga0157371_10176743
368 Ga0157370_10034677
369 Ga0157370_10087543
370 Ga0157369_10200129
371 Ga0157369_10392053
372 Ga0157374_10007589
373 Ga0157374_10057726
374 Ga0157374_10240858
375 Ga0157378_10290919
376 Ga0163162_10443287
377 Ga0157375_10048244
378 Ga0163163_10193487
379 Ga0163163_10314038
380 Ga0157379_10035715
381 Ga0157379_10098488
382 Ga0157376_10016683
383 Ga0157376_10151906
384 Ga0163161_10293487
385 Ga0213873_10054344
386 Ga0207427_103274
387 Ga0209148_1000478
388 Ga0209233_1000208
389 Ga0209455_1001109
390 Ga0207705_10006182
391 Ga0207707_10027014
392 Ga0207695_10087030
393 Ga0207663_10107773
394 Ga0207660_10016083
395 Ga0207660_10278868
396 Ga0207657_10002273
397 Ga0207652_10015767
398 Ga0207652_10185410
399 Ga0207694_10140662
400 Ga0207687_10006722
401 Ga0207687_10107150
402 Ga0207687_10252147
403 Ga0207700_10015924
404 Ga0207664_10017318
405 Ga0207711_10058205
406 Ga0207711_10262828
407 Ga0207661_10012212
408 Ga0207667_10018736
409 Ga0207667_10149791
410 Ga0207667_10548474
411 Ga0207651_10119468
412 Ga0207640_10024475
413 Ga0207703_10160756
414 Ga0207678_10019070
415 Ga0207678_10069835
416 Ga0207708_10114198
417 Ga0207702_10012327
418 Ga0207702_10288611
419 Ga0207641_10071712
420 Ga0207676_10085134
421 Ga0207676_10090794
422 Ga0207674_10404981
423 Ga0207683_10003192
424 Ga0207683_10025369
425 Ga0268264_10133691
426 Ga0268264_10395164
427 Ga0265337_1012354
428 Ga0265318_10107535
429 Ga0265322_10004531
430 Ga0265338_10367427
431 Ga0265330_10002372
432 Ga0265325_10005449
433 Ga0265340_10013402
434 Ga0265340_10016635
435 Ga0265340_10075221
436 Ga0265339_10003247
437 Ga0265339_10027992
438 Ga0265339_10028029
439 Ga0265331_10084956
440 Ga0265331_10175177
441 Ga0265327_10018110
442 Ga0265316_10000865
443 Ga0265316_10026943
444 Ga0265316_10094051
445 Ga0265313_10008573
446 Ga0265313_10017620
447 Ga0316575_10052650
448 Ga0316579_10014555
449 Ga0265342_10003452
450 Ga0265342_10004478
451 Ga0316576_10001800
452 Ga0316576_10012177
453 Ga0316576_10013274
454 Ga0316576_10108501
455 Ga0316576_10452298
456 Ga0316578_10003013
457 Ga0316578_10054249
458 Ga0316578_10079535
459 Ga0316577_10000941
460 Ga0316577_10001640
461 Ga0316577_10044329
462 Ga0316577_10052687
463 Ga0316577_10068381
464 Ga0316577_10133150
465 Ga0316583_10002444
466 Ga0316583_10014200
467 Ga0316585_10000491
468 Ga0316580_10000559
469 Ga0316580_10010202
470 Ga0316593_10003374
471 Ga0316593_10017900
472 Ga0316592_1001501
473 Ga0316586_1001130
474 Ga0316588_1000053
475 Ga0316588_1003671
476 Ga0316596_1000050
477 Ga0316596_1002044
478 Ga0316574_0000513
479 Ga0316574_0010555
480 Ga0316574_0031058
481 Ga0316574_0069967
482 Ga0316574_0093280
483 Ga0316574_0103748
484 Ga0373937_0031703
485 Ga0316582_0002592
486 Ga0316582_0015029
487 Ga0316582_0120934
488 Ga0316582_0149388
489 Ga0316582_0186100
490 Ga0316582_0213638
491 Ga0316584_0002927
492 Ga0316584_0012701
493 Ga0316584_0093289
494 Ga0316584_0106107
495 Ga0316584_0171716
496 Ga0316584_0186339
497 Ga0395899_0020598
498 Ga0395899_0029163
499 Ga0395900_0064448
500 Ga0395900_0178650
501 Ga0395900_0477692
502 Ga0395898_0084462
503 Ga0395898_0114082
504 Ga0395898_0149155
505 Ga0395898_0388635
506 Ga0395905_0359322
507 Ga0316581_0004127
508 Ga0316581_0023836
509 Ga0395901_0055098
510 Ga0395901_0177408
511 Ga0395901_0535458
512 Ga0395901_0790349
513 Ga0400484_04286
514 Ga0400487_20834
515 Ga0436362_0148168
516 Ga0453683_0016603
517 Ga0466966_0278117
518 Ga0453684_0316875
519 Ga0495592_0264579
520 Ga0495603_0052273
521 Ga0495629_0238550
522 Ga0495651_0152032
523 Ga0495653_0154644
524 Ga0495594_0078438
525 Ga0495645_0064229
526 Ga0495634_0030695
527 Ga0495613_0044932
528 Ga0495600_0259189
529 Ga0495680_0069083
530 Ga0495684_0089353
531 Ga0496102_0001096
532 Ga0496103_0003372
533 Ga0496104_0000526
534 Ga0496104_0038631
535 Ga0496105_0002094
536 Ga0496107_0047986
537 Ga0496107_0094285
538 Ga0496107_0270061
539 Ga0496108_0000633
540 Ga0496108_0113158
541 Ga0496108_0160671
542 Ga0496109_0008687
543 Ga0496109_0012619
544 Ga0496109_0136017
545 Ga0496109_0143705
546 Ga0496109_0719131
547 Ga0496110_0000483
548 Ga0496110_0001244
549 Ga0496110_0006600
550 Ga0496111_0000682
551 Ga0496111_0003626
552 Ga0496111_0007637
553 Ga0496112_0006905
554 Ga0496112_0805521
555 Ga0496113_0001374
556 Ga0496113_0002578
557 Ga0496113_0070267
558 Ga0496114_0015991
559 Ga0496114_0035203
560 Ga0496114_0297449
561 Ga0496115_0034141
562 Ga0501031_0011150
563 Ga0501031_0045681
564 Ga0501031_0140343
565 Ga0501032_0000665
566 Ga0501032_0062145
567 Ga0501032_0175775
568 Ga0501033_0000761
569 Ga0501033_0023142
570 Ga0501033_0074608
571 Ga0501034_0655486
572 Ga0501037_0000053
573 Ga0501037_0024991
574 Ga0501037_0060892
575 Ga0501037_0234659
576 Ga0501038_0087451
577 Ga0501038_0098340
578 Ga0501039_0268548
579 Ga0501043_0000124
580 Ga0501043_0187576
581 Ga0501046_0021738
582 Ga0501047_0065582
583 Ga0501047_0559431
584 Ga0501048_0136644
585 Ga0501067_0007214
586 Ga0501068_0051343
587 Ga0501069_0000004
588 Ga0501070_0000148
589 Ga0501070_0000480
590 Ga0501070_0001686
591 Ga0501070_0003555
592 Ga0501070_0058806
593 Ga0501070_0116430
594 Ga0501070_0258577
595 Ga0501071_0007794
596 Ga0501073_0028009
597 Ga0501073_0033375
598 Ga0501074_0000006
599 Ga0501074_0116039
600 Ga0501077_0007256
601 Ga0501080_0000509
602 Ga0501080_0001624
603 Ga0501080_0017871
604 Ga0501080_0096677
605 Ga0501080_0200873
606 Ga0501080_0538784
607 Ga0501083_0000066
608 Ga0501083_0000787
609 Ga0501035_0000011
610 Ga0501035_0002757
611 Ga0501035_0012419
612 Ga0501035_0032168
613 Ga0501035_0051044
614 Ga0501044_0000803
615 Ga0501044_0030888
616 Ga0501044_0083871
617 Ga0501044_0104314
618 Ga0495601_0032835
619 Ga0495595_0003507
620 Ga0495619_0007392
621 Ga0500577_0018369
622 Ga0501084_0418291
623 Ga0501082_0026290
624 Ga0501082_0593605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

62

216

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.8896 16 241
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.8754 16 241
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8718 16 241
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8676 14 241
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.8644 14 239
ID Description Score Start End Superfamily
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9197 14 249 3.40.50.300
af_P77509_259_498_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9117 12 249 3.40.50.300
af_P0AAF3_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9117 12 249 3.40.50.300
af_P32721_2_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9036 14 249 3.40.50.300
af_P04983_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9028 14 253 3.40.50.300
ID Description Score Start End GO Terms
AF-X1PX01-F1-model_v4 ABC transporter domain-containing protein 0.9601 84 261 GO:0005524
GO:0016887
AF-A0A419Z768-F1-model_v4 deleted 0.9352 12 251
AF-A0A1M5D1A9-F1-model_v4 Ribose transport system ATP-binding protein 0.9342 15 249 GO:0005524
GO:0016887
AF-A0A0Q6FHG5-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9306 15 248 GO:0005524
GO:0016887
AF-C7REM8-F1-model_v4 ABC transporter related 0.9298 16 249 GO:0005524
GO:0016887

Map