F401648

General Info

Members Datasets Scaffolds Average Seq Length
312 202 312 143

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100416339|Ga0070712_1004163392
Length 173
Sequence MRLRSSELDLDRPIGHDPRDNAERVVPMKMDHAVTSLRPSHPQLAVSAAIFRDGKILLVRRARVPAKGFYSLPGGRVEFGETLHAALNREIGEETGLKVDIVGLAGWREVVPGERGSGHYLIMSFAARWVSGEVVLNDELDDFKWLAPDDLGDLKITGGLQEVIQSASRLLRA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
196 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
197 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
202 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.21
Nodule 0
Rhizoplane 5.45
Rhizosphere 85.9
Stem 0
Stem Tuber 0
Unclassified 5.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10323634 3300005327 Bacteria 1317
2 Ga0070658_11888645 3300005327 Bacteria 516
3 Ga0070683_100695869 3300005329 Bacteria 973
4 Ga0070680_100234149 3300005336 Bacteria 1551
5 Ga0070680_100704573 3300005336 Bacteria 869
6 Ga0070682_100865279 3300005337 Bacteria 740
7 Ga0070660_100077488 3300005339 Bacteria 2605
8 Ga0070660_100459571 3300005339 Bacteria 1057
9 Ga0070661_100327970 3300005344 Bacteria 1197
10 Ga0070669_100073703 3300005353 Bacteria 2530
11 Ga0070673_100147791 3300005364 Bacteria 1988
12 Ga0070688_100312535 3300005365 Bacteria 1139
13 Ga0070659_100118867 3300005366 Bacteria 2138
14 Ga0070709_10016164 3300005434 Bacteria 4255
15 Ga0070714_100003949 3300005435 Bacteria 11146
16 Ga0070713_100030877 3300005436 Bacteria 4261
17 Ga0070713_101055171 3300005436 Bacteria 785
18 Ga0070710_10006335 3300005437 Bacteria 5678
19 Ga0070711_100007521 3300005439 Bacteria 6633
20 Ga0070711_100055762 3300005439 Bacteria 2731
21 Ga0070663_100005889 3300005455 Bacteria 7333
22 Ga0070678_100313181 3300005456 Bacteria 1338
23 Ga0070681_10400691 3300005458 Bacteria 1283
24 Ga0070698_100102065 3300005471 Bacteria 2840
25 Ga0070684_100020644 3300005535 Bacteria 5464
26 Ga0070684_100952225 3300005535 Unclassified 805
27 Ga0070697_100070116 3300005536 Bacteria 2873
28 Ga0068853_100022057 3300005539 Bacteria 5313
29 Ga0070686_100687668 3300005544 Bacteria 815
30 Ga0068855_100088613 3300005563 Bacteria 3574
31 Ga0070664_100798845 3300005564 Bacteria 882
32 Ga0068852_100010119 3300005616 Bacteria 7023
33 Ga0068852_100425339 3300005616 Bacteria 1311
34 Ga0068851_10430168 3300005834 Bacteria 781
35 Ga0068870_10160356 3300005840 Bacteria 1333
36 Ga0081455_10021405 3300005937 Bacteria 6065
37 Ga0081540_1052265 3300005983 Bacteria 2013
38 Ga0081539_10000003 3300005985 Bacteria 594833
39 Ga0070717_10002923 3300006028 Bacteria 12133
40 Ga0070715_10053301 3300006163 Bacteria 1747
41 Ga0070716_100005225 3300006173 Bacteria 6274
42 Ga0070716_100215954 3300006173 Bacteria 1285
43 Ga0070716_100276363 3300006173 Bacteria 1157
44 Ga0070712_100408093 3300006175 Bacteria 1123
45 Ga0070712_100416339 3300006175 Bacteria 1113
46 Ga0070712_100715254 3300006175 Bacteria 855
47 Ga0075433_10188828 3300006852 Bacteria 1833
48 Ga0075434_100042719 3300006871 Bacteria 4495
49 Ga0075435_100061406 3300007076 Bacteria 3049
50 Ga0099794_10031417 3300007265 Bacteria 2485
51 Ga0099794_10064270 3300007265 Bacteria 1788
52 Ga0099794_10605104 3300007265 Bacteria 580
53 Ga0099795_10251259 3300007788 Bacteria 763
54 Ga0105240_10490577 3300009093 Bacteria 1368
55 Ga0105243_10750313 3300009148 Bacteria 957
56 Ga0105248_12144490 3300009177 Bacteria 636
57 Ga0105237_10488662 3300009545 Bacteria 1237
58 Ga0105238_10003869 3300009551 Bacteria 14870
59 Ga0099796_10030728 3300010159 Bacteria 1745
60 Ga0105239_10156400 3300010375 Bacteria 2546
61 Ga0157370_10288610 3300013104 Bacteria 1515
62 Ga0157369_10000685 3300013105 Bacteria 43830
63 Ga0157369_11331942 3300013105 Unclassified 731
64 Ga0163162_10733339 3300013306 Bacteria 1108
65 Ga0206356_11502919 3300020070 Bacteria 779
66 Ga0206353_10800240 3300020082 Bacteria 823
67 Ga0213876_10003103 3300021384 Bacteria 9610
68 Ga0209677_106932 3300025253 Bacteria 2550
69 Ga0207692_10001475 3300025898 Bacteria 8812
70 Ga0207685_10000714 3300025905 Bacteria 6022
71 Ga0207643_10380376 3300025908 Bacteria 890
72 Ga0207705_10340438 3300025909 Bacteria 1154
73 Ga0207707_10000126 3300025912 Bacteria 78954
74 Ga0207695_10087909 3300025913 Bacteria 3130
75 Ga0207671_10182723 3300025914 Bacteria 1632
76 Ga0207693_10647676 3300025915 Bacteria 821
77 Ga0207663_10002752 3300025916 Bacteria 8484
78 Ga0207660_10132540 3300025917 Bacteria 1898
79 Ga0207657_10038640 3300025919 Bacteria 4247
80 Ga0207652_10042877 3300025921 Bacteria 3852
81 Ga0207694_10089700 3300025924 Bacteria 2425
82 Ga0207700_10159407 3300025928 Bacteria 1873
83 Ga0207665_10000090 3300025939 Bacteria 58962
84 Ga0207665_10057928 3300025939 Bacteria 2618
85 Ga0207665_10311777 3300025939 Bacteria 1179
86 Ga0207661_10099587 3300025944 Bacteria 2438
87 Ga0207667_10127851 3300025949 Bacteria 2617
88 Ga0207667_10764029 3300025949 Bacteria 965
89 Ga0207640_10447151 3300025981 Bacteria 1064
90 Ga0207639_10708627 3300026041 Bacteria 934
91 Ga0207678_10007974 3300026067 Bacteria 9336
92 Ga0207674_10008743 3300026116 Bacteria 11659
93 Ga0207683_10365833 3300026121 Bacteria 1325
94 Ga0207698_10465831 3300026142 Bacteria 1223
95 Ga0209588_1029654 3300027671 Bacteria 1746
96 Ga0209588_1198799 3300027671 Bacteria 625
97 Ga0265762_1046425 3300030760 Bacteria 862
98 Ga0265330_10041373 3300031235 Bacteria 2043
99 Ga0265328_10191087 3300031239 Bacteria 776
100 Ga0265329_10114242 3300031242 Bacteria 864
101 Ga0265339_10025452 3300031249 Bacteria 3396
102 Ga0265339_10041828 3300031249 Bacteria 2541
103 Ga0265331_10008754 3300031250 Bacteria 5738
104 Ga0265316_10049353 3300031344 Bacteria 3316
105 Ga0307509_10789023 3300031507 Bacteria 615
106 Ga0265313_10150055 3300031595 Bacteria 997
107 Ga0307508_10075484 3300031616 Bacteria 2948
108 Ga0265342_10012254 3300031712 Bacteria 5814
109 Ga0307516_10094186 3300031730 Bacteria 2819
110 Ga0373934_0003635 3300035086 Bacteria 5667
111 Ga0373934_0016752 3300035086 Bacteria 2789
112 Ga0373923_0052425 3300035111 Bacteria 1714
113 Ga0373936_0038992 3300035113 Bacteria 1900
114 Ga0373945_0009634 3300035116 Bacteria 3167
115 Ga0373953_0000752 3300035117 Bacteria 8989
116 Ga0373953_0010956 3300035117 Bacteria 3169
117 Ga0373953_0471161 3300035117 Bacteria 556
118 Ga0373954_0001286 3300035118 Bacteria 10089
119 Ga0373954_0013388 3300035118 Bacteria 3655
120 Ga0373956_0013531 3300035119 Bacteria 3394
121 Ga0373956_0294673 3300035119 Bacteria 772
122 Ga0373957_0001582 3300035120 Bacteria 6212
123 Ga0373957_0006158 3300035120 Bacteria 3765
124 Ga0373943_0009282 3300035170 Bacteria 4408
125 Ga0373943_0290581 3300035170 Bacteria 926
126 Ga0373943_0961667 3300035170 Bacteria 511
127 Ga0373946_0110909 3300035171 Bacteria 1241
128 Ga0373955_0001870 3300035172 Bacteria 9062
129 Ga0373955_0020397 3300035172 Bacteria 3331
130 Ga0373955_0099629 3300035172 Bacteria 1666
131 Ga0373924_0001741 3300035410 Bacteria 7183
132 Ga0373924_0002290 3300035410 Bacteria 6430
133 Ga0373924_0044985 3300035410 Bacteria 1815
134 Ga0373924_0178376 3300035410 Bacteria 935
135 Ga0373935_0001222 3300035692 Bacteria 14189
136 Ga0373935_0030741 3300035692 Bacteria 3329
137 Ga0373935_0932024 3300035692 Bacteria 644
138 Ga0373927_0002079 3300035695 Bacteria 14787
139 Ga0373927_0007796 3300035695 Bacteria 7243
140 Ga0373927_0263579 3300035695 Bacteria 1133
141 Ga0373927_0520131 3300035695 Bacteria 786
142 Ga0373933_0005956 3300035724 Bacteria 6634
143 Ga0373933_0015541 3300035724 Bacteria 4245
144 Ga0373933_0338232 3300035724 Bacteria 977
145 Ga0373947_0012136 3300035725 Bacteria 4932
146 Ga0373947_0045420 3300035725 Bacteria 2628
147 Ga0373937_0005511 3300036401 Bacteria 10850
148 Ga0373937_0016644 3300036401 Bacteria 6533
149 Ga0373937_0027219 3300036401 Bacteria 5169
150 Ga0373937_0134115 3300036401 Bacteria 2314
151 Ga0373937_0284544 3300036401 Bacteria 1562
152 Ga0373937_0354679 3300036401 Bacteria 1390
153 Ga0373925_0007214 3300037068 Bacteria 8125
154 Ga0373925_0050797 3300037068 Bacteria 3094
155 Ga0373925_0186497 3300037068 Bacteria 1644
156 Ga0395898_1624281 3300037466 Bacteria 570
157 Ga0436365_0365623 3300039437 Bacteria 31548
158 Ga0436362_0868242 3300039453 Bacteria 9788
159 Ga0451853_0406698 3300041512 Bacteria 766
160 Ga0466963_0093338 3300044694 Bacteria 2052
161 Ga0466967_0030689 3300045976 Bacteria 4513
162 Ga0495592_0025795 3300046454 Bacteria 4461
163 Ga0495603_0003000 3300046455 Bacteria 9994
164 Ga0495629_0000316 3300046459 Bacteria 41262
165 Ga0495629_0004290 3300046459 Bacteria 10688
166 Ga0495629_0029925 3300046459 Bacteria 3860
167 Ga0495641_0003654 3300046461 Bacteria 11359
168 Ga0495651_0008870 3300046462 Bacteria 7721
169 Ga0495651_0018088 3300046462 Bacteria 5456
170 Ga0495651_0022974 3300046462 Bacteria 4849
171 Ga0495653_0011022 3300046463 Bacteria 7392
172 Ga0495653_0325217 3300046463 Bacteria 995
173 Ga0495580_0004684 3300046472 Bacteria 11472
174 Ga0495580_0108933 3300046472 Bacteria 1923
175 Ga0495582_0000038 3300046473 Bacteria 67536
176 Ga0495639_0000050 3300046475 Bacteria 52004
177 Ga0495639_0034729 3300046475 Bacteria 2256
178 Ga0495662_0001679 3300046476 Bacteria 11042
179 Ga0495664_0016683 3300046477 Bacteria 4187
180 Ga0495664_0026084 3300046477 Bacteria 3403
181 Ga0495664_0231580 3300046477 Bacteria 1118
182 Ga0495664_0264818 3300046477 Bacteria 1039
183 Ga0495594_0000658 3300046499 Bacteria 17863
184 Ga0495606_0000514 3300046507 Bacteria 62799
185 Ga0495608_0020284 3300046511 Bacteria 4569
186 Ga0495608_0037521 3300046511 Bacteria 3258
187 Ga0495618_0043477 3300046514 Bacteria 2834
188 Ga0495618_0063196 3300046514 Bacteria 2350
189 Ga0495628_0035065 3300046516 Bacteria 4034
190 Ga0495628_0037210 3300046516 Bacteria 3902
191 Ga0495630_0064778 3300046517 Bacteria 2746
192 Ga0495648_0005492 3300046524 Bacteria 10520
193 Ga0495666_0011095 3300046526 Bacteria 4495
194 Ga0495652_0029755 3300046529 Bacteria 4794
195 Ga0495665_0000732 3300046531 Bacteria 16988
196 Ga0495665_0115631 3300046531 Bacteria 1406
197 Ga0495640_0013105 3300046533 Bacteria 6310
198 Ga0495640_0063746 3300046533 Bacteria 2494
199 Ga0495586_0119265 3300046535 Bacteria 1473
200 Ga0495587_0013105 3300046536 Bacteria 5212
201 Ga0495587_0015615 3300046536 Bacteria 4737
202 Ga0495597_0237994 3300046542 Bacteria 719
203 Ga0495645_0010010 3300046543 Bacteria 6639
204 Ga0495645_0038522 3300046543 Bacteria 3486
205 Ga0495645_0372299 3300046543 Bacteria 916
206 Ga0495622_0007068 3300046557 Bacteria 5214
207 Ga0495667_0012694 3300046559 Bacteria 5711
208 Ga0495667_0034448 3300046559 Bacteria 3386
209 Ga0495667_0057282 3300046559 Bacteria 2561
210 Ga0495667_1020979 3300046559 Bacteria 504
211 Ga0495634_0000931 3300046642 Bacteria 27727
212 Ga0495634_0009394 3300046642 Bacteria 7213
213 Ga0495634_0015271 3300046642 Bacteria 5521
214 Ga0495611_0126454 3300046648 Bacteria 1192
215 Ga0495635_0000415 3300046663 Bacteria 27018
216 Ga0495635_0028085 3300046663 Bacteria 3911
217 Ga0495657_0011375 3300046675 Bacteria 6657
218 Ga0495657_0029103 3300046675 Bacteria 3877
219 Ga0495599_0006706 3300046678 Bacteria 6954
220 Ga0495599_0008211 3300046678 Bacteria 6345
221 Ga0495599_0026285 3300046678 Bacteria 3647
222 Ga0495623_0013374 3300046679 Bacteria 5321
223 Ga0495623_0023266 3300046679 Bacteria 3999
224 Ga0495623_0026803 3300046679 Bacteria 3708
225 Ga0495646_0007443 3300046680 Bacteria 6959
226 Ga0495646_0022434 3300046680 Bacteria 3983
227 Ga0495646_0080815 3300046680 Bacteria 1895
228 Ga0495647_0000195 3300046681 Bacteria 16130
229 Ga0495658_0000802 3300046683 Bacteria 16866
230 Ga0495658_0481158 3300046683 Bacteria 794
231 Ga0495613_0002073 3300046689 Bacteria 15236
232 Ga0495624_0041622 3300046690 Bacteria 2937
233 Ga0495600_0023734 3300046809 Bacteria 3945
234 Ga0495600_0030829 3300046809 Bacteria 3472
235 Ga0495600_0230540 3300046809 Bacteria 1182
236 Ga0495600_0296575 3300046809 Bacteria 1021
237 Ga0495581_0005552 3300047315 Bacteria 7306
238 Ga0495581_0175566 3300047315 Bacteria 1252
239 Ga0495581_0178318 3300047315 Bacteria 1242
240 Ga0495604_0020499 3300047317 Bacteria 5280
241 Ga0495604_0073624 3300047317 Bacteria 2577
242 Ga0495604_0399201 3300047317 Bacteria 906
243 Ga0495674_0002995 3300047319 Bacteria 16455
244 Ga0495674_0019395 3300047319 Bacteria 6311
245 Ga0495674_0024430 3300047319 Bacteria 5553
246 Ga0495672_0247753 3300047320 Bacteria 866
247 Ga0495676_0045672 3300047321 Bacteria 3563
248 Ga0495676_0131398 3300047321 Bacteria 1807
249 Ga0495680_0034146 3300047322 Bacteria 4112
250 Ga0495675_0017754 3300047444 Bacteria 4511
251 Ga0495675_0030667 3300047444 Bacteria 3430
252 Ga0495673_0166382 3300047469 Bacteria 843
253 Ga0495684_0007203 3300047471 Bacteria 8634
254 Ga0495684_0007358 3300047471 Bacteria 8533
255 Ga0495684_0557206 3300047471 Bacteria 779
256 Ga0495593_0000291 3300047673 Bacteria 27242
257 Ga0495593_0008689 3300047673 Bacteria 5903
258 Ga0495602_0054867 3300048088 Bacteria 3514
259 Ga0495602_0066387 3300048088 Bacteria 3108
260 Ga0495602_0862602 3300048088 Bacteria 604
261 Ga0496101_0150546 3300048904 Bacteria 1780
262 Ga0496102_0689236 3300048905 Bacteria 945
263 Ga0496103_0574586 3300048906 Bacteria 719
264 Ga0496104_0097937 3300048907 Bacteria 2807
265 Ga0496105_0529391 3300048908 Bacteria 922
266 Ga0496106_0429325 3300048909 Bacteria 1062
267 Ga0496108_0317428 3300048911 Bacteria 1358
268 Ga0496109_0398670 3300048912 Bacteria 1300
269 Ga0496109_0553220 3300048912 Bacteria 1085
270 Ga0496110_0160514 3300048913 Bacteria 2038
271 Ga0496110_0344514 3300048913 Bacteria 1357
272 Ga0496111_0046844 3300048914 Bacteria 3114
273 Ga0496112_0000045 3300048915 Bacteria 85873
274 Ga0496112_0260779 3300048915 Bacteria 1682
275 Ga0496112_0494029 3300048915 Bacteria 1159
276 Ga0496113_0114878 3300048916 Bacteria 2099
277 Ga0496113_0386611 3300048916 Bacteria 1123
278 Ga0496117_0111307 3300048920 Bacteria 1705
279 Ga0496118_0092173 3300048921 Bacteria 2080
280 Ga0496118_0152357 3300048921 Bacteria 1445
281 Ga0496119_0045214 3300048922 Bacteria 2763
282 Ga0496119_0053190 3300048922 Bacteria 2475
283 Ga0496121_0000225 3300048924 Bacteria 122351
284 Ga0496121_0057566 3300048924 Bacteria 3220
285 Ga0496126_0013635 3300048929 Bacteria 8250
286 Ga0496126_0024225 3300048929 Bacteria 5862
287 Ga0496126_0046829 3300048929 Bacteria 3962
288 Ga0496126_0180685 3300048929 Bacteria 1792
289 Ga0501046_0056829 3300049580 Bacteria 3070
290 Ga0501047_1167636 3300049581 Bacteria 583
291 Ga0501073_0490838 3300049589 Bacteria 849
292 Ga0501074_0070335 3300049590 Bacteria 2516
293 Ga0501080_0008826 3300049742 Bacteria 9162
294 Ga0501035_0704631 3300049822 Bacteria 814
295 nmdc:mga0n895_12280_c1 3300050512 Bacteria 7675
296 nmdc:mga0rr50_174035_c1 3300050513 Bacteria 1756
297 Ga0495601_0021416 3300053077 Bacteria 3959
298 Ga0495601_0194977 3300053077 Bacteria 1324
299 Ga0495612_0018450 3300053078 Bacteria 2794
300 Ga0495595_0000665 3300053084 Bacteria 13109
301 Ga0495619_0007310 3300053085 Bacteria 6995
302 Ga0495619_0410599 3300053085 Bacteria 934
303 Ga0495619_0826947 3300053085 Bacteria 625
304 Ga0500650_0144663 3300053098 Bacteria 1101
305 Ga0500556_0034085 3300053104 Bacteria 1750
306 Ga0500592_013151 3300053116 Bacteria 1326
307 Ga0500595_003476 3300053119 Bacteria 7330
308 Ga0500614_158410 3300053123 Bacteria 685
309 Ga0500568_0010218 3300053139 Bacteria 4408
310 Ga0500568_0032312 3300053139 Bacteria 2153
311 Ga0500604_0175833 3300053151 Bacteria 733
312 Ga0500570_185898 3300053724 Bacteria 660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025253 Ga0209677_106932 Ga0209677_1069323 138
2 3300005353 Ga0070669_100073703 Ga0070669_1000737031 139
3 3300005544 Ga0070686_100687668 Ga0070686_1006876681 139
4 3300005983 Ga0081540_1052265 Ga0081540_10522653 139
5 3300009148 Ga0105243_10750313 Ga0105243_107503131 139
6 3300013306 Ga0163162_10733339 Ga0163162_107333392 139
7 3300005937 Ga0081455_10021405 Ga0081455_100214052 140
8 3300007265 Ga0099794_10031417 Ga0099794_100314173 140
9 3300025915 Ga0207693_10647676 Ga0207693_106476762 140
10 3300027671 Ga0209588_1198799 Ga0209588_11987992 140
11 3300030760 Ga0265762_1046425 Ga0265762_10464252 140
12 3300031730 Ga0307516_10094186 Ga0307516_100941866 140
13 3300035695 Ga0373927_0263579 Ga0373927_0263579_375_797 140
14 3300036401 Ga0373937_0016644 Ga0373937_0016644_637_1059 140
15 3300046462 Ga0495651_0008870 Ga0495651_0008870_6126_6548 140
16 3300046679 Ga0495623_0023266 Ga0495623_0023266_1876_2298 140
17 3300048088 Ga0495602_0862602 Ga0495602_0862602_42_467 140
18 3300005327 Ga0070658_11888645 Ga0070658_118886451 141
19 3300005329 Ga0070683_100695869 Ga0070683_1006958692 141
20 3300005336 Ga0070680_100234149 Ga0070680_1002341493 141
21 3300005337 Ga0070682_100865279 Ga0070682_1008652791 141
22 3300005339 Ga0070660_100077488 Ga0070660_1000774882 141
23 3300005344 Ga0070661_100327970 Ga0070661_1003279702 141
24 3300005364 Ga0070673_100147791 Ga0070673_1001477913 141
25 3300005365 Ga0070688_100312535 Ga0070688_1003125352 141
26 3300005439 Ga0070711_100055762 Ga0070711_1000557623 141
27 3300005455 Ga0070663_100005889 Ga0070663_1000058897 141
28 3300005458 Ga0070681_10400691 Ga0070681_104006912 141
29 3300005471 Ga0070698_100102065 Ga0070698_1001020654 141
30 3300005535 Ga0070684_100020644 Ga0070684_1000206442 141
31 3300005535 Ga0070684_100952225 Ga0070684_1009522251 141
32 3300005536 Ga0070697_100070116 Ga0070697_1000701164 141
33 3300005539 Ga0068853_100022057 Ga0068853_1000220575 141
34 3300005563 Ga0068855_100088613 Ga0068855_1000886132 141
35 3300005564 Ga0070664_100798845 Ga0070664_1007988452 141
36 3300005616 Ga0068852_100425339 Ga0068852_1004253393 141
37 3300005834 Ga0068851_10430168 Ga0068851_104301682 141
38 3300006173 Ga0070716_100215954 Ga0070716_1002159541 141
39 3300006852 Ga0075433_10188828 Ga0075433_101888283 141
40 3300006871 Ga0075434_100042719 Ga0075434_1000427193 141
41 3300007076 Ga0075435_100061406 Ga0075435_1000614063 141
42 3300007265 Ga0099794_10605104 Ga0099794_106051041 141
43 3300007788 Ga0099795_10251259 Ga0099795_102512591 141
44 3300009093 Ga0105240_10490577 Ga0105240_104905773 141
45 3300009545 Ga0105237_10488662 Ga0105237_104886622 141
46 3300009551 Ga0105238_10003869 Ga0105238_100038692 141
47 3300010159 Ga0099796_10030728 Ga0099796_100307282 141
48 3300010375 Ga0105239_10156400 Ga0105239_101564002 141
49 3300013104 Ga0157370_10288610 Ga0157370_102886103 141
50 3300013105 Ga0157369_10000685 Ga0157369_1000068510 141
51 3300013105 Ga0157369_11331942 Ga0157369_113319421 141
52 3300020070 Ga0206356_11502919 Ga0206356_115029191 141
53 3300020082 Ga0206353_10800240 Ga0206353_108002401 141
54 3300025909 Ga0207705_10340438 Ga0207705_103404382 141
55 3300025912 Ga0207707_10000126 Ga0207707_100001264 141
56 3300025913 Ga0207695_10087909 Ga0207695_100879093 141
57 3300025914 Ga0207671_10182723 Ga0207671_101827232 141
58 3300025917 Ga0207660_10132540 Ga0207660_101325402 141
59 3300025919 Ga0207657_10038640 Ga0207657_100386404 141
60 3300025921 Ga0207652_10042877 Ga0207652_100428774 141
61 3300025924 Ga0207694_10089700 Ga0207694_100897002 141
62 3300025939 Ga0207665_10057928 Ga0207665_100579282 141
63 3300025944 Ga0207661_10099587 Ga0207661_100995874 141
64 3300025949 Ga0207667_10127851 Ga0207667_101278513 141
65 3300025981 Ga0207640_10447151 Ga0207640_104471512 141
66 3300026041 Ga0207639_10708627 Ga0207639_107086272 141
67 3300026067 Ga0207678_10007974 Ga0207678_100079749 141
68 3300026116 Ga0207674_10008743 Ga0207674_100087432 141
69 3300026142 Ga0207698_10465831 Ga0207698_104658312 141
70 3300031249 Ga0265339_10025452 Ga0265339_100254524 141
71 3300031250 Ga0265331_10008754 Ga0265331_100087541 141
72 3300031712 Ga0265342_10012254 Ga0265342_100122547 141
73 3300035086 Ga0373934_0003635 Ga0373934_0003635_2270_2695 141
74 3300035086 Ga0373934_0016752 Ga0373934_0016752_1852_2277 141
75 3300035111 Ga0373923_0052425 Ga0373923_0052425_635_1060 141
76 3300035117 Ga0373953_0000752 Ga0373953_0000752_5701_6126 141
77 3300035117 Ga0373953_0010956 Ga0373953_0010956_2175_2600 141
78 3300035117 Ga0373953_0471161 Ga0373953_0471161_24_449 141
79 3300035118 Ga0373954_0001286 Ga0373954_0001286_6339_6764 141
80 3300035118 Ga0373954_0013388 Ga0373954_0013388_743_1168 141
81 3300035119 Ga0373956_0013531 Ga0373956_0013531_2806_3231 141
82 3300035119 Ga0373956_0294673 Ga0373956_0294673_249_674 141
83 3300035120 Ga0373957_0001582 Ga0373957_0001582_1077_1502 141
84 3300035120 Ga0373957_0006158 Ga0373957_0006158_2905_3330 141
85 3300035170 Ga0373943_0290581 Ga0373943_0290581_319_744 141
86 3300035170 Ga0373943_0961667 Ga0373943_0961667_41_466 141
87 3300035172 Ga0373955_0001870 Ga0373955_0001870_4476_4901 141
88 3300035172 Ga0373955_0020397 Ga0373955_0020397_2238_2663 141
89 3300035172 Ga0373955_0099629 Ga0373955_0099629_1042_1467 141
90 3300035410 Ga0373924_0001741 Ga0373924_0001741_3910_4335 141
91 3300035410 Ga0373924_0178376 Ga0373924_0178376_112_537 141
92 3300035692 Ga0373935_0030741 Ga0373935_0030741_743_1168 141
93 3300035692 Ga0373935_0932024 Ga0373935_0932024_177_602 141
94 3300035695 Ga0373927_0007796 Ga0373927_0007796_4436_4861 141
95 3300035695 Ga0373927_0520131 Ga0373927_0520131_147_572 141
96 3300035724 Ga0373933_0005956 Ga0373933_0005956_3546_3971 141
97 3300035724 Ga0373933_0015541 Ga0373933_0015541_539_964 141
98 3300035724 Ga0373933_0338232 Ga0373933_0338232_541_966 141
99 3300035725 Ga0373947_0045420 Ga0373947_0045420_611_1036 141
100 3300036401 Ga0373937_0027219 Ga0373937_0027219_3519_3944 141
101 3300036401 Ga0373937_0134115 Ga0373937_0134115_275_700 141
102 3300036401 Ga0373937_0284544 Ga0373937_0284544_337_762 141
103 3300036401 Ga0373937_0354679 Ga0373937_0354679_801_1226 141
104 3300037068 Ga0373925_0186497 Ga0373925_0186497_1150_1575 141
105 3300037466 Ga0395898_1624281 Ga0395898_1624281_110_535 141
106 3300041512 Ga0451853_0406698 Ga0451853_0406698_249_674 141
107 3300046454 Ga0495592_0025795 Ga0495592_0025795_1078_1503 141
108 3300046459 Ga0495629_0004290 Ga0495629_0004290_5980_6405 141
109 3300046459 Ga0495629_0029925 Ga0495629_0029925_402_827 141
110 3300046462 Ga0495651_0018088 Ga0495651_0018088_2959_3384 141
111 3300046462 Ga0495651_0022974 Ga0495651_0022974_652_1077 141
112 3300046463 Ga0495653_0011022 Ga0495653_0011022_2073_2498 141
113 3300046463 Ga0495653_0325217 Ga0495653_0325217_286_711 141
114 3300046472 Ga0495580_0108933 Ga0495580_0108933_341_766 141
115 3300046475 Ga0495639_0034729 Ga0495639_0034729_892_1317 141
116 3300046477 Ga0495664_0026084 Ga0495664_0026084_308_733 141
117 3300046477 Ga0495664_0231580 Ga0495664_0231580_654_1079 141
118 3300046511 Ga0495608_0020284 Ga0495608_0020284_2262_2687 141
119 3300046511 Ga0495608_0037521 Ga0495608_0037521_1608_2033 141
120 3300046514 Ga0495618_0043477 Ga0495618_0043477_434_859 141
121 3300046516 Ga0495628_0035065 Ga0495628_0035065_1608_2033 141
122 3300046529 Ga0495652_0029755 Ga0495652_0029755_4162_4587 141
123 3300046531 Ga0495665_0115631 Ga0495665_0115631_361_786 141
124 3300046533 Ga0495640_0063746 Ga0495640_0063746_651_1076 141
125 3300046535 Ga0495586_0119265 Ga0495586_0119265_306_731 141
126 3300046536 Ga0495587_0013105 Ga0495587_0013105_4666_5091 141
127 3300046536 Ga0495587_0015615 Ga0495587_0015615_2959_3384 141
128 3300046543 Ga0495645_0010010 Ga0495645_0010010_1825_2250 141
129 3300046543 Ga0495645_0038522 Ga0495645_0038522_424_849 141
130 3300046543 Ga0495645_0372299 Ga0495645_0372299_338_763 141
131 3300046559 Ga0495667_0034448 Ga0495667_0034448_1226_1651 141
132 3300046559 Ga0495667_0057282 Ga0495667_0057282_121_546 141
133 3300046559 Ga0495667_1020979 Ga0495667_1020979_34_459 141
134 3300046642 Ga0495634_0009394 Ga0495634_0009394_3459_3884 141
135 3300046642 Ga0495634_0015271 Ga0495634_0015271_426_851 141
136 3300046663 Ga0495635_0028085 Ga0495635_0028085_1057_1482 141
137 3300046675 Ga0495657_0011375 Ga0495657_0011375_3569_3994 141
138 3300046675 Ga0495657_0029103 Ga0495657_0029103_1060_1485 141
139 3300046678 Ga0495599_0006706 Ga0495599_0006706_3111_3536 141
140 3300046678 Ga0495599_0008211 Ga0495599_0008211_3453_3878 141
141 3300046679 Ga0495623_0013374 Ga0495623_0013374_3671_4096 141
142 3300046679 Ga0495623_0026803 Ga0495623_0026803_636_1061 141
143 3300046680 Ga0495646_0007443 Ga0495646_0007443_3508_3933 141
144 3300046680 Ga0495646_0022434 Ga0495646_0022434_1530_1955 141
145 3300046683 Ga0495658_0481158 Ga0495658_0481158_63_488 141
146 3300046809 Ga0495600_0023734 Ga0495600_0023734_208_633 141
147 3300046809 Ga0495600_0030829 Ga0495600_0030829_432_857 141
148 3300046809 Ga0495600_0296575 Ga0495600_0296575_161_586 141
149 3300047315 Ga0495581_0175566 Ga0495581_0175566_418_843 141
150 3300047315 Ga0495581_0178318 Ga0495581_0178318_416_841 141
151 3300047317 Ga0495604_0020499 Ga0495604_0020499_4581_5006 141
152 3300047317 Ga0495604_0073624 Ga0495604_0073624_1945_2370 141
153 3300047319 Ga0495674_0019395 Ga0495674_0019395_5600_6025 141
154 3300047319 Ga0495674_0024430 Ga0495674_0024430_2149_2574 141
155 3300047320 Ga0495672_0247753 Ga0495672_0247753_251_676 141
156 3300047321 Ga0495676_0131398 Ga0495676_0131398_1315_1740 141
157 3300047322 Ga0495680_0034146 Ga0495680_0034146_1078_1503 141
158 3300047444 Ga0495675_0017754 Ga0495675_0017754_950_1375 141
159 3300047444 Ga0495675_0030667 Ga0495675_0030667_2263_2688 141
160 3300047469 Ga0495673_0166382 Ga0495673_0166382_10_435 141
161 3300047471 Ga0495684_0007358 Ga0495684_0007358_4326_4751 141
162 3300047471 Ga0495684_0557206 Ga0495684_0557206_233_658 141
163 3300047673 Ga0495593_0008689 Ga0495593_0008689_3326_3751 141
164 3300048088 Ga0495602_0054867 Ga0495602_0054867_1354_1779 141
165 3300048088 Ga0495602_0066387 Ga0495602_0066387_127_552 141
166 3300048906 Ga0496103_0574586 Ga0496103_0574586_273_698 141
167 3300048907 Ga0496104_0097937 Ga0496104_0097937_711_1136 141
168 3300048908 Ga0496105_0529391 Ga0496105_0529391_59_484 141
169 3300048911 Ga0496108_0317428 Ga0496108_0317428_533_958 141
170 3300048912 Ga0496109_0553220 Ga0496109_0553220_452_877 141
171 3300048913 Ga0496110_0344514 Ga0496110_0344514_477_902 141
172 3300048914 Ga0496111_0046844 Ga0496111_0046844_1081_1506 141
173 3300048915 Ga0496112_0260779 Ga0496112_0260779_899_1324 141
174 3300048916 Ga0496113_0114878 Ga0496113_0114878_1240_1665 141
175 3300048920 Ga0496117_0111307 Ga0496117_0111307_201_626 141
176 3300048921 Ga0496118_0092173 Ga0496118_0092173_1636_2061 141
177 3300048921 Ga0496118_0152357 Ga0496118_0152357_632_1057 141
178 3300048922 Ga0496119_0045214 Ga0496119_0045214_52_477 141
179 3300048922 Ga0496119_0053190 Ga0496119_0053190_291_716 141
180 3300048924 Ga0496121_0000225 Ga0496121_0000225_72696_73121 141
181 3300048924 Ga0496121_0057566 Ga0496121_0057566_829_1254 141
182 3300048929 Ga0496126_0013635 Ga0496126_0013635_4984_5409 141
183 3300048929 Ga0496126_0024225 Ga0496126_0024225_3969_4394 141
184 3300048929 Ga0496126_0046829 Ga0496126_0046829_2818_3243 141
185 3300048929 Ga0496126_0180685 Ga0496126_0180685_440_865 141
186 3300049580 Ga0501046_0056829 Ga0501046_0056829_1154_1579 141
187 3300049581 Ga0501047_1167636 Ga0501047_1167636_40_465 141
188 3300049589 Ga0501073_0490838 Ga0501073_0490838_311_736 141
189 3300049590 Ga0501074_0070335 Ga0501074_0070335_480_905 141
190 3300049742 Ga0501080_0008826 Ga0501080_0008826_6311_6736 141
191 3300049822 Ga0501035_0704631 Ga0501035_0704631_349_774 141
192 3300050512 nmdc:mga0n895_12280_c1 nmdc:mga0n895_12280_c1_5102_5527 141
193 3300050513 nmdc:mga0rr50_174035_c1 nmdc:mga0rr50_174035_c1_783_1208 141
194 3300053077 Ga0495601_0021416 Ga0495601_0021416_1377_1802 141
195 3300053078 Ga0495612_0018450 Ga0495612_0018450_2073_2498 141
196 3300053084 Ga0495595_0000665 Ga0495595_0000665_9509_9934 141
197 3300053085 Ga0495619_0007310 Ga0495619_0007310_3569_3994 141
198 3300053085 Ga0495619_0410599 Ga0495619_0410599_388_813 141
199 3300053085 Ga0495619_0826947 Ga0495619_0826947_119_544 141
200 3300053098 Ga0500650_0144663 Ga0500650_0144663_426_851 141
201 3300053104 Ga0500556_0034085 Ga0500556_0034085_550_975 141
202 3300053116 Ga0500592_013151 Ga0500592_013151_410_835 141
203 3300053119 Ga0500595_003476 Ga0500595_003476_5529_5954 141
204 3300053123 Ga0500614_158410 Ga0500614_158410_215_640 141
205 3300053139 Ga0500568_0010218 Ga0500568_0010218_2873_3298 141
206 3300053139 Ga0500568_0032312 Ga0500568_0032312_345_770 141
207 3300053151 Ga0500604_0175833 Ga0500604_0175833_85_510 141
208 3300053724 Ga0500570_185898 Ga0500570_185898_68_493 141
209 3300005434 Ga0070709_10016164 Ga0070709_100161642 142
210 3300005435 Ga0070714_100003949 Ga0070714_10000394910 142
211 3300005436 Ga0070713_100030877 Ga0070713_1000308774 142
212 3300005437 Ga0070710_10006335 Ga0070710_100063356 142
213 3300005439 Ga0070711_100007521 Ga0070711_1000075216 142
214 3300006028 Ga0070717_10002923 Ga0070717_100029236 142
215 3300006163 Ga0070715_10053301 Ga0070715_100533013 142
216 3300006173 Ga0070716_100005225 Ga0070716_1000052257 142
217 3300006175 Ga0070712_100408093 Ga0070712_1004080932 142
218 3300025898 Ga0207692_10001475 Ga0207692_100014752 142
219 3300025905 Ga0207685_10000714 Ga0207685_100007146 142
220 3300025916 Ga0207663_10002752 Ga0207663_100027525 142
221 3300025939 Ga0207665_10000090 Ga0207665_100000907 142
222 3300044694 Ga0466963_0093338 Ga0466963_0093338_1078_1506 142
223 3300045976 Ga0466967_0030689 Ga0466967_0030689_2256_2684 142
224 3300005436 Ga0070713_101055171 Ga0070713_1010551712 143
225 3300005456 Ga0070678_100313181 Ga0070678_1003131812 143
226 3300005840 Ga0068870_10160356 Ga0068870_101603561 143
227 3300005985 Ga0081539_10000003 Ga0081539_10000003488 143
228 3300006173 Ga0070716_100276363 Ga0070716_1002763632 143
229 3300006175 Ga0070712_100416339 Ga0070712_1004163392 143
230 3300006175 Ga0070712_100715254 Ga0070712_1007152542 143
231 3300007265 Ga0099794_10064270 Ga0099794_100642702 143
232 3300009177 Ga0105248_12144490 Ga0105248_121444902 143
233 3300021384 Ga0213876_10003103 Ga0213876_100031034 143
234 3300025908 Ga0207643_10380376 Ga0207643_103803762 143
235 3300025928 Ga0207700_10159407 Ga0207700_101594073 143
236 3300025939 Ga0207665_10311777 Ga0207665_103117771 143
237 3300026121 Ga0207683_10365833 Ga0207683_103658333 143
238 3300027671 Ga0209588_1029654 Ga0209588_10296543 143
239 3300031235 Ga0265330_10041373 Ga0265330_100413733 143
240 3300031239 Ga0265328_10191087 Ga0265328_101910871 143
241 3300031242 Ga0265329_10114242 Ga0265329_101142422 143
242 3300031249 Ga0265339_10041828 Ga0265339_100418283 143
243 3300031344 Ga0265316_10049353 Ga0265316_100493532 143
244 3300031507 Ga0307509_10789023 Ga0307509_107890231 143
245 3300031595 Ga0265313_10150055 Ga0265313_101500551 143
246 3300031616 Ga0307508_10075484 Ga0307508_100754843 143
247 3300035113 Ga0373936_0038992 Ga0373936_0038992_903_1334 143
248 3300035116 Ga0373945_0009634 Ga0373945_0009634_27_458 143
249 3300035170 Ga0373943_0009282 Ga0373943_0009282_299_730 143
250 3300035171 Ga0373946_0110909 Ga0373946_0110909_157_588 143
251 3300035410 Ga0373924_0002290 Ga0373924_0002290_1752_2261 143
252 3300035410 Ga0373924_0044985 Ga0373924_0044985_172_603 143
253 3300035692 Ga0373935_0001222 Ga0373935_0001222_8935_9366 143
254 3300035695 Ga0373927_0002079 Ga0373927_0002079_11130_11561 143
255 3300035725 Ga0373947_0012136 Ga0373947_0012136_3306_3737 143
256 3300036401 Ga0373937_0005511 Ga0373937_0005511_10248_10679 143
257 3300037068 Ga0373925_0007214 Ga0373925_0007214_126_557 143
258 3300037068 Ga0373925_0050797 Ga0373925_0050797_510_962 143
259 3300039437 Ga0436365_0365623 Ga0436365_0365623_21246_21689 143
260 3300039453 Ga0436362_0868242 Ga0436362_0868242_2740_3183 143
261 3300046455 Ga0495603_0003000 Ga0495603_0003000_7297_7728 143
262 3300046459 Ga0495629_0000316 Ga0495629_0000316_7436_7867 143
263 3300046461 Ga0495641_0003654 Ga0495641_0003654_2645_3076 143
264 3300046472 Ga0495580_0004684 Ga0495580_0004684_2306_2737 143
265 3300046473 Ga0495582_0000038 Ga0495582_0000038_52142_52573 143
266 3300046475 Ga0495639_0000050 Ga0495639_0000050_7031_7462 143
267 3300046476 Ga0495662_0001679 Ga0495662_0001679_7527_7958 143
268 3300046477 Ga0495664_0016683 Ga0495664_0016683_1296_1727 143
269 3300046477 Ga0495664_0264818 Ga0495664_0264818_244_675 143
270 3300046499 Ga0495594_0000658 Ga0495594_0000658_3657_4088 143
271 3300046507 Ga0495606_0000514 Ga0495606_0000514_45207_45638 143
272 3300046514 Ga0495618_0063196 Ga0495618_0063196_998_1429 143
273 3300046516 Ga0495628_0037210 Ga0495628_0037210_11_442 143
274 3300046517 Ga0495630_0064778 Ga0495630_0064778_1295_1726 143
275 3300046524 Ga0495648_0005492 Ga0495648_0005492_9505_9936 143
276 3300046526 Ga0495666_0011095 Ga0495666_0011095_1562_1993 143
277 3300046531 Ga0495665_0000732 Ga0495665_0000732_7362_7793 143
278 3300046533 Ga0495640_0013105 Ga0495640_0013105_3612_4043 143
279 3300046542 Ga0495597_0237994 Ga0495597_0237994_166_597 143
280 3300046557 Ga0495622_0007068 Ga0495622_0007068_4686_5117 143
281 3300046559 Ga0495667_0012694 Ga0495667_0012694_1019_1450 143
282 3300046642 Ga0495634_0000931 Ga0495634_0000931_5797_6228 143
283 3300046648 Ga0495611_0126454 Ga0495611_0126454_358_789 143
284 3300046663 Ga0495635_0000415 Ga0495635_0000415_5827_6258 143
285 3300046678 Ga0495599_0026285 Ga0495599_0026285_1869_2300 143
286 3300046680 Ga0495646_0080815 Ga0495646_0080815_474_905 143
287 3300046681 Ga0495647_0000195 Ga0495647_0000195_8606_9037 143
288 3300046683 Ga0495658_0000802 Ga0495658_0000802_9172_9603 143
289 3300046689 Ga0495613_0002073 Ga0495613_0002073_7444_7875 143
290 3300046690 Ga0495624_0041622 Ga0495624_0041622_2077_2508 143
291 3300046809 Ga0495600_0230540 Ga0495600_0230540_187_618 143
292 3300047315 Ga0495581_0005552 Ga0495581_0005552_3228_3659 143
293 3300047317 Ga0495604_0399201 Ga0495604_0399201_340_771 143
294 3300047319 Ga0495674_0002995 Ga0495674_0002995_12836_13267 143
295 3300047321 Ga0495676_0045672 Ga0495676_0045672_404_835 143
296 3300047471 Ga0495684_0007203 Ga0495684_0007203_1374_1805 143
297 3300047673 Ga0495593_0000291 Ga0495593_0000291_7317_7748 143
298 3300048904 Ga0496101_0150546 Ga0496101_0150546_53_574 143
299 3300048905 Ga0496102_0689236 Ga0496102_0689236_147_581 143
300 3300048909 Ga0496106_0429325 Ga0496106_0429325_344_865 143
301 3300048912 Ga0496109_0398670 Ga0496109_0398670_515_1036 143
302 3300048913 Ga0496110_0160514 Ga0496110_0160514_1437_1937 143
303 3300048915 Ga0496112_0000045 Ga0496112_0000045_11430_11861 143
304 3300048915 Ga0496112_0494029 Ga0496112_0494029_261_782 143
305 3300048916 Ga0496113_0386611 Ga0496113_0386611_66_566 143
306 3300053077 Ga0495601_0194977 Ga0495601_0194977_607_1041 143
307 3300005327 Ga0070658_10323634 Ga0070658_103236342 150
308 3300005336 Ga0070680_100704573 Ga0070680_1007045732 150
309 3300005339 Ga0070660_100459571 Ga0070660_1004595712 150
310 3300005366 Ga0070659_100118867 Ga0070659_1001188671 150
311 3300005616 Ga0068852_100010119 Ga0068852_1000101199 150
312 3300025949 Ga0207667_10764029 Ga0207667_107640292 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

41

167

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dyw-assembly1.cif.gz_A crystal structure of mutt nudix hydrolase from burkholderia pseudomallei 0.8989 10 136
1vc9-assembly2.cif.gz_B crystal structure of a t.thermophilus hb8 ap6a hydrolase e50q mutant-mg2+-atp complex 0.8974 13 139
1vcd-assembly1.cif.gz_A crystal structure of a t.thermophilus hb8 ap6a hydrolase ndx1 0.8911 13 139
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.8857 12 143
5xd2-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with ap5a, atp and manganese 0.8832 10 136
ID Description Score Start End Superfamily
4dywB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8887 10 136 3.90.79.10
1vcdB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8857 15 139 3.90.79.10
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8828 15 141 3.90.79.10
4dywB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8696 10 136 3.90.79.10
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8644 15 141 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A239DY02-F1-model_v4 ADP-ribose pyrophosphatase YjhB, NUDIX family 0.9687 5 141 GO:0016787
AF-A0A833L5I5-F1-model_v4 Nudix hydrolase domain-containing protein 0.959 9 143 GO:0016787
AF-A0A2T0PCB5-F1-model_v4 deleted 0.9561 17 140
AF-A0A0N1N437-F1-model_v4 NUDIX hydrolase 0.9552 11 145 GO:0016787
AF-A0A1Q4DKJ1-F1-model_v4 NUDIX hydrolase 0.9541 8 142 GO:0016787

Feature Viewer

pLDDT pTM Quality
88.58 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map