F401684

General Info

Members Datasets Scaffolds Average Seq Length
312 228 303 102

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11342572|Ga0114129_113425721
Length 116
Sequence MKEASMIPGEIITAKGQIELNKGRKAITLTVANTGDRPIQVGSHYHFAETNPALRFDREKARGHRLDIAAGTAVRFEPGQTREVRLIAFAGKREVYGFRQEVMGSLDAGASKKGKS

Samples

Sample ID Description Type Environment
1 2643221591 Devosia sp. Root685 Isolate Unclassified
2 2643221629 Devosia sp. Root105 Isolate Unclassified
3 2643221662 Devosia sp. Root413D1 Isolate Unclassified
4 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
5 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
6 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
7 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
8 2932401849 Devosia sp. 2618 Isolate Rhizosphere
9 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
209 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
210 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
213 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
218 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
219 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
220 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
221 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
222 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
223 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
228 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.79
Metatranscriptomes 0.32
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.65
Nodule 0
Rhizoplane 3.21
Rhizosphere 82.37
Stem 0
Stem Tuber 0
Unclassified 5.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1005761 3300001976 Bacteria 1618
2 Ga0065707_10210486 3300005295 Bacteria 1268
3 Ga0070670_100000016 3300005331 Bacteria 226440
4 Ga0070680_100052384 3300005336 Bacteria 3331
5 Ga0068868_100776186 3300005338 Bacteria 863
6 Ga0070689_101441784 3300005340 Bacteria 623
7 Ga0070692_10226860 3300005345 Bacteria 1107
8 Ga0070668_100010408 3300005347 Bacteria 6912
9 Ga0070668_100074017 3300005347 Bacteria 2657
10 Ga0070668_100875300 3300005347 Bacteria 802
11 Ga0070669_100689981 3300005353 Bacteria 861
12 Ga0070669_101960422 3300005353 Bacteria 512
13 Ga0070667_100000425 3300005367 Bacteria 44629
14 Ga0070667_100570978 3300005367 Bacteria 1041
15 Ga0070703_10028415 3300005406 Bacteria 1672
16 Ga0070713_100394247 3300005436 Bacteria 1292
17 Ga0070713_102239757 3300005436 Bacteria 529
18 Ga0070705_100000010 3300005440 Bacteria 102079
19 Ga0070705_100814814 3300005440 Bacteria 744
20 Ga0070700_100012029 3300005441 Bacteria 4811
21 Ga0070694_100007490 3300005444 Bacteria 6658
22 Ga0070708_100575627 3300005445 Bacteria 1062
23 Ga0070663_100021990 3300005455 Bacteria 4254
24 Ga0070681_10015235 3300005458 Bacteria 7649
25 Ga0070681_11866731 3300005458 Bacteria 528
26 Ga0068867_100987306 3300005459 Bacteria 763
27 Ga0070706_100176971 3300005467 Bacteria 1992
28 Ga0070707_100358759 3300005468 Bacteria 1416
29 Ga0070698_100530485 3300005471 Bacteria 1116
30 Ga0070699_100001267 3300005518 Bacteria 23288
31 Ga0070699_100057182 3300005518 Bacteria 3378
32 Ga0070679_100225124 3300005530 Bacteria 1836
33 Ga0070697_100019537 3300005536 Bacteria 5353
34 Ga0070686_101595474 3300005544 Bacteria 552
35 Ga0070695_100001386 3300005545 Bacteria 13460
36 Ga0070696_100000088 3300005546 Bacteria 45502
37 Ga0070693_100048170 3300005547 Bacteria 2427
38 Ga0070704_100007022 3300005549 Bacteria 6679
39 Ga0070702_100180781 3300005615 Bacteria 1380
40 Ga0068859_100029774 3300005617 Bacteria 5478
41 Ga0068859_100143529 3300005617 Bacteria 2461
42 Ga0068864_100000017 3300005618 Bacteria 285607
43 Ga0068863_100000018 3300005841 Bacteria 206948
44 Ga0068858_101855240 3300005842 Bacteria 596
45 Ga0068860_100032520 3300005843 Bacteria 5012
46 Ga0068862_100000010 3300005844 Bacteria 285607
47 Ga0068862_100000484 3300005844 Bacteria 42509
48 Ga0081539_10031123 3300005985 Bacteria 3296
49 Ga0075368_10002428 3300006042 Bacteria 6077
50 Ga0075364_10579264 3300006051 Bacteria 767
51 Ga0075367_10001240 3300006178 Bacteria 10744
52 Ga0075428_100104994 3300006844 Bacteria 3081
53 Ga0075428_100561187 3300006844 Bacteria 1220
54 Ga0075428_101354872 3300006844 Bacteria 747
55 Ga0075430_100338260 3300006846 Bacteria 1243
56 Ga0075431_100151995 3300006847 Bacteria 2383
57 Ga0075431_100183701 3300006847 Bacteria 2145
58 Ga0075431_100501752 3300006847 Bacteria 1204
59 Ga0075431_100942381 3300006847 Bacteria 832
60 Ga0075433_10249577 3300006852 Bacteria 1575
61 Ga0075434_101287957 3300006871 Bacteria 742
62 Ga0075429_100076247 3300006880 Bacteria 2920
63 Ga0075429_100268853 3300006880 Bacteria 1493
64 Ga0068865_100226643 3300006881 Bacteria 1464
65 Ga0075436_100142041 3300006914 Bacteria 1687
66 Ga0097620_100029774 3300006931 Bacteria 5478
67 Ga0097620_100143527 3300006931 Bacteria 2461
68 Ga0099794_10590726 3300007265 Bacteria 588
69 Ga0105251_10001652 3300009011 Bacteria 18866
70 Ga0111539_10016502 3300009094 Bacteria 9157
71 Ga0111539_10127192 3300009094 Bacteria 2985
72 Ga0111539_12146926 3300009094 Bacteria 648
73 Ga0111539_13263465 3300009094 Bacteria 523
74 Ga0114129_10109226 3300009147 Bacteria 3818
75 Ga0114129_10751324 3300009147 Bacteria 1248
76 Ga0114129_11342572 3300009147 Bacteria 884
77 Ga0105243_10173983 3300009148 Bacteria 1867
78 Ga0105248_10000128 3300009177 Bacteria 87735
79 Ga0105249_10000726 3300009553 Bacteria 29928
80 Ga0105249_10255250 3300009553 Bacteria 1740
81 Ga0105249_13021585 3300009553 Bacteria 540
82 Ga0099796_10156286 3300010159 Bacteria 901
83 Ga0105246_10191419 3300011119 Bacteria 1584
84 Ga0163162_10008438 3300013306 Bacteria 10048
85 Ga0157380_10427746 3300014326 Bacteria 1265
86 Ga0157379_10232969 3300014968 Bacteria 1670
87 Ga0213873_10110162 3300021358 Bacteria 800
88 Ga0213875_10006995 3300021388 Bacteria 5872
89 Ga0207713_1002817 3300025735 Bacteria 12268
90 Ga0207647_10554958 3300025904 Bacteria 637
91 Ga0207684_10017509 3300025910 Bacteria 6146
92 Ga0207707_10060725 3300025912 Bacteria 3288
93 Ga0207695_10022004 3300025913 Bacteria 7256
94 Ga0207693_11392361 3300025915 Bacteria 521
95 Ga0207660_10007073 3300025917 Bacteria 7269
96 Ga0207652_10188496 3300025921 Bacteria 1855
97 Ga0207681_11771193 3300025923 Bacteria 515
98 Ga0207650_10000057 3300025925 Bacteria 156913
99 Ga0207706_10711501 3300025933 Bacteria 857
100 Ga0207706_11056003 3300025933 Bacteria 680
101 Ga0207709_10113989 3300025935 Bacteria 1813
102 Ga0207704_10723393 3300025938 Bacteria 826
103 Ga0207711_10000031 3300025941 Bacteria 203323
104 Ga0207689_10432478 3300025942 Bacteria 1099
105 Ga0207712_10000565 3300025961 Bacteria 29915
106 Ga0207712_10002216 3300025961 Bacteria 12663
107 Ga0207712_10634284 3300025961 Bacteria 927
108 Ga0207668_10000032 3300025972 Bacteria 122020
109 Ga0207668_10063697 3300025972 Bacteria 2602
110 Ga0207668_10734398 3300025972 Bacteria 870
111 Ga0207658_10001010 3300025986 Bacteria 23016
112 Ga0207658_10106866 3300025986 Bacteria 2204
113 Ga0207703_10682676 3300026035 Bacteria 976
114 Ga0207678_10023593 3300026067 Bacteria 5380
115 Ga0207708_10017542 3300026075 Bacteria 5388
116 Ga0207641_10000002 3300026088 Bacteria 981004
117 Ga0207676_10000005 3300026095 Bacteria 698744
118 Ga0207674_10030214 3300026116 Bacteria 5699
119 Ga0207683_10210430 3300026121 Bacteria 1770
120 Ga0207683_11461049 3300026121 Bacteria 632
121 Ga0209813_10001193 3300027866 Bacteria 5799
122 Ga0207428_10068908 3300027907 Bacteria 2782
123 Ga0207428_10515622 3300027907 Bacteria 867
124 Ga0268266_10199386 3300028379 Bacteria 1831
125 Ga0268265_10000003 3300028380 Bacteria 949201
126 Ga0268265_10002000 3300028380 Bacteria 16092
127 Ga0268265_10023409 3300028380 Bacteria 4353
128 Ga0268265_10058002 3300028380 Bacteria 2954
129 Ga0268264_10010737 3300028381 Bacteria 7568
130 Ga0265340_10036437 3300031247 Bacteria 2438
131 Ga0307513_10061682 3300031456 Bacteria 3968
132 Ga0307516_10815631 3300031730 Bacteria 595
133 Ga0307410_11470736 3300031852 Bacteria 599
134 Ga0307409_100089384 3300031995 Bacteria 2518
135 Ga0307409_100954935 3300031995 Bacteria 873
136 Ga0307409_101294041 3300031995 Bacteria 754
137 Ga0307416_100191507 3300032002 Bacteria 1929
138 Ga0307414_11401957 3300032004 Bacteria 649
139 Ga0307415_100057590 3300032126 Bacteria 2671
140 Ga0307415_102279374 3300032126 Bacteria 531
141 Ga0373934_0332820 3300035086 Bacteria 631
142 Ga0373953_0042348 3300035117 Bacteria 1814
143 Ga0373956_0070607 3300035119 Bacteria 1593
144 Ga0373955_0362720 3300035172 Bacteria 878
145 Ga0373937_0106503 3300036401 Bacteria 2606
146 Ga0373937_0150032 3300036401 Bacteria 2183
147 Ga0395899_0240649 3300037312 Bacteria 1246
148 Ga0395900_0584728 3300037418 Bacteria 1058
149 Ga0395898_0027110 3300037466 Bacteria 5756
150 Ga0436364_0012703 3300037853 Bacteria 2945
151 Ga0436364_1189275 3300037853 Bacteria 1083
152 Ga0395901_0003552 3300038443 Bacteria 15718
153 Ga0400483_199174 3300039062 Bacteria 2392
154 Ga0436360_0692873 3300039438 Bacteria 2342
155 Ga0436361_0607780 3300039447 Bacteria 901
156 Ga0436361_0917927 3300039447 Bacteria 640
157 Ga0436363_0296277 3300039450 Bacteria 1565
158 Ga0436362_0236059 3300039453 Bacteria 840
159 Ga0451847_0554112 3300041503 Bacteria 670
160 Ga0466969_0007912 3300044656 Bacteria 5642
161 Ga0466965_0060531 3300044683 Bacteria 1891
162 Ga0466966_0144553 3300044684 Bacteria 1452
163 Ga0466961_0001344 3300044693 Bacteria 15148
164 Ga0466964_0007314 3300044706 Bacteria 4131
165 Ga0466968_0297627 3300044735 Bacteria 775
166 Ga0466970_0153319 3300044765 Bacteria 1273
167 Ga0466970_0888202 3300044765 Bacteria 524
168 Ga0466959_0002098 3300045049 Bacteria 12608
169 Ga0451576_0004104 3300045051 Bacteria 19212
170 Ga0495592_0020292 3300046454 Bacteria 5055
171 Ga0495629_0077748 3300046459 Bacteria 2316
172 Ga0495638_0532663 3300046460 Bacteria 587
173 Ga0495594_0649937 3300046499 Bacteria 597
174 Ga0495618_0080636 3300046514 Bacteria 2077
175 Ga0495620_0099037 3300046515 Bacteria 1163
176 Ga0495654_0196633 3300046530 Bacteria 865
177 Ga0495640_0462339 3300046533 Bacteria 774
178 Ga0495586_0179006 3300046535 Bacteria 1199
179 Ga0495609_0040389 3300046538 Bacteria 2099
180 Ga0495609_0054623 3300046538 Bacteria 1773
181 Ga0495597_0001468 3300046542 Bacteria 16907
182 Ga0495622_0001122 3300046557 Bacteria 13993
183 Ga0495668_0015644 3300046616 Bacteria 4426
184 Ga0495625_0263794 3300046660 Bacteria 1114
185 Ga0495635_0118014 3300046663 Bacteria 1810
186 Ga0495669_0029610 3300046684 Bacteria 2402
187 Ga0495671_0225840 3300046692 Bacteria 906
188 Ga0495600_0019398 3300046809 Bacteria 4342
189 Ga0495687_022097 3300047443 Bacteria 3061
190 Ga0495593_0205883 3300047673 Bacteria 988
191 Ga0496100_0911722 3300048903 Bacteria 690
192 Ga0496101_0124396 3300048904 Bacteria 1953
193 Ga0496102_0027078 3300048905 Bacteria 5119
194 Ga0496103_0076608 3300048906 Bacteria 2099
195 Ga0496103_0088702 3300048906 Bacteria 1950
196 Ga0496104_0364161 3300048907 Bacteria 1358
197 Ga0496106_0027107 3300048909 Bacteria 4267
198 Ga0496107_0043350 3300048910 Bacteria 3232
199 Ga0496109_1022538 3300048912 Bacteria 764
200 Ga0496115_0428202 3300048918 Bacteria 1071
201 Ga0496117_0003768 3300048920 Bacteria 17344
202 Ga0496118_0004620 3300048921 Bacteria 16171
203 Ga0496121_0217399 3300048924 Bacteria 1349
204 Ga0496124_0187021 3300048927 Bacteria 1589
205 Ga0501031_0105046 3300049568 Bacteria 1843
206 Ga0501032_0439936 3300049569 Bacteria 836
207 Ga0501032_0764324 3300049569 Bacteria 611
208 Ga0501033_0177546 3300049570 Bacteria 1527
209 Ga0501039_0652928 3300049575 Bacteria 824
210 Ga0501039_1141589 3300049575 Bacteria 603
211 Ga0501040_0103173 3300049576 Bacteria 1991
212 Ga0501041_0147011 3300049577 Bacteria 1471
213 Ga0501041_0207503 3300049577 Bacteria 1229
214 Ga0501041_0467480 3300049577 Bacteria 801
215 Ga0501041_0929834 3300049577 Bacteria 559
216 Ga0501043_0114622 3300049579 Bacteria 2116
217 Ga0501043_0711733 3300049579 Bacteria 733
218 Ga0501043_1217297 3300049579 Bacteria 528
219 Ga0501046_0093144 3300049580 Bacteria 2316
220 Ga0501047_0557768 3300049581 Bacteria 969
221 Ga0501048_0063661 3300049582 Bacteria 2608
222 Ga0501048_0748268 3300049582 Bacteria 702
223 Ga0501070_0150478 3300049586 Bacteria 1920
224 Ga0501070_0159061 3300049586 Bacteria 1863
225 Ga0501072_0021583 3300049588 Bacteria 4995
226 Ga0501072_0150759 3300049588 Bacteria 1854
227 Ga0501073_0087677 3300049589 Bacteria 2164
228 Ga0501073_0386287 3300049589 Bacteria 967
229 Ga0501074_0039930 3300049590 Bacteria 3398
230 Ga0501074_0501525 3300049590 Bacteria 860
231 Ga0501075_0090352 3300049591 Bacteria 2323
232 Ga0501075_1293831 3300049591 Bacteria 553
233 Ga0501076_0007181 3300049592 Bacteria 8098
234 Ga0501076_0209362 3300049592 Bacteria 1593
235 Ga0501076_1505789 3300049592 Bacteria 552
236 Ga0501077_0026808 3300049593 Bacteria 3658
237 Ga0501077_0524943 3300049593 Bacteria 759
238 Ga0501079_0006499 3300049741 Bacteria 8781
239 Ga0501079_0064820 3300049741 Bacteria 2818
240 Ga0501079_0321582 3300049741 Bacteria 1211
241 Ga0501080_0052155 3300049742 Bacteria 3807
242 Ga0501080_1327563 3300049742 Bacteria 615
243 Ga0501081_0031238 3300049743 Bacteria 3609
244 Ga0501081_0725811 3300049743 Bacteria 746
245 Ga0501083_0359724 3300049744 Bacteria 946
246 Ga0501083_1058360 3300049744 Bacteria 528
247 Ga0501044_1167391 3300049823 Bacteria 638
248 Ga0501045_0195318 3300049824 Bacteria 1508
249 Ga0501045_0925330 3300049824 Bacteria 640
250 nmdc:mga00v17_555853_c1 3300050491 Bacteria 742
251 nmdc:mga0k408_903197_c1 3300050493 Bacteria 512
252 nmdc:mga06z11_1628_c1 3300050494 Bacteria 8400
253 nmdc:mga04h51_1238_c1 3300050495 Bacteria 5906
254 nmdc:mga05p37_1060776_c1 3300050507 Bacteria 853
255 nmdc:mga05p37_358505_c1 3300050507 Bacteria 1715
256 nmdc:mga09592_373844_c1 3300050508 Bacteria 1233
257 nmdc:mga09592_41750_c1 3300050508 Bacteria 3857
258 nmdc:mga06r32_1743749_c1 3300050510 Bacteria 559
259 nmdc:mga06r32_417149_c1 3300050510 Bacteria 1324
260 nmdc:mga06r32_522387_c1 3300050510 Bacteria 1163
261 nmdc:mga06r32_633993_c1 3300050510 Bacteria 1038
262 nmdc:mga06r32_804920_c1 3300050510 Bacteria 900
263 nmdc:mga08y16_1049814_c1 3300050511 Bacteria 792
264 nmdc:mga08y16_111942_c1 3300050511 Bacteria 2842
265 nmdc:mga08y16_74905_c1 3300050511 Bacteria 3528
266 nmdc:mga0n895_1488663_c1 3300050512 Bacteria 643
267 nmdc:mga0n895_448241_c1 3300050512 Bacteria 1303
268 nmdc:mga08x19_431833_c1 3300050514 Bacteria 926
269 nmdc:mga0a205_202653_c1 3300050515 Bacteria 1874
270 Ga0495601_0051577 3300053077 Bacteria 2596
271 Ga0495595_0110711 3300053084 Bacteria 1331
272 Ga0495619_0019737 3300053085 Bacteria 4288
273 Ga0500583_0204952 3300053092 Bacteria 980
274 Ga0500566_0050354 3300053094 Bacteria 2385
275 Ga0500554_149831 3300053102 Bacteria 789
276 Ga0500555_076492 3300053103 Bacteria 876
277 Ga0500555_100967 3300053103 Bacteria 732
278 Ga0500569_010963 3300053109 Bacteria 2151
279 Ga0500595_003056 3300053119 Bacteria 7954
280 Ga0500608_003033 3300053122 Bacteria 6220
281 Ga0500614_000425 3300053123 Bacteria 11002
282 Ga0500559_0422339 3300053136 Bacteria 618
283 Ga0500590_004834 3300053148 Bacteria 6423
284 Ga0500616_0410698 3300053153 Bacteria 539
285 Ga0500619_054353 3300053154 Bacteria 1304
286 Ga0500620_108555 3300053155 Bacteria 972
287 Ga0500638_308890 3300053162 Bacteria 606
288 Ga0500636_0145671 3300053177 Bacteria 1306
289 Ga0500637_0142378 3300053178 Bacteria 1387
290 Ga0500625_128174 3300053729 Bacteria 1004
291 Ga0500596_002873 3300053735 Bacteria 3355
292 Ga0501084_0003507 3300054114 Bacteria 12748
293 Ga0501084_0903016 3300054114 Bacteria 743
294 Ga0587124_030738 3300059660 Bacteria 592
295 Ga0501082_0041654 3300060353 Bacteria 3959
296 Ga0501082_0174716 3300060353 Bacteria 1868
297 Ga0501082_0200098 3300060353 Bacteria 1738
298 Ga0501082_0556851 3300060353 Bacteria 1003
299 Ga0501082_0757405 3300060353 Bacteria 850
300 Ga0501082_1207483 3300060353 Bacteria 661
301 Ga0530510_0034341 3300061734 Bacteria 3653
302 Ga0530510_0143798 3300061734 Bacteria 1758
303 Ga0530510_1007361 3300061734 Bacteria 637

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221591 2643962884 97
2 iso_pu_bacteria 2844533157 2844538197 97
3 iso_pu_bacteria 2889790730 2889793770 97
4 iso_pu_bacteria 2889914905 2889918989 97
5 iso_pu_bacteria 2929199973 2929204357 97
6 iso_pu_bacteria 2932401849 2932402619 97
7 iso_pu_bacteria 8055909800 8055910675 97
8 3300005338 Ga0068868_100776186 Ga0068868_1007761862 99
9 3300005436 Ga0070713_102239757 Ga0070713_1022397571 99
10 3300031995 Ga0307409_100089384 Ga0307409_1000893844 99
11 3300031995 Ga0307409_100954935 Ga0307409_1009549352 99
12 3300032002 Ga0307416_100191507 Ga0307416_1001915072 99
13 3300032126 Ga0307415_100057590 Ga0307415_1000575903 99
14 3300032126 Ga0307415_102279374 Ga0307415_1022793741 99
15 3300037312 Ga0395899_0240649 Ga0395899_0240649_625_927 99
16 3300037418 Ga0395900_0584728 Ga0395900_0584728_156_458 99
17 3300037466 Ga0395898_0027110 Ga0395898_0027110_3398_3700 99
18 3300038443 Ga0395901_0003552 Ga0395901_0003552_3350_3652 99
19 3300041503 Ga0451847_0554112 Ga0451847_0554112_32_334 99
20 iso_pu_bacteria 2643221629 2644166953 99
21 iso_pu_bacteria 2643221662 2644349467 99
22 3300001976 JGI24752J21851_1005761 JGI24752J21851_10057612 101
23 3300005295 Ga0065707_10210486 Ga0065707_102104862 101
24 3300005331 Ga0070670_100000016 Ga0070670_10000001659 101
25 3300005336 Ga0070680_100052384 Ga0070680_1000523842 101
26 3300005340 Ga0070689_101441784 Ga0070689_1014417841 101
27 3300005345 Ga0070692_10226860 Ga0070692_102268602 101
28 3300005347 Ga0070668_100010408 Ga0070668_1000104087 101
29 3300005347 Ga0070668_100074017 Ga0070668_1000740173 101
30 3300005347 Ga0070668_100875300 Ga0070668_1008753002 101
31 3300005353 Ga0070669_100689981 Ga0070669_1006899811 101
32 3300005353 Ga0070669_101960422 Ga0070669_1019604222 101
33 3300005367 Ga0070667_100000425 Ga0070667_10000042526 101
34 3300005367 Ga0070667_100570978 Ga0070667_1005709782 101
35 3300005406 Ga0070703_10028415 Ga0070703_100284152 101
36 3300005436 Ga0070713_100394247 Ga0070713_1003942472 101
37 3300005440 Ga0070705_100000010 Ga0070705_10000001011 101
38 3300005440 Ga0070705_100814814 Ga0070705_1008148142 101
39 3300005441 Ga0070700_100012029 Ga0070700_1000120297 101
40 3300005444 Ga0070694_100007490 Ga0070694_1000074906 101
41 3300005445 Ga0070708_100575627 Ga0070708_1005756272 101
42 3300005455 Ga0070663_100021990 Ga0070663_1000219905 101
43 3300005458 Ga0070681_10015235 Ga0070681_100152355 101
44 3300005458 Ga0070681_11866731 Ga0070681_118667311 101
45 3300005459 Ga0068867_100987306 Ga0068867_1009873062 101
46 3300005467 Ga0070706_100176971 Ga0070706_1001769713 101
47 3300005468 Ga0070707_100358759 Ga0070707_1003587591 101
48 3300005471 Ga0070698_100530485 Ga0070698_1005304852 101
49 3300005518 Ga0070699_100001267 Ga0070699_10000126712 101
50 3300005518 Ga0070699_100057182 Ga0070699_1000571825 101
51 3300005530 Ga0070679_100225124 Ga0070679_1002251242 101
52 3300005536 Ga0070697_100019537 Ga0070697_1000195376 101
53 3300005544 Ga0070686_101595474 Ga0070686_1015954742 101
54 3300005545 Ga0070695_100001386 Ga0070695_1000013863 101
55 3300005546 Ga0070696_100000088 Ga0070696_10000008831 101
56 3300005547 Ga0070693_100048170 Ga0070693_1000481704 101
57 3300005549 Ga0070704_100007022 Ga0070704_1000070225 101
58 3300005615 Ga0070702_100180781 Ga0070702_1001807812 101
59 3300005617 Ga0068859_100029774 Ga0068859_1000297743 101
60 3300005617 Ga0068859_100143529 Ga0068859_1001435292 101
61 3300005618 Ga0068864_100000017 Ga0068864_100000017231 101
62 3300005841 Ga0068863_100000018 Ga0068863_100000018152 101
63 3300005842 Ga0068858_101855240 Ga0068858_1018552401 101
64 3300005843 Ga0068860_100032520 Ga0068860_1000325202 101
65 3300005844 Ga0068862_100000010 Ga0068862_10000001080 101
66 3300005844 Ga0068862_100000484 Ga0068862_10000048428 101
67 3300005985 Ga0081539_10031123 Ga0081539_100311234 101
68 3300006042 Ga0075368_10002428 Ga0075368_100024282 101
69 3300006051 Ga0075364_10579264 Ga0075364_105792642 101
70 3300006178 Ga0075367_10001240 Ga0075367_100012408 101
71 3300006844 Ga0075428_100104994 Ga0075428_1001049945 101
72 3300006844 Ga0075428_100561187 Ga0075428_1005611873 101
73 3300006844 Ga0075428_101354872 Ga0075428_1013548722 101
74 3300006846 Ga0075430_100338260 Ga0075430_1003382603 101
75 3300006847 Ga0075431_100151995 Ga0075431_1001519953 101
76 3300006847 Ga0075431_100183701 Ga0075431_1001837013 101
77 3300006847 Ga0075431_100501752 Ga0075431_1005017522 101
78 3300006847 Ga0075431_100942381 Ga0075431_1009423812 101
79 3300006852 Ga0075433_10249577 Ga0075433_102495772 101
80 3300006871 Ga0075434_101287957 Ga0075434_1012879572 101
81 3300006880 Ga0075429_100076247 Ga0075429_1000762475 101
82 3300006880 Ga0075429_100268853 Ga0075429_1002688532 101
83 3300006881 Ga0068865_100226643 Ga0068865_1002266433 101
84 3300006914 Ga0075436_100142041 Ga0075436_1001420412 101
85 3300006931 Ga0097620_100029774 Ga0097620_1000297743 101
86 3300006931 Ga0097620_100143527 Ga0097620_1001435273 101
87 3300007265 Ga0099794_10590726 Ga0099794_105907261 101
88 3300009011 Ga0105251_10001652 Ga0105251_1000165212 101
89 3300009094 Ga0111539_10016502 Ga0111539_100165025 101
90 3300009094 Ga0111539_10127192 Ga0111539_101271923 101
91 3300009094 Ga0111539_12146926 Ga0111539_121469262 101
92 3300009094 Ga0111539_13263465 Ga0111539_132634651 101
93 3300009147 Ga0114129_10109226 Ga0114129_101092265 101
94 3300009147 Ga0114129_10751324 Ga0114129_107513243 101
95 3300009147 Ga0114129_11342572 Ga0114129_113425721 101
96 3300009148 Ga0105243_10173983 Ga0105243_101739832 101
97 3300009177 Ga0105248_10000128 Ga0105248_1000012881 101
98 3300009553 Ga0105249_10000726 Ga0105249_1000072625 101
99 3300009553 Ga0105249_10255250 Ga0105249_102552503 101
100 3300009553 Ga0105249_13021585 Ga0105249_130215852 101
101 3300010159 Ga0099796_10156286 Ga0099796_101562861 101
102 3300011119 Ga0105246_10191419 Ga0105246_101914193 101
103 3300013306 Ga0163162_10008438 Ga0163162_100084385 101
104 3300014326 Ga0157380_10427746 Ga0157380_104277462 101
105 3300014968 Ga0157379_10232969 Ga0157379_102329693 101
106 3300021358 Ga0213873_10110162 Ga0213873_101101622 101
107 3300021388 Ga0213875_10006995 Ga0213875_100069952 101
108 3300025735 Ga0207713_1002817 Ga0207713_10028176 101
109 3300025904 Ga0207647_10554958 Ga0207647_105549581 101
110 3300025910 Ga0207684_10017509 Ga0207684_100175093 101
111 3300025912 Ga0207707_10060725 Ga0207707_100607253 101
112 3300025913 Ga0207695_10022004 Ga0207695_100220046 101
113 3300025915 Ga0207693_11392361 Ga0207693_113923612 101
114 3300025917 Ga0207660_10007073 Ga0207660_100070736 101
115 3300025921 Ga0207652_10188496 Ga0207652_101884962 101
116 3300025923 Ga0207681_11771193 Ga0207681_117711931 101
117 3300025925 Ga0207650_10000057 Ga0207650_1000005759 101
118 3300025933 Ga0207706_10711501 Ga0207706_107115012 101
119 3300025933 Ga0207706_11056003 Ga0207706_110560032 101
120 3300025935 Ga0207709_10113989 Ga0207709_101139892 101
121 3300025938 Ga0207704_10723393 Ga0207704_107233932 101
122 3300025941 Ga0207711_10000031 Ga0207711_1000003180 101
123 3300025942 Ga0207689_10432478 Ga0207689_104324782 101
124 3300025961 Ga0207712_10000565 Ga0207712_1000056526 101
125 3300025961 Ga0207712_10002216 Ga0207712_100022169 101
126 3300025961 Ga0207712_10634284 Ga0207712_106342842 101
127 3300025972 Ga0207668_10000032 Ga0207668_10000032108 101
128 3300025972 Ga0207668_10063697 Ga0207668_100636973 101
129 3300025972 Ga0207668_10734398 Ga0207668_107343982 101
130 3300025986 Ga0207658_10001010 Ga0207658_1000101024 101
131 3300025986 Ga0207658_10106866 Ga0207658_101068663 101
132 3300026035 Ga0207703_10682676 Ga0207703_106826762 101
133 3300026067 Ga0207678_10023593 Ga0207678_100235933 101
134 3300026075 Ga0207708_10017542 Ga0207708_100175427 101
135 3300026088 Ga0207641_10000002 Ga0207641_10000002406 101
136 3300026095 Ga0207676_10000005 Ga0207676_10000005402 101
137 3300026116 Ga0207674_10030214 Ga0207674_100302142 101
138 3300026121 Ga0207683_10210430 Ga0207683_102104303 101
139 3300026121 Ga0207683_11461049 Ga0207683_114610492 101
140 3300027866 Ga0209813_10001193 Ga0209813_100011932 101
141 3300027907 Ga0207428_10068908 Ga0207428_100689084 101
142 3300027907 Ga0207428_10515622 Ga0207428_105156221 101
143 3300028379 Ga0268266_10199386 Ga0268266_101993863 101
144 3300028380 Ga0268265_10000003 Ga0268265_10000003584 101
145 3300028380 Ga0268265_10002000 Ga0268265_100020009 101
146 3300028380 Ga0268265_10023409 Ga0268265_100234092 101
147 3300028380 Ga0268265_10058002 Ga0268265_100580023 101
148 3300028381 Ga0268264_10010737 Ga0268264_100107378 101
149 3300031247 Ga0265340_10036437 Ga0265340_100364373 101
150 3300031456 Ga0307513_10061682 Ga0307513_100616825 101
151 3300031730 Ga0307516_10815631 Ga0307516_108156312 101
152 3300031852 Ga0307410_11470736 Ga0307410_114707361 101
153 3300031995 Ga0307409_101294041 Ga0307409_1012940412 101
154 3300032004 Ga0307414_11401957 Ga0307414_114019572 101
155 3300035086 Ga0373934_0332820 Ga0373934_0332820_152_457 101
156 3300035117 Ga0373953_0042348 Ga0373953_0042348_123_431 101
157 3300035119 Ga0373956_0070607 Ga0373956_0070607_431_739 101
158 3300035172 Ga0373955_0362720 Ga0373955_0362720_409_714 101
159 3300036401 Ga0373937_0106503 Ga0373937_0106503_1147_1455 101
160 3300036401 Ga0373937_0150032 Ga0373937_0150032_235_540 101
161 3300037853 Ga0436364_0012703 Ga0436364_0012703_2455_2760 101
162 3300037853 Ga0436364_1189275 Ga0436364_1189275_430_735 101
163 3300039062 Ga0400483_199174 Ga0400483_199174_333_638 101
164 3300039438 Ga0436360_0692873 Ga0436360_0692873_1398_1703 101
165 3300039447 Ga0436361_0607780 Ga0436361_0607780_384_689 101
166 3300039447 Ga0436361_0917927 Ga0436361_0917927_321_626 101
167 3300039450 Ga0436363_0296277 Ga0436363_0296277_479_784 101
168 3300039453 Ga0436362_0236059 Ga0436362_0236059_267_572 101
169 3300044656 Ga0466969_0007912 Ga0466969_0007912_1763_2071 101
170 3300044683 Ga0466965_0060531 Ga0466965_0060531_122_430 101
171 3300044684 Ga0466966_0144553 Ga0466966_0144553_544_852 101
172 3300044693 Ga0466961_0001344 Ga0466961_0001344_958_1266 101
173 3300044706 Ga0466964_0007314 Ga0466964_0007314_575_883 101
174 3300044735 Ga0466968_0297627 Ga0466968_0297627_456_764 101
175 3300044765 Ga0466970_0153319 Ga0466970_0153319_633_950 101
176 3300044765 Ga0466970_0888202 Ga0466970_0888202_125_433 101
177 3300045049 Ga0466959_0002098 Ga0466959_0002098_7875_8183 101
178 3300045051 Ga0451576_0004104 Ga0451576_0004104_9002_9307 101
179 3300046454 Ga0495592_0020292 Ga0495592_0020292_4633_4941 101
180 3300046459 Ga0495629_0077748 Ga0495629_0077748_1951_2256 101
181 3300046460 Ga0495638_0532663 Ga0495638_0532663_112_417 101
182 3300046499 Ga0495594_0649937 Ga0495594_0649937_51_356 101
183 3300046514 Ga0495618_0080636 Ga0495618_0080636_475_783 101
184 3300046515 Ga0495620_0099037 Ga0495620_0099037_691_996 101
185 3300046530 Ga0495654_0196633 Ga0495654_0196633_284_589 101
186 3300046533 Ga0495640_0462339 Ga0495640_0462339_167_475 101
187 3300046535 Ga0495586_0179006 Ga0495586_0179006_795_1103 101
188 3300046538 Ga0495609_0040389 Ga0495609_0040389_1210_1530 101
189 3300046538 Ga0495609_0054623 Ga0495609_0054623_862_1167 101
190 3300046542 Ga0495597_0001468 Ga0495597_0001468_4429_4734 101
191 3300046557 Ga0495622_0001122 Ga0495622_0001122_10064_10369 101
192 3300046616 Ga0495668_0015644 Ga0495668_0015644_904_1209 101
193 3300046660 Ga0495625_0263794 Ga0495625_0263794_187_492 101
194 3300046663 Ga0495635_0118014 Ga0495635_0118014_588_896 101
195 3300046684 Ga0495669_0029610 Ga0495669_0029610_1254_1559 101
196 3300046692 Ga0495671_0225840 Ga0495671_0225840_97_417 101
197 3300046809 Ga0495600_0019398 Ga0495600_0019398_1464_1772 101
198 3300047443 Ga0495687_022097 Ga0495687_022097_2321_2626 101
199 3300047673 Ga0495593_0205883 Ga0495593_0205883_456_761 101
200 3300048903 Ga0496100_0911722 Ga0496100_0911722_173_478 101
201 3300048904 Ga0496101_0124396 Ga0496101_0124396_606_911 101
202 3300048905 Ga0496102_0027078 Ga0496102_0027078_3177_3482 101
203 3300048906 Ga0496103_0076608 Ga0496103_0076608_1769_2074 101
204 3300048906 Ga0496103_0088702 Ga0496103_0088702_169_474 101
205 3300048907 Ga0496104_0364161 Ga0496104_0364161_885_1190 101
206 3300048909 Ga0496106_0027107 Ga0496106_0027107_1059_1364 101
207 3300048910 Ga0496107_0043350 Ga0496107_0043350_81_386 101
208 3300048912 Ga0496109_1022538 Ga0496109_1022538_120_425 101
209 3300048918 Ga0496115_0428202 Ga0496115_0428202_432_737 101
210 3300048920 Ga0496117_0003768 Ga0496117_0003768_8715_9020 101
211 3300048921 Ga0496118_0004620 Ga0496118_0004620_13109_13414 101
212 3300048924 Ga0496121_0217399 Ga0496121_0217399_87_392 101
213 3300048927 Ga0496124_0187021 Ga0496124_0187021_633_941 101
214 3300049568 Ga0501031_0105046 Ga0501031_0105046_355_660 101
215 3300049569 Ga0501032_0439936 Ga0501032_0439936_273_578 101
216 3300049569 Ga0501032_0764324 Ga0501032_0764324_53_367 101
217 3300049570 Ga0501033_0177546 Ga0501033_0177546_235_540 101
218 3300049575 Ga0501039_0652928 Ga0501039_0652928_471_791 101
219 3300049575 Ga0501039_1141589 Ga0501039_1141589_257_562 101
220 3300049576 Ga0501040_0103173 Ga0501040_0103173_324_629 101
221 3300049577 Ga0501041_0147011 Ga0501041_0147011_1137_1442 101
222 3300049577 Ga0501041_0207503 Ga0501041_0207503_904_1209 101
223 3300049577 Ga0501041_0467480 Ga0501041_0467480_66_371 101
224 3300049577 Ga0501041_0929834 Ga0501041_0929834_212_517 101
225 3300049579 Ga0501043_0114622 Ga0501043_0114622_1151_1456 101
226 3300049579 Ga0501043_0711733 Ga0501043_0711733_303_608 101
227 3300049579 Ga0501043_1217297 Ga0501043_1217297_206_511 101
228 3300049580 Ga0501046_0093144 Ga0501046_0093144_438_743 101
229 3300049581 Ga0501047_0557768 Ga0501047_0557768_407_712 101
230 3300049582 Ga0501048_0063661 Ga0501048_0063661_2113_2418 101
231 3300049582 Ga0501048_0748268 Ga0501048_0748268_22_333 101
232 3300049586 Ga0501070_0150478 Ga0501070_0150478_953_1258 101
233 3300049586 Ga0501070_0159061 Ga0501070_0159061_666_971 101
234 3300049588 Ga0501072_0021583 Ga0501072_0021583_525_830 101
235 3300049588 Ga0501072_0150759 Ga0501072_0150759_1393_1698 101
236 3300049589 Ga0501073_0087677 Ga0501073_0087677_416_721 101
237 3300049589 Ga0501073_0386287 Ga0501073_0386287_261_566 101
238 3300049590 Ga0501074_0039930 Ga0501074_0039930_2125_2430 101
239 3300049590 Ga0501074_0501525 Ga0501074_0501525_483_788 101
240 3300049591 Ga0501075_0090352 Ga0501075_0090352_1943_2248 101
241 3300049591 Ga0501075_1293831 Ga0501075_1293831_41_352 101
242 3300049592 Ga0501076_0007181 Ga0501076_0007181_6801_7106 101
243 3300049592 Ga0501076_0209362 Ga0501076_0209362_688_993 101
244 3300049592 Ga0501076_1505789 Ga0501076_1505789_120_425 101
245 3300049593 Ga0501077_0026808 Ga0501077_0026808_750_1055 101
246 3300049593 Ga0501077_0524943 Ga0501077_0524943_147_452 101
247 3300049741 Ga0501079_0006499 Ga0501079_0006499_6060_6365 101
248 3300049741 Ga0501079_0064820 Ga0501079_0064820_621_926 101
249 3300049741 Ga0501079_0321582 Ga0501079_0321582_736_1041 101
250 3300049742 Ga0501080_0052155 Ga0501080_0052155_1065_1370 101
251 3300049742 Ga0501080_1327563 Ga0501080_1327563_79_384 101
252 3300049743 Ga0501081_0031238 Ga0501081_0031238_760_1065 101
253 3300049743 Ga0501081_0725811 Ga0501081_0725811_194_499 101
254 3300049744 Ga0501083_0359724 Ga0501083_0359724_564_875 101
255 3300049744 Ga0501083_1058360 Ga0501083_1058360_153_458 101
256 3300049823 Ga0501044_1167391 Ga0501044_1167391_25_330 101
257 3300049824 Ga0501045_0195318 Ga0501045_0195318_278_583 101
258 3300049824 Ga0501045_0925330 Ga0501045_0925330_164_469 101
259 3300050491 nmdc:mga00v17_555853_c1 nmdc:mga00v17_555853_c1_195_500 101
260 3300050493 nmdc:mga0k408_903197_c1 nmdc:mga0k408_903197_c1_95_427 101
261 3300050494 nmdc:mga06z11_1628_c1 nmdc:mga06z11_1628_c1_2659_2967 101
262 3300050495 nmdc:mga04h51_1238_c1 nmdc:mga04h51_1238_c1_404_712 101
263 3300050507 nmdc:mga05p37_1060776_c1 nmdc:mga05p37_1060776_c1_211_561 101
264 3300050507 nmdc:mga05p37_358505_c1 nmdc:mga05p37_358505_c1_869_1177 101
265 3300050508 nmdc:mga09592_373844_c1 nmdc:mga09592_373844_c1_42_347 101
266 3300050508 nmdc:mga09592_41750_c1 nmdc:mga09592_41750_c1_3236_3544 101
267 3300050510 nmdc:mga06r32_1743749_c1 nmdc:mga06r32_1743749_c1_35_343 101
268 3300050510 nmdc:mga06r32_417149_c1 nmdc:mga06r32_417149_c1_695_1000 101
269 3300050510 nmdc:mga06r32_522387_c1 nmdc:mga06r32_522387_c1_387_692 101
270 3300050510 nmdc:mga06r32_633993_c1 nmdc:mga06r32_633993_c1_550_855 101
271 3300050510 nmdc:mga06r32_804920_c1 nmdc:mga06r32_804920_c1_551_856 101
272 3300050511 nmdc:mga08y16_1049814_c1 nmdc:mga08y16_1049814_c1_121_456 101
273 3300050511 nmdc:mga08y16_111942_c1 nmdc:mga08y16_111942_c1_1114_1419 101
274 3300050511 nmdc:mga08y16_74905_c1 nmdc:mga08y16_74905_c1_766_1074 101
275 3300050512 nmdc:mga0n895_1488663_c1 nmdc:mga0n895_1488663_c1_247_552 101
276 3300050512 nmdc:mga0n895_448241_c1 nmdc:mga0n895_448241_c1_90_425 101
277 3300050514 nmdc:mga08x19_431833_c1 nmdc:mga08x19_431833_c1_220_549 101
278 3300050515 nmdc:mga0a205_202653_c1 nmdc:mga0a205_202653_c1_589_924 101
279 3300053077 Ga0495601_0051577 Ga0495601_0051577_2232_2540 101
280 3300053084 Ga0495595_0110711 Ga0495595_0110711_803_1111 101
281 3300053085 Ga0495619_0019737 Ga0495619_0019737_3056_3364 101
282 3300053092 Ga0500583_0204952 Ga0500583_0204952_194_499 101
283 3300053094 Ga0500566_0050354 Ga0500566_0050354_1429_1734 101
284 3300053102 Ga0500554_149831 Ga0500554_149831_181_486 101
285 3300053103 Ga0500555_076492 Ga0500555_076492_292_597 101
286 3300053103 Ga0500555_100967 Ga0500555_100967_122_427 101
287 3300053109 Ga0500569_010963 Ga0500569_010963_396_701 101
288 3300053119 Ga0500595_003056 Ga0500595_003056_6991_7296 101
289 3300053122 Ga0500608_003033 Ga0500608_003033_381_686 101
290 3300053123 Ga0500614_000425 Ga0500614_000425_992_1297 101
291 3300053136 Ga0500559_0422339 Ga0500559_0422339_241_546 101
292 3300053148 Ga0500590_004834 Ga0500590_004834_659_964 101
293 3300053153 Ga0500616_0410698 Ga0500616_0410698_110_421 101
294 3300053154 Ga0500619_054353 Ga0500619_054353_514_819 101
295 3300053155 Ga0500620_108555 Ga0500620_108555_154_459 101
296 3300053162 Ga0500638_308890 Ga0500638_308890_213_518 101
297 3300053177 Ga0500636_0145671 Ga0500636_0145671_228_533 101
298 3300053178 Ga0500637_0142378 Ga0500637_0142378_277_582 101
299 3300053729 Ga0500625_128174 Ga0500625_128174_442_747 101
300 3300053735 Ga0500596_002873 Ga0500596_002873_2788_3093 101
301 3300054114 Ga0501084_0003507 Ga0501084_0003507_4642_4947 101
302 3300054114 Ga0501084_0903016 Ga0501084_0903016_46_357 101
303 3300059660 Ga0587124_030738 Ga0587124_030738_197_520 101
304 3300060353 Ga0501082_0041654 Ga0501082_0041654_1575_1880 101
305 3300060353 Ga0501082_0174716 Ga0501082_0174716_271_576 101
306 3300060353 Ga0501082_0200098 Ga0501082_0200098_650_955 101
307 3300060353 Ga0501082_0556851 Ga0501082_0556851_166_504 101
308 3300060353 Ga0501082_0757405 Ga0501082_0757405_37_342 101
309 3300060353 Ga0501082_1207483 Ga0501082_1207483_127_432 101
310 3300061734 Ga0530510_0034341 Ga0530510_0034341_339_644 101
311 3300061734 Ga0530510_0143798 Ga0530510_0143798_1334_1639 101
312 3300061734 Ga0530510_1007361 Ga0530510_1007361_218_523 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00699

Urease_beta

Urease beta subunit

8

105

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qga-assembly1.cif.gz_A 3.0 a model of iron containing urease urea2b2 from helicobacter mustelae 0.944 4 99
6yl3-assembly1.cif.gz_B high resolution cryo-em structure of urease from the pathogen yersinia enterocolitica 0.9345 3 99
8a18-assembly1.cif.gz_BBB 1.63 a resolution hydroquinone inhibited sporosarcina pasteurii urease 0.932 1 92
8hc1-assembly1.cif.gz_A cryoem structure of helicobacter pylori urefd/urease complex 0.9305 1 93
4z42-assembly1.cif.gz_B crystal structure of urease from yersinia enterocolitica 0.9301 4 99
ID Description Score Start End Superfamily
3qgaA02 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.944 4 99 2.10.150.10
1s3tB00 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.9331 1 92 2.10.150.10
4z42K00 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.9324 4 99 2.10.150.10
1a5kB00 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.9232 1 101 2.10.150.10
3la4A03 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.8929 21 101 2.10.150.10
ID Description Score Start End GO Terms
AF-A0A3C0N2Z2-F1-model_v4 Urease subunit beta 1.014 27 77 GO:0009039
GO:0035550
GO:0043419
AF-A0A7Y6E4D2-F1-model_v4 Urease subunit beta 0.9928 7 61 GO:0016787
GO:0035550
GO:0043419
AF-A0A0K6FSH9-F1-model_v4 urease (EC 3.5.1.5) 0.9905 13 86 GO:0009039
GO:0016151
GO:0035550
GO:0043419
AF-A0A0F7GA08-F1-model_v4 Urease B (EC 3.5.1.5) 0.987 17 82 GO:0009039
GO:0035550
GO:0043419
AF-A0A7C2ZAT0-F1-model_v4 Urease subunit beta (EC 3.5.1.5) 0.983 5 86 GO:0009039
GO:0035550
GO:0043419

Feature Viewer

pLDDT pTM Quality
90.38 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map