F401689

General Info

Members Datasets Scaffolds Average Seq Length
312 161 301 273

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10515720|Ga0105237_105157201
Length 319
Sequence MPLSLDYFNKFKSLLQYTDKIIHYYTTFFIFFRGPVKLFLIVNQFNMTTTVSNLPGLNDLKATSAENIQEFAEKGHTLVRNILSPEEIAVYRPVIVDAAERYNTEKRKMQDRDTYGKAFLQIMNLWRVDEAVKRFVMSKRLGKIAADLLGVENVRIYHDQALFKEAGGGPTPWHQDQYYWPIDTNNTITMWMPLVDIDVDMGMLTFASGSYDKGSIFDYEISDESESAFDDYVRDNKFPISRATTMKAGDATFHRGFTIHNAPGNNSDKMREVMTIIYLADGARVSEPKNEWQKNDLAKWMMSKPVGELIDSELNPKVL

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
3 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
4 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
5 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
6 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
7 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
8 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
9 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
10 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
11 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
12 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
109 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
110 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
149 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
155 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
156 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
157 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
158 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 0
Isolates 3.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.09
Nodule 0
Rhizoplane 0.32
Rhizosphere 86.22
Stem 0
Stem Tuber 0
Unclassified 7.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1012409 3300001915 Bacteria 1465
2 JGI24740J21852_10005935 3300001979 Bacteria 5114
3 JGI24737J22298_10000628 3300001990 Bacteria 12434
4 JGI24735J21928_10000031 3300002067 Bacteria 75354
5 rootH1_10030138 3300003316 Bacteria 9704
6 rootH2_10007197 3300003320 Bacteria 152995
7 rootH2_10084556 3300003320 Bacteria 3312
8 rootH2_10095015 3300003320 Bacteria 5078
9 rootH2_10098509 3300003320 Bacteria 1791
10 rootH2_10098510 3300003320 Bacteria 1797
11 rootL2_10114256 3300003322 Bacteria 4261
12 rootL2_10121379 3300003322 Bacteria 3433
13 rootL2_10188514 3300003322 Bacteria 3352
14 rootH1_10048873 3300003323 Bacteria 5046
15 rootH1_10069140 3300003323 Bacteria 4938
16 rootH1_10114082 3300003323 Bacteria 3445
17 rootH1_10117575 3300003323 Bacteria 8177
18 JGI25160J50197_1001449 3300003354 Bacteria 11859
19 Ga0055531_10000061 3300003794 Bacteria 120535
20 Ga0065714_10086018 3300005288 Bacteria 2120
21 Ga0065704_10002530 3300005289 Bacteria 5199
22 Ga0065704_10003015 3300005289 Bacteria 4454
23 Ga0070658_10000340 3300005327 Bacteria 40349
24 Ga0070658_10025860 3300005327 Bacteria 4707
25 Ga0070658_10093217 3300005327 Bacteria 2484
26 Ga0070658_10133009 3300005327 Bacteria 2074
27 Ga0070676_10000474 3300005328 Bacteria 19238
28 Ga0070680_100009468 3300005336 Bacteria 7484
29 Ga0068868_100041639 3300005338 Bacteria 3579
30 Ga0068868_100043049 3300005338 Bacteria 3527
31 Ga0068868_100049543 3300005338 Bacteria 3296
32 Ga0070660_100009269 3300005339 Bacteria 6918
33 Ga0070660_100011814 3300005339 Bacteria 6221
34 Ga0070660_100152718 3300005339 Bacteria 1857
35 Ga0070671_100011572 3300005355 Bacteria 7097
36 Ga0070673_100000361 3300005364 Bacteria 23757
37 Ga0070659_100068344 3300005366 Bacteria 2818
38 Ga0070659_100235840 3300005366 Bacteria 1512
39 Ga0070667_100646310 3300005367 Unclassified 976
40 Ga0070678_100003672 3300005456 Bacteria 8577
41 Ga0070662_100000046 3300005457 Bacteria 67592
42 Ga0070681_10042192 3300005458 Bacteria 4572
43 Ga0068867_100001280 3300005459 Bacteria 17355
44 Ga0070679_100000435 3300005530 Bacteria 35484
45 Ga0070679_100038423 3300005530 Bacteria 4759
46 Ga0070679_100041864 3300005530 Bacteria 4560
47 Ga0070679_100144895 3300005530 Unclassified 2353
48 Ga0068853_100041626 3300005539 Bacteria 3926
49 Ga0070665_100000012 3300005548 Bacteria 508937
50 Ga0070665_100000196 3300005548 Bacteria 106415
51 Ga0068855_100009280 3300005563 Bacteria 11882
52 Ga0068855_100056007 3300005563 Bacteria 4628
53 Ga0068855_100417458 3300005563 Bacteria 1468
54 Ga0068855_100478162 3300005563 Bacteria 1356
55 Ga0068857_100204073 3300005577 Unclassified 1802
56 Ga0068854_100056046 3300005578 Bacteria 2840
57 Ga0068856_100000825 3300005614 Bacteria 33467
58 Ga0068856_100198623 3300005614 Bacteria 2020
59 Ga0068852_100009682 3300005616 Bacteria 7160
60 Ga0068852_100013027 3300005616 Bacteria 6347
61 Ga0068852_100142961 3300005616 Bacteria 2216
62 Ga0068851_10216608 3300005834 Bacteria 1074
63 Ga0068870_10013922 3300005840 Bacteria 3789
64 Ga0068863_100481638 3300005841 Bacteria 1220
65 Ga0068860_100000004 3300005843 Bacteria 506126
66 Ga0075366_10000117 3300006195 Bacteria 32747
67 Ga0097621_100002108 3300006237 Bacteria 13634
68 Ga0068871_100002497 3300006358 Bacteria 12550
69 Ga0068871_100151477 3300006358 Unclassified 1978
70 Ga0068865_100000025 3300006881 Bacteria 94590
71 Ga0105240_10000128 3300009093 Bacteria 156107
72 Ga0105240_10001775 3300009093 Bacteria 36392
73 Ga0105240_10035160 3300009093 Bacteria 6459
74 Ga0105240_10067252 3300009093 Bacteria 4442
75 Ga0105240_10261854 3300009093 Bacteria 1994
76 Ga0105240_10323102 3300009093 Bacteria 1758
77 Ga0105240_10538929 3300009093 Bacteria 1293
78 Ga0105240_10555124 3300009093 Bacteria 1270
79 Ga0105240_10584577 3300009093 Bacteria 1231
80 Ga0105243_10063626 3300009148 Bacteria 2956
81 Ga0105241_10000358 3300009174 Bacteria 34691
82 Ga0105241_10002717 3300009174 Bacteria 13249
83 Ga0105241_10017668 3300009174 Bacteria 5244
84 Ga0105237_10003841 3300009545 Bacteria 17658
85 Ga0105237_10008328 3300009545 Bacteria 11252
86 Ga0105237_10018298 3300009545 Bacteria 7251
87 Ga0105237_10074909 3300009545 Bacteria 3376
88 Ga0105237_10074931 3300009545 Bacteria 3376
89 Ga0105237_10139517 3300009545 Bacteria 2418
90 Ga0105237_10515720 3300009545 Bacteria 1202
91 Ga0105238_10002223 3300009551 Bacteria 19586
92 Ga0105238_10004370 3300009551 Bacteria 14022
93 Ga0105238_10051522 3300009551 Bacteria 4140
94 Ga0105238_10199255 3300009551 Bacteria 1977
95 Ga0105239_10000068 3300010375 Bacteria 144666
96 Ga0105239_10001575 3300010375 Bacteria 30140
97 Ga0105239_10003355 3300010375 Bacteria 19676
98 Ga0105239_10021062 3300010375 Bacteria 7194
99 Ga0105239_10040807 3300010375 Bacteria 5086
100 Ga0105239_10057611 3300010375 Bacteria 4262
101 Ga0105239_10166374 3300010375 Bacteria 2466
102 Ga0105239_10211493 3300010375 Bacteria 2174
103 Ga0157373_10000484 3300013100 Bacteria 31505
104 Ga0157373_10011192 3300013100 Bacteria 6602
105 Ga0157373_10051236 3300013100 Bacteria 2941
106 Ga0157373_10140032 3300013100 Bacteria 1701
107 Ga0157371_10001698 3300013102 Bacteria 22431
108 Ga0157371_10002289 3300013102 Bacteria 18458
109 Ga0157371_10008361 3300013102 Bacteria 8254
110 Ga0157371_10008463 3300013102 Bacteria 8189
111 Ga0157371_10040374 3300013102 Bacteria 3333
112 Ga0157371_10307110 3300013102 Bacteria 1149
113 Ga0157370_10000418 3300013104 Bacteria 53630
114 Ga0157370_10002309 3300013104 Bacteria 23081
115 Ga0157370_10006566 3300013104 Bacteria 12811
116 Ga0157370_10031639 3300013104 Bacteria 5174
117 Ga0157370_10177059 3300013104 Bacteria 1982
118 Ga0157370_10224014 3300013104 Bacteria 1741
119 Ga0157369_10032521 3300013105 Bacteria 5736
120 Ga0157369_10137382 3300013105 Bacteria 2587
121 Ga0157369_10378763 3300013105 Bacteria 1469
122 Ga0157374_10000147 3300013296 Bacteria 63762
123 Ga0157374_10003698 3300013296 Bacteria 12864
124 Ga0157378_10024426 3300013297 Bacteria 5318
125 Ga0163162_10000044 3300013306 Bacteria 128200
126 Ga0163162_10001391 3300013306 Bacteria 22512
127 Ga0163162_10008179 3300013306 Bacteria 10204
128 Ga0163162_10034880 3300013306 Bacteria 5009
129 Ga0163162_10088180 3300013306 Bacteria 3182
130 Ga0157372_10000077 3300013307 Bacteria 102192
131 Ga0157372_10002608 3300013307 Bacteria 19498
132 Ga0157372_10004188 3300013307 Bacteria 15435
133 Ga0157372_10006526 3300013307 Bacteria 12417
134 Ga0157372_10010718 3300013307 Bacteria 9757
135 Ga0157372_10136351 3300013307 Bacteria 2826
136 Ga0157372_10243234 3300013307 Bacteria 2088
137 Ga0157372_10393586 3300013307 Bacteria 1615
138 Ga0157375_10003196 3300013308 Bacteria 14219
139 Ga0157375_10147056 3300013308 Bacteria 2488
140 Ga0182008_10000006 3300014497 Bacteria 378521
141 Ga0157377_10001533 3300014745 Bacteria 10032
142 Ga0182006_1001205 3300015261 Bacteria 16160
143 Ga0163161_10072095 3300017792 Bacteria 2529
144 Ga0209437_100030 3300025233 Bacteria 532466
145 Ga0209129_1008918 3300025258 Bacteria 2714
146 Ga0209233_1012923 3300025261 Bacteria 2403
147 Ga0207426_1000002 3300025302 Bacteria 1249660
148 Ga0209257_1000006 3300025304 Bacteria 1570111
149 Ga0207647_10000027 3300025904 Bacteria 109872
150 Ga0207647_10143242 3300025904 Bacteria 1400
151 Ga0207645_10000300 3300025907 Bacteria 41495
152 Ga0207643_10016223 3300025908 Bacteria 4062
153 Ga0207705_10000111 3300025909 Bacteria 92842
154 Ga0207705_10036227 3300025909 Bacteria 3531
155 Ga0207705_10131860 3300025909 Bacteria 1860
156 Ga0207654_10000894 3300025911 Bacteria 16515
157 Ga0207654_10017508 3300025911 Bacteria 3748
158 Ga0207654_10024016 3300025911 Bacteria 3272
159 Ga0207707_10042027 3300025912 Bacteria 3992
160 Ga0207695_10000179 3300025913 Bacteria 185564
161 Ga0207695_10000892 3300025913 Bacteria 54116
162 Ga0207695_10007613 3300025913 Bacteria 13724
163 Ga0207695_10013006 3300025913 Bacteria 9942
164 Ga0207695_10207948 3300025913 Bacteria 1869
165 Ga0207695_10234659 3300025913 Bacteria 1737
166 Ga0207695_10285826 3300025913 Bacteria 1542
167 Ga0207695_10343084 3300025913 Bacteria 1381
168 Ga0207671_10000112 3300025914 Bacteria 125310
169 Ga0207671_10000478 3300025914 Bacteria 54326
170 Ga0207671_10000634 3300025914 Bacteria 46044
171 Ga0207671_10003656 3300025914 Bacteria 15184
172 Ga0207671_10022338 3300025914 Bacteria 4785
173 Ga0207671_10023527 3300025914 Bacteria 4646
174 Ga0207671_10081234 3300025914 Bacteria 2431
175 Ga0207657_10012609 3300025919 Bacteria 8332
176 Ga0207657_10023493 3300025919 Bacteria 5740
177 Ga0207657_10047843 3300025919 Bacteria 3737
178 Ga0207657_10324303 3300025919 Bacteria 1217
179 Ga0207652_10000606 3300025921 Bacteria 35687
180 Ga0207652_10021943 3300025921 Bacteria 5275
181 Ga0207694_10054542 3300025924 Bacteria 3102
182 Ga0207694_10219697 3300025924 Bacteria 1550
183 Ga0207644_10043318 3300025931 Bacteria 3193
184 Ga0207706_10000010 3300025933 Bacteria 200039
185 Ga0207706_10122591 3300025933 Bacteria 2286
186 Ga0207709_10041451 3300025935 Bacteria 2762
187 Ga0207704_10000016 3300025938 Bacteria 158362
188 Ga0207691_10274394 3300025940 Unclassified 1451
189 Ga0207667_10056180 3300025949 Bacteria 4136
190 Ga0207667_10084882 3300025949 Bacteria 3278
191 Ga0207651_10003516 3300025960 Bacteria 7700
192 Ga0207640_10039764 3300025981 Bacteria 2979
193 Ga0207640_10476953 3300025981 Unclassified 1034
194 Ga0207677_10029581 3300026023 Bacteria 3483
195 Ga0207639_10048326 3300026041 Bacteria 3220
196 Ga0207639_10260764 3300026041 Bacteria 1516
197 Ga0207678_10090010 3300026067 Bacteria 2623
198 Ga0207702_10002499 3300026078 Bacteria 17358
199 Ga0207702_10304271 3300026078 Bacteria 1514
200 Ga0207702_10397385 3300026078 Bacteria 1329
201 Ga0207648_10003384 3300026089 Bacteria 16755
202 Ga0207674_10164322 3300026116 Bacteria 2174
203 Ga0207683_10007636 3300026121 Bacteria 9262
204 Ga0207698_10013311 3300026142 Bacteria 5424
205 Ga0207698_10015612 3300026142 Bacteria 5091
206 Ga0207698_10025243 3300026142 Bacteria 4183
207 Ga0207698_10370179 3300026142 Bacteria 1360
208 Ga0268266_10000080 3300028379 Bacteria 210179
209 Ga0268266_10000327 3300028379 Bacteria 74821
210 Ga0268264_10000011 3300028381 Bacteria 580884
211 Ga0307515_10000299 3300028794 Bacteria 122087
212 Ga0307515_10000712 3300028794 Bacteria 76634
213 Ga0265338_10037321 3300028800 Bacteria 4628
214 Ga0316176_1200406 3300030732 Bacteria 7468
215 Ga0316183_1033841 3300030742 Bacteria 14926
216 Ga0316181_1119930 3300030744 Bacteria 21111
217 Ga0265327_10034506 3300031251 Bacteria 2807
218 Ga0265327_10039453 3300031251 Bacteria 2565
219 Ga0307516_10154680 3300031730 Bacteria 2050
220 Ga0307412_10000029 3300031911 Bacteria 209074
221 Ga0307414_10007194 3300032004 Bacteria 6246
222 Ga0307414_10083897 3300032004 Bacteria 2341
223 Ga0307507_10002432 3300033179 Bacteria 39062
224 Ga0307510_10003306 3300033180 Bacteria 18769
225 Ga0395899_0000011 3300037312 Bacteria 521331
226 Ga0395899_0000257 3300037312 Bacteria 69779
227 Ga0395899_0000534 3300037312 Bacteria 41504
228 Ga0395899_0000845 3300037312 Bacteria 29504
229 Ga0395899_0050528 3300037312 Bacteria 3086
230 Ga0395900_0000151 3300037418 Bacteria 116281
231 Ga0395900_0001520 3300037418 Bacteria 27545
232 Ga0395900_0001900 3300037418 Bacteria 23785
233 Ga0395900_0017305 3300037418 Bacteria 7357
234 Ga0395900_0086812 3300037418 Bacteria 3215
235 Ga0395900_0364371 3300037418 Bacteria 1416
236 Ga0395898_0000688 3300037466 Bacteria 60735
237 Ga0395898_0034902 3300037466 Bacteria 5005
238 Ga0395898_0055638 3300037466 Bacteria 3859
239 Ga0395898_0154191 3300037466 Bacteria 2197
240 Ga0395905_0000526 3300037471 Bacteria 52521
241 Ga0395905_0001935 3300037471 Bacteria 23767
242 Ga0395905_0025895 3300037471 Bacteria 5528
243 Ga0395901_0002093 3300038443 Bacteria 20486
244 Ga0395901_0003603 3300038443 Bacteria 15624
245 Ga0395901_0014688 3300038443 Bacteria 7958
246 Ga0436361_0460219 3300039447 Bacteria 10251
247 Ga0439431_0004264 3300041997 Bacteria 3138
248 Ga0439448_0021463 3300042005 Bacteria 2002
249 Ga0466966_0004915 3300044684 Bacteria 8788
250 Ga0466966_0142354 3300044684 Bacteria 1465
251 Ga0495650_0000098 3300046471 Bacteria 215716
252 Ga0495585_0000029 3300046492 Bacteria 145822
253 Ga0495585_0000092 3300046492 Bacteria 94819
254 Ga0495606_0000021 3300046507 Bacteria 271238
255 Ga0495606_0024362 3300046507 Bacteria 4362
256 Ga0495606_0243941 3300046507 Bacteria 1000
257 Ga0495610_0000347 3300046512 Bacteria 48803
258 Ga0495616_0001094 3300046513 Bacteria 19271
259 Ga0495616_0003779 3300046513 Bacteria 9656
260 Ga0495631_0077990 3300046518 Bacteria 1430
261 Ga0495637_0045251 3300046520 Bacteria 1869
262 Ga0495644_0020637 3300046523 Bacteria 2513
263 Ga0495648_0002147 3300046524 Bacteria 18589
264 Ga0495648_0010099 3300046524 Bacteria 7229
265 Ga0495652_0191184 3300046529 Bacteria 1562
266 Ga0495654_0011715 3300046530 Bacteria 4738
267 Ga0495609_0013260 3300046538 Bacteria 3897
268 Ga0495622_0061030 3300046557 Bacteria 1746
269 Ga0495633_0000004 3300046558 Bacteria 370781
270 Ga0495633_0001478 3300046558 Bacteria 18227
271 Ga0495668_0000058 3300046616 Bacteria 195501
272 Ga0495668_0029559 3300046616 Bacteria 3095
273 Ga0495668_0214380 3300046616 Unclassified 1054
274 Ga0495625_0000314 3300046660 Bacteria 74102
275 Ga0495625_0000649 3300046660 Bacteria 49932
276 Ga0495625_0008165 3300046660 Bacteria 8968
277 Ga0495625_0063679 3300046660 Bacteria 2603
278 Ga0495625_0075704 3300046660 Bacteria 2354
279 Ga0495661_0015546 3300046665 Bacteria 5078
280 Ga0495649_0000007 3300046694 Bacteria 518037
281 Ga0495660_0044085 3300046810 Bacteria 2456
282 Ga0495687_000385 3300047443 Bacteria 54684
283 Ga0495687_002893 3300047443 Bacteria 13105
284 Ga0495673_0082304 3300047469 Bacteria 1331
285 Ga0496126_0383917 3300048929 Unclassified 1143
286 Ga0495678_002804 3300049459 Bacteria 11326
287 Ga0495682_0009861 3300049460 Bacteria 3718
288 Ga0501036_0689111 3300049572 Bacteria 845
289 Ga0501069_0132226 3300049585 Bacteria 1429
290 Ga0501241_009910 3300049758 Bacteria 1732
291 nmdc:mga0k408_49_c2 3300050493 Bacteria 55012
292 Ga0500583_0016614 3300053092 Bacteria 2942
293 Ga0500651_0000256 3300053093 Bacteria 32006
294 Ga0500608_000607 3300053122 Bacteria 13192
295 Ga0500608_007942 3300053122 Bacteria 4424
296 Ga0500618_000006 3300053125 Bacteria 239188
297 Ga0500618_020259 3300053125 Bacteria 1630
298 Ga0500642_0135724 3300053130 Bacteria 1153
299 Ga0500568_0010292 3300053139 Bacteria 4388
300 Ga0500622_0002737 3300053156 Bacteria 12445
301 Ga0500624_000262 3300053157 Bacteria 18417

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2896109856 2896111200 261
2 3300049572 Ga0501036_0689111 Ga0501036_0689111_12_830 262
3 3300025914 Ga0207671_10003656 Ga0207671_1000365612 263
4 3300026142 Ga0207698_10013311 Ga0207698_100133112 263
5 3300005548 Ga0070665_100000196 Ga0070665_10000019628 265
6 3300028379 Ga0268266_10000327 Ga0268266_1000032744 265
7 3300003322 rootL2_10188514 rootL2_101885142 267
8 3300009093 Ga0105240_10538929 Ga0105240_105389291 267
9 3300009093 Ga0105240_10555124 Ga0105240_105551242 267
10 3300009545 Ga0105237_10018298 Ga0105237_100182982 267
11 3300025913 Ga0207695_10234659 Ga0207695_102346592 267
12 3300025914 Ga0207671_10000478 Ga0207671_100004785 267
13 3300053130 Ga0500642_0135724 Ga0500642_0135724_170_991 267
14 iso_pu_bacteria 2775506987 2776612271 267
15 iso_pu_bacteria 2898713307 2898714639 267
16 3300003794 Ga0055531_10000061 Ga0055531_1000006158 268
17 3300025304 Ga0209257_1000006 Ga0209257_1000006196 268
18 3300031251 Ga0265327_10039453 Ga0265327_100394533 269
19 iso_pu_bacteria 2599185184 2599481306 269
20 iso_pu_bacteria 2896085136 2896089789 269
21 iso_pu_bacteria 2919186247 2919188018 269
22 iso_pu_bacteria 2919437846 2919439956 269
23 iso_pu_bacteria 2928078545 2928081906 269
24 iso_pu_bacteria 2928147474 2928151925 269
25 iso_pu_bacteria 2932082852 2932088116 269
26 iso_pu_bacteria 2939664404 2939664715 269
27 3300005289 Ga0065704_10002530 Ga0065704_100025305 270
28 3300005289 Ga0065704_10003015 Ga0065704_100030154 270
29 3300005327 Ga0070658_10133009 Ga0070658_101330092 270
30 3300005339 Ga0070660_100011814 Ga0070660_1000118143 270
31 3300005834 Ga0068851_10216608 Ga0068851_102166081 270
32 3300006358 Ga0068871_100151477 Ga0068871_1001514771 270
33 3300013100 Ga0157373_10011192 Ga0157373_100111925 270
34 3300013102 Ga0157371_10001698 Ga0157371_100016989 270
35 3300013102 Ga0157371_10008463 Ga0157371_100084634 270
36 3300013104 Ga0157370_10000418 Ga0157370_100004184 270
37 3300013104 Ga0157370_10006566 Ga0157370_100065667 270
38 3300013104 Ga0157370_10177059 Ga0157370_101770591 270
39 3300014497 Ga0182008_10000006 Ga0182008_10000006137 270
40 3300015261 Ga0182006_1001205 Ga0182006_100120514 270
41 3300025919 Ga0207657_10023493 Ga0207657_100234933 270
42 3300025940 Ga0207691_10274394 Ga0207691_102743941 270
43 3300028800 Ga0265338_10037321 Ga0265338_100373214 270
44 3300031251 Ga0265327_10034506 Ga0265327_100345062 270
45 3300031730 Ga0307516_10154680 Ga0307516_101546802 270
46 3300031911 Ga0307412_10000029 Ga0307412_1000002945 270
47 3300032004 Ga0307414_10007194 Ga0307414_100071941 270
48 3300032004 Ga0307414_10083897 Ga0307414_100838972 270
49 3300049758 Ga0501241_009910 Ga0501241_009910_422_1237 270
50 3300053093 Ga0500651_0000256 Ga0500651_0000256_30273_31088 270
51 3300049585 Ga0501069_0132226 Ga0501069_0132226_390_1208 271
52 3300001915 JGI24741J21665_1012409 JGI24741J21665_10124092 272
53 3300001979 JGI24740J21852_10005935 JGI24740J21852_100059352 272
54 3300001990 JGI24737J22298_10000628 JGI24737J22298_100006281 272
55 3300002067 JGI24735J21928_10000031 JGI24735J21928_1000003178 272
56 3300003316 rootH1_10030138 rootH1_100301381 272
57 3300003320 rootH2_10007197 rootH2_10007197135 272
58 3300003320 rootH2_10084556 rootH2_100845562 272
59 3300003320 rootH2_10095015 rootH2_100950153 272
60 3300003320 rootH2_10098509 rootH2_100985091 272
61 3300003320 rootH2_10098510 rootH2_100985101 272
62 3300003322 rootL2_10114256 rootL2_101142562 272
63 3300003322 rootL2_10121379 rootL2_101213793 272
64 3300003323 rootH1_10048873 rootH1_100488732 272
65 3300003323 rootH1_10069140 rootH1_100691404 272
66 3300003323 rootH1_10114082 rootH1_101140823 272
67 3300003323 rootH1_10117575 rootH1_101175754 272
68 3300003354 JGI25160J50197_1001449 JGI25160J50197_10014497 272
69 3300005288 Ga0065714_10086018 Ga0065714_100860182 272
70 3300005327 Ga0070658_10000340 Ga0070658_1000034030 272
71 3300005327 Ga0070658_10025860 Ga0070658_100258603 272
72 3300005327 Ga0070658_10093217 Ga0070658_100932172 272
73 3300005328 Ga0070676_10000474 Ga0070676_1000047412 272
74 3300005336 Ga0070680_100009468 Ga0070680_1000094682 272
75 3300005338 Ga0068868_100041639 Ga0068868_1000416392 272
76 3300005338 Ga0068868_100043049 Ga0068868_1000430493 272
77 3300005338 Ga0068868_100049543 Ga0068868_1000495432 272
78 3300005339 Ga0070660_100009269 Ga0070660_1000092696 272
79 3300005339 Ga0070660_100152718 Ga0070660_1001527182 272
80 3300005355 Ga0070671_100011572 Ga0070671_1000115724 272
81 3300005364 Ga0070673_100000361 Ga0070673_1000003614 272
82 3300005366 Ga0070659_100068344 Ga0070659_1000683443 272
83 3300005366 Ga0070659_100235840 Ga0070659_1002358402 272
84 3300005367 Ga0070667_100646310 Ga0070667_1006463101 272
85 3300005456 Ga0070678_100003672 Ga0070678_1000036726 272
86 3300005457 Ga0070662_100000046 Ga0070662_10000004636 272
87 3300005458 Ga0070681_10042192 Ga0070681_100421924 272
88 3300005459 Ga0068867_100001280 Ga0068867_1000012806 272
89 3300005530 Ga0070679_100000435 Ga0070679_10000043514 272
90 3300005530 Ga0070679_100038423 Ga0070679_1000384234 272
91 3300005530 Ga0070679_100041864 Ga0070679_1000418643 272
92 3300005530 Ga0070679_100144895 Ga0070679_1001448952 272
93 3300005539 Ga0068853_100041626 Ga0068853_1000416263 272
94 3300005548 Ga0070665_100000012 Ga0070665_10000001226 272
95 3300005563 Ga0068855_100009280 Ga0068855_1000092802 272
96 3300005563 Ga0068855_100056007 Ga0068855_1000560073 272
97 3300005563 Ga0068855_100417458 Ga0068855_1004174581 272
98 3300005563 Ga0068855_100478162 Ga0068855_1004781622 272
99 3300005577 Ga0068857_100204073 Ga0068857_1002040732 272
100 3300005578 Ga0068854_100056046 Ga0068854_1000560462 272
101 3300005614 Ga0068856_100000825 Ga0068856_10000082520 272
102 3300005614 Ga0068856_100198623 Ga0068856_1001986232 272
103 3300005616 Ga0068852_100009682 Ga0068852_1000096823 272
104 3300005616 Ga0068852_100013027 Ga0068852_1000130272 272
105 3300005616 Ga0068852_100142961 Ga0068852_1001429612 272
106 3300005840 Ga0068870_10013922 Ga0068870_100139222 272
107 3300005841 Ga0068863_100481638 Ga0068863_1004816382 272
108 3300005843 Ga0068860_100000004 Ga0068860_100000004235 272
109 3300006195 Ga0075366_10000117 Ga0075366_1000011725 272
110 3300006237 Ga0097621_100002108 Ga0097621_1000021089 272
111 3300006358 Ga0068871_100002497 Ga0068871_1000024979 272
112 3300006881 Ga0068865_100000025 Ga0068865_10000002513 272
113 3300009093 Ga0105240_10000128 Ga0105240_1000012816 272
114 3300009093 Ga0105240_10001775 Ga0105240_100017755 272
115 3300009093 Ga0105240_10035160 Ga0105240_100351605 272
116 3300009093 Ga0105240_10067252 Ga0105240_100672524 272
117 3300009093 Ga0105240_10261854 Ga0105240_102618542 272
118 3300009093 Ga0105240_10323102 Ga0105240_103231022 272
119 3300009093 Ga0105240_10584577 Ga0105240_105845772 272
120 3300009148 Ga0105243_10063626 Ga0105243_100636263 272
121 3300009174 Ga0105241_10000358 Ga0105241_100003588 272
122 3300009174 Ga0105241_10002717 Ga0105241_100027174 272
123 3300009174 Ga0105241_10017668 Ga0105241_100176682 272
124 3300009545 Ga0105237_10003841 Ga0105237_100038418 272
125 3300009545 Ga0105237_10008328 Ga0105237_100083283 272
126 3300009545 Ga0105237_10074909 Ga0105237_100749092 272
127 3300009545 Ga0105237_10074931 Ga0105237_100749312 272
128 3300009545 Ga0105237_10139517 Ga0105237_101395172 272
129 3300009545 Ga0105237_10515720 Ga0105237_105157201 272
130 3300009551 Ga0105238_10002223 Ga0105238_1000222312 272
131 3300009551 Ga0105238_10004370 Ga0105238_100043703 272
132 3300009551 Ga0105238_10051522 Ga0105238_100515224 272
133 3300009551 Ga0105238_10199255 Ga0105238_101992551 272
134 3300010375 Ga0105239_10000068 Ga0105239_100000689 272
135 3300010375 Ga0105239_10001575 Ga0105239_1000157515 272
136 3300010375 Ga0105239_10003355 Ga0105239_100033552 272
137 3300010375 Ga0105239_10021062 Ga0105239_100210624 272
138 3300010375 Ga0105239_10040807 Ga0105239_100408074 272
139 3300010375 Ga0105239_10057611 Ga0105239_100576113 272
140 3300010375 Ga0105239_10166374 Ga0105239_101663743 272
141 3300010375 Ga0105239_10211493 Ga0105239_102114932 272
142 3300013100 Ga0157373_10000484 Ga0157373_1000048427 272
143 3300013100 Ga0157373_10051236 Ga0157373_100512363 272
144 3300013100 Ga0157373_10140032 Ga0157373_101400322 272
145 3300013102 Ga0157371_10002289 Ga0157371_100022896 272
146 3300013102 Ga0157371_10008361 Ga0157371_100083612 272
147 3300013102 Ga0157371_10040374 Ga0157371_100403743 272
148 3300013102 Ga0157371_10307110 Ga0157371_103071101 272
149 3300013104 Ga0157370_10002309 Ga0157370_1000230916 272
150 3300013104 Ga0157370_10031639 Ga0157370_100316393 272
151 3300013104 Ga0157370_10224014 Ga0157370_102240141 272
152 3300013105 Ga0157369_10032521 Ga0157369_100325212 272
153 3300013105 Ga0157369_10137382 Ga0157369_101373821 272
154 3300013105 Ga0157369_10378763 Ga0157369_103787632 272
155 3300013296 Ga0157374_10000147 Ga0157374_1000014751 272
156 3300013296 Ga0157374_10003698 Ga0157374_1000369812 272
157 3300013297 Ga0157378_10024426 Ga0157378_100244261 272
158 3300013306 Ga0163162_10000044 Ga0163162_10000044116 272
159 3300013306 Ga0163162_10001391 Ga0163162_100013916 272
160 3300013306 Ga0163162_10008179 Ga0163162_100081798 272
161 3300013306 Ga0163162_10034880 Ga0163162_100348804 272
162 3300013306 Ga0163162_10088180 Ga0163162_100881802 272
163 3300013307 Ga0157372_10000077 Ga0157372_100000771 272
164 3300013307 Ga0157372_10002608 Ga0157372_100026088 272
165 3300013307 Ga0157372_10004188 Ga0157372_100041882 272
166 3300013307 Ga0157372_10006526 Ga0157372_100065264 272
167 3300013307 Ga0157372_10010718 Ga0157372_100107186 272
168 3300013307 Ga0157372_10136351 Ga0157372_101363513 272
169 3300013307 Ga0157372_10243234 Ga0157372_102432342 272
170 3300013307 Ga0157372_10393586 Ga0157372_103935862 272
171 3300013308 Ga0157375_10003196 Ga0157375_1000319612 272
172 3300013308 Ga0157375_10147056 Ga0157375_101470562 272
173 3300014745 Ga0157377_10001533 Ga0157377_100015338 272
174 3300017792 Ga0163161_10072095 Ga0163161_100720952 272
175 3300025233 Ga0209437_100030 Ga0209437_100030113 272
176 3300025258 Ga0209129_1008918 Ga0209129_10089182 272
177 3300025261 Ga0209233_1012923 Ga0209233_10129231 272
178 3300025302 Ga0207426_1000002 Ga0207426_100000290 272
179 3300025904 Ga0207647_10000027 Ga0207647_1000002750 272
180 3300025904 Ga0207647_10143242 Ga0207647_101432422 272
181 3300025907 Ga0207645_10000300 Ga0207645_1000030014 272
182 3300025908 Ga0207643_10016223 Ga0207643_100162233 272
183 3300025909 Ga0207705_10000111 Ga0207705_1000011114 272
184 3300025909 Ga0207705_10036227 Ga0207705_100362273 272
185 3300025909 Ga0207705_10131860 Ga0207705_101318602 272
186 3300025911 Ga0207654_10000894 Ga0207654_100008943 272
187 3300025911 Ga0207654_10017508 Ga0207654_100175084 272
188 3300025911 Ga0207654_10024016 Ga0207654_100240163 272
189 3300025912 Ga0207707_10042027 Ga0207707_100420273 272
190 3300025913 Ga0207695_10000179 Ga0207695_10000179165 272
191 3300025913 Ga0207695_10000892 Ga0207695_1000089224 272
192 3300025913 Ga0207695_10007613 Ga0207695_100076133 272
193 3300025913 Ga0207695_10013006 Ga0207695_100130069 272
194 3300025913 Ga0207695_10207948 Ga0207695_102079482 272
195 3300025913 Ga0207695_10285826 Ga0207695_102858262 272
196 3300025913 Ga0207695_10343084 Ga0207695_103430842 272
197 3300025914 Ga0207671_10000112 Ga0207671_100001128 272
198 3300025914 Ga0207671_10000634 Ga0207671_100006345 272
199 3300025914 Ga0207671_10022338 Ga0207671_100223384 272
200 3300025914 Ga0207671_10023527 Ga0207671_100235272 272
201 3300025914 Ga0207671_10081234 Ga0207671_100812343 272
202 3300025919 Ga0207657_10012609 Ga0207657_100126096 272
203 3300025919 Ga0207657_10047843 Ga0207657_100478433 272
204 3300025919 Ga0207657_10324303 Ga0207657_103243031 272
205 3300025921 Ga0207652_10000606 Ga0207652_1000060618 272
206 3300025921 Ga0207652_10021943 Ga0207652_100219433 272
207 3300025924 Ga0207694_10054542 Ga0207694_100545423 272
208 3300025924 Ga0207694_10219697 Ga0207694_102196972 272
209 3300025931 Ga0207644_10043318 Ga0207644_100433183 272
210 3300025933 Ga0207706_10000010 Ga0207706_10000010124 272
211 3300025933 Ga0207706_10122591 Ga0207706_101225912 272
212 3300025935 Ga0207709_10041451 Ga0207709_100414512 272
213 3300025938 Ga0207704_10000016 Ga0207704_1000001648 272
214 3300025949 Ga0207667_10056180 Ga0207667_100561803 272
215 3300025949 Ga0207667_10084882 Ga0207667_100848824 272
216 3300025960 Ga0207651_10003516 Ga0207651_100035163 272
217 3300025981 Ga0207640_10039764 Ga0207640_100397641 272
218 3300025981 Ga0207640_10476953 Ga0207640_104769531 272
219 3300026023 Ga0207677_10029581 Ga0207677_100295813 272
220 3300026041 Ga0207639_10048326 Ga0207639_100483263 272
221 3300026041 Ga0207639_10260764 Ga0207639_102607642 272
222 3300026067 Ga0207678_10090010 Ga0207678_100900101 272
223 3300026078 Ga0207702_10002499 Ga0207702_100024995 272
224 3300026078 Ga0207702_10304271 Ga0207702_103042711 272
225 3300026078 Ga0207702_10397385 Ga0207702_103973852 272
226 3300026089 Ga0207648_10003384 Ga0207648_100033849 272
227 3300026116 Ga0207674_10164322 Ga0207674_101643223 272
228 3300026121 Ga0207683_10007636 Ga0207683_100076364 272
229 3300026142 Ga0207698_10015612 Ga0207698_100156124 272
230 3300026142 Ga0207698_10025243 Ga0207698_100252433 272
231 3300026142 Ga0207698_10370179 Ga0207698_103701792 272
232 3300028379 Ga0268266_10000080 Ga0268266_1000008025 272
233 3300028381 Ga0268264_10000011 Ga0268264_10000011131 272
234 3300028794 Ga0307515_10000299 Ga0307515_1000029931 272
235 3300028794 Ga0307515_10000712 Ga0307515_1000071265 272
236 3300030732 Ga0316176_1200406 Ga0316176_12004063 272
237 3300030742 Ga0316183_1033841 Ga0316183_10338417 272
238 3300030744 Ga0316181_1119930 Ga0316181_111993013 272
239 3300033179 Ga0307507_10002432 Ga0307507_1000243224 272
240 3300033180 Ga0307510_10003306 Ga0307510_100033065 272
241 3300037312 Ga0395899_0000011 Ga0395899_0000011_364121_364942 272
242 3300037312 Ga0395899_0000257 Ga0395899_0000257_68742_69560 272
243 3300037312 Ga0395899_0000534 Ga0395899_0000534_15562_16380 272
244 3300037312 Ga0395899_0000845 Ga0395899_0000845_9969_10790 272
245 3300037312 Ga0395899_0050528 Ga0395899_0050528_694_1515 272
246 3300037418 Ga0395900_0000151 Ga0395900_0000151_64994_65815 272
247 3300037418 Ga0395900_0001520 Ga0395900_0001520_13628_14449 272
248 3300037418 Ga0395900_0001900 Ga0395900_0001900_11269_12087 272
249 3300037418 Ga0395900_0017305 Ga0395900_0017305_2253_3074 272
250 3300037418 Ga0395900_0086812 Ga0395900_0086812_1177_1998 272
251 3300037418 Ga0395900_0364371 Ga0395900_0364371_385_1203 272
252 3300037466 Ga0395898_0000688 Ga0395898_0000688_33912_34733 272
253 3300037466 Ga0395898_0034902 Ga0395898_0034902_3604_4422 272
254 3300037466 Ga0395898_0055638 Ga0395898_0055638_637_1458 272
255 3300037466 Ga0395898_0154191 Ga0395898_0154191_85_906 272
256 3300037471 Ga0395905_0000526 Ga0395905_0000526_18335_19156 272
257 3300037471 Ga0395905_0001935 Ga0395905_0001935_10954_11772 272
258 3300037471 Ga0395905_0025895 Ga0395905_0025895_2717_3538 272
259 3300038443 Ga0395901_0002093 Ga0395901_0002093_6238_7059 272
260 3300038443 Ga0395901_0003603 Ga0395901_0003603_11529_12350 272
261 3300038443 Ga0395901_0014688 Ga0395901_0014688_1122_1940 272
262 3300039447 Ga0436361_0460219 Ga0436361_0460219_5145_5963 272
263 3300041997 Ga0439431_0004264 Ga0439431_0004264_1246_2067 272
264 3300042005 Ga0439448_0021463 Ga0439448_0021463_1145_1963 272
265 3300044684 Ga0466966_0004915 Ga0466966_0004915_421_1239 272
266 3300044684 Ga0466966_0142354 Ga0466966_0142354_335_1156 272
267 3300046471 Ga0495650_0000098 Ga0495650_0000098_149_970 272
268 3300046492 Ga0495585_0000029 Ga0495585_0000029_118686_119507 272
269 3300046492 Ga0495585_0000092 Ga0495585_0000092_36266_37087 272
270 3300046507 Ga0495606_0000021 Ga0495606_0000021_45448_46269 272
271 3300046507 Ga0495606_0024362 Ga0495606_0024362_1797_2618 272
272 3300046507 Ga0495606_0243941 Ga0495606_0243941_103_924 272
273 3300046512 Ga0495610_0000347 Ga0495610_0000347_28416_29237 272
274 3300046513 Ga0495616_0001094 Ga0495616_0001094_17725_18546 272
275 3300046513 Ga0495616_0003779 Ga0495616_0003779_1258_2079 272
276 3300046518 Ga0495631_0077990 Ga0495631_0077990_47_868 272
277 3300046520 Ga0495637_0045251 Ga0495637_0045251_471_1292 272
278 3300046523 Ga0495644_0020637 Ga0495644_0020637_194_1015 272
279 3300046524 Ga0495648_0002147 Ga0495648_0002147_17038_17856 272
280 3300046524 Ga0495648_0010099 Ga0495648_0010099_1058_1879 272
281 3300046529 Ga0495652_0191184 Ga0495652_0191184_387_1208 272
282 3300046530 Ga0495654_0011715 Ga0495654_0011715_2919_3740 272
283 3300046538 Ga0495609_0013260 Ga0495609_0013260_2978_3799 272
284 3300046557 Ga0495622_0061030 Ga0495622_0061030_387_1208 272
285 3300046558 Ga0495633_0000004 Ga0495633_0000004_115430_116251 272
286 3300046558 Ga0495633_0001478 Ga0495633_0001478_15879_16700 272
287 3300046616 Ga0495668_0000058 Ga0495668_0000058_185730_186551 272
288 3300046616 Ga0495668_0029559 Ga0495668_0029559_1684_2505 272
289 3300046616 Ga0495668_0214380 Ga0495668_0214380_81_902 272
290 3300046660 Ga0495625_0000314 Ga0495625_0000314_33361_34182 272
291 3300046660 Ga0495625_0000649 Ga0495625_0000649_11273_12094 272
292 3300046660 Ga0495625_0008165 Ga0495625_0008165_1356_2177 272
293 3300046660 Ga0495625_0063679 Ga0495625_0063679_1054_1875 272
294 3300046660 Ga0495625_0075704 Ga0495625_0075704_480_1301 272
295 3300046665 Ga0495661_0015546 Ga0495661_0015546_1763_2584 272
296 3300046694 Ga0495649_0000007 Ga0495649_0000007_474545_475366 272
297 3300046810 Ga0495660_0044085 Ga0495660_0044085_68_889 272
298 3300047443 Ga0495687_000385 Ga0495687_000385_4050_4871 272
299 3300047443 Ga0495687_002893 Ga0495687_002893_12121_12939 272
300 3300047469 Ga0495673_0082304 Ga0495673_0082304_61_882 272
301 3300048929 Ga0496126_0383917 Ga0496126_0383917_174_992 272
302 3300049459 Ga0495678_002804 Ga0495678_002804_3855_4676 272
303 3300049460 Ga0495682_0009861 Ga0495682_0009861_1731_2552 272
304 3300050493 nmdc:mga0k408_49_c2 nmdc:mga0k408_49_c2_12384_13205 272
305 3300053092 Ga0500583_0016614 Ga0500583_0016614_2089_2907 272
306 3300053122 Ga0500608_000607 Ga0500608_000607_3450_4268 272
307 3300053122 Ga0500608_007942 Ga0500608_007942_1894_2715 272
308 3300053125 Ga0500618_000006 Ga0500618_000006_152334_153155 272
309 3300053125 Ga0500618_020259 Ga0500618_020259_268_1089 272
310 3300053139 Ga0500568_0010292 Ga0500568_0010292_1779_2597 272
311 3300053156 Ga0500622_0002737 Ga0500622_0002737_3287_4105 272
312 3300053157 Ga0500624_000262 Ga0500624_000262_5432_6253 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

71

273

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ep9-assembly4.cif.gz_D crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.8529 19 272
5ep9-assembly4.cif.gz_D crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.8298 19 272
7dt0-assembly3.cif.gz_C proline hydroxylase h11-n101i mutant 0.826 15 233
5ep9-assembly3.cif.gz_C crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.8258 19 272
5epa-assembly6.cif.gz_F crystal structure of non-heme alpha ketoglutarate dependent carbocyclase snok from nogalamycin biosynthesis 0.8244 6 270
ID Description Score Start End Superfamily
5ep9C00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8258 19 272 2.60.120.620
5epaF00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8244 6 270 2.60.120.620
af_A8E5P7_122_256_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8167 122 240 2.60.120.620
5epaF00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8122 6 270 2.60.120.620
af_C7FZX0_9_206_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8104 54 231 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A3N7HA42-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9947 4 272 GO:0051213
AF-A0A317GWP3-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9901 1 272 GO:0051213
AF-A0A4Q3DEH3-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9883 55 272 GO:0051213
AF-A0A068NRC0-F1-model_v4 SnoK-like protein 0.9882 3 271
AF-A0A2D6BU56-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9877 7 271 GO:0051213

Feature Viewer

pLDDT pTM Quality
92.54 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map