F401693
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 312 | 188 | 312 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10061687|Ga0105239_100616873 |
| Length | 207 |
| Sequence | MLKTLRQIVSIGIVTEPPPSADETLRMRERPGDPGASTAALRARLDERIRIVLGRALCIRHIDAGSCNGCELEIQALNNPIYNLEGLGIRFVASPRHADLLLVTGPVSRHMEVALRRTYEATPDPKLVVALGDCGCTGGIFGESYASRGRVSEVIPVDVAIPGCPPSPTRILQGILTALSASPAKNVARDLPSTAAPTASDSVAPRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 126 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 127 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 130 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 132 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 133 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 134 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 135 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 136 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 139 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 140 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 141 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 142 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 143 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 144 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 145 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 146 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 147 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 148 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 154 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 155 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 156 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 161 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 162 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 176 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 177 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 182 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 183 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 184 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 185 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 186 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 187 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.92 |
| Nodule | 0 |
| Rhizoplane | 2.24 |
| Rhizosphere | 94.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10436918 | 3300005295 | Bacteria | 814 |
| 2 | Ga0070658_10027226 | 3300005327 | Bacteria | 4589 |
| 3 | Ga0070683_100002653 | 3300005329 | Bacteria | 14305 |
| 4 | Ga0070683_100077527 | 3300005329 | Unclassified | 3108 |
| 5 | Ga0070683_100081484 | 3300005329 | Bacteria | 3030 |
| 6 | Ga0070683_100092836 | 3300005329 | Bacteria | 2835 |
| 7 | Ga0070683_100369576 | 3300005329 | Bacteria | 1366 |
| 8 | Ga0070670_100046058 | 3300005331 | Bacteria | 3750 |
| 9 | Ga0070677_10080657 | 3300005333 | Bacteria | 1391 |
| 10 | Ga0068869_100016970 | 3300005334 | Bacteria | 4924 |
| 11 | Ga0070666_10042346 | 3300005335 | Unclassified | 3046 |
| 12 | Ga0070680_100002400 | 3300005336 | Bacteria | 13868 |
| 13 | Ga0070680_100027729 | 3300005336 | Bacteria | 4537 |
| 14 | Ga0070680_100495480 | 3300005336 | Bacteria | 1045 |
| 15 | Ga0070680_100511333 | 3300005336 | Bacteria | 1028 |
| 16 | Ga0068868_100081556 | 3300005338 | Bacteria | 2593 |
| 17 | Ga0068868_100081703 | 3300005338 | Unclassified | 2591 |
| 18 | Ga0070660_100001007 | 3300005339 | Bacteria | 18914 |
| 19 | Ga0070660_100379302 | 3300005339 | Unclassified | 1167 |
| 20 | Ga0070661_100000558 | 3300005344 | Bacteria | 28462 |
| 21 | Ga0070661_100890481 | 3300005344 | Unclassified | 734 |
| 22 | Ga0070692_10106281 | 3300005345 | Bacteria | 1546 |
| 23 | Ga0070668_100136713 | 3300005347 | Unclassified | 1972 |
| 24 | Ga0070675_100328139 | 3300005354 | Unclassified | 1353 |
| 25 | Ga0070667_100232980 | 3300005367 | Unclassified | 1642 |
| 26 | Ga0070713_100051630 | 3300005436 | Bacteria | 3401 |
| 27 | Ga0070713_100128057 | 3300005436 | Bacteria | 2236 |
| 28 | Ga0070711_100428074 | 3300005439 | Bacteria | 1080 |
| 29 | Ga0070694_100410349 | 3300005444 | Bacteria | 1062 |
| 30 | Ga0070678_100063803 | 3300005456 | Unclassified | 2727 |
| 31 | Ga0070678_101006503 | 3300005456 | Bacteria | 766 |
| 32 | Ga0070662_100024935 | 3300005457 | Unclassified | 4126 |
| 33 | Ga0070681_10011416 | 3300005458 | Bacteria | 8792 |
| 34 | Ga0070681_10011526 | 3300005458 | Bacteria | 8750 |
| 35 | Ga0070681_10094207 | 3300005458 | Bacteria | 2943 |
| 36 | Ga0070681_10102224 | 3300005458 | Bacteria | 2811 |
| 37 | Ga0070681_10258551 | 3300005458 | Bacteria | 1653 |
| 38 | Ga0070681_10268525 | 3300005458 | Bacteria | 1617 |
| 39 | Ga0070699_100063380 | 3300005518 | Bacteria | 3205 |
| 40 | Ga0070699_101093880 | 3300005518 | Bacteria | 731 |
| 41 | Ga0070679_100000289 | 3300005530 | Bacteria | 42702 |
| 42 | Ga0070679_100030866 | 3300005530 | Bacteria | 5295 |
| 43 | Ga0070679_100127755 | 3300005530 | Bacteria | 2524 |
| 44 | Ga0070679_100181923 | 3300005530 | Bacteria | 2074 |
| 45 | Ga0070679_100368793 | 3300005530 | Bacteria | 1383 |
| 46 | Ga0070684_100031600 | 3300005535 | Bacteria | 4509 |
| 47 | Ga0070684_100041571 | 3300005535 | Unclassified | 3964 |
| 48 | Ga0068853_100079563 | 3300005539 | Unclassified | 2866 |
| 49 | Ga0070672_100010784 | 3300005543 | Bacteria | 6350 |
| 50 | Ga0070695_100120736 | 3300005545 | Bacteria | 1792 |
| 51 | Ga0070696_100463367 | 3300005546 | Bacteria | 1002 |
| 52 | Ga0070665_100106460 | 3300005548 | Unclassified | 2806 |
| 53 | Ga0068855_100010788 | 3300005563 | Bacteria | 11029 |
| 54 | Ga0068855_100029363 | 3300005563 | Bacteria | 6575 |
| 55 | Ga0068855_100037860 | 3300005563 | Bacteria | 5732 |
| 56 | Ga0068855_100115859 | 3300005563 | Bacteria | 3071 |
| 57 | Ga0068855_100383397 | 3300005563 | Bacteria | 1543 |
| 58 | Ga0068855_100422988 | 3300005563 | Bacteria | 1457 |
| 59 | Ga0068855_100464987 | 3300005563 | Unclassified | 1379 |
| 60 | Ga0068855_100556752 | 3300005563 | Unclassified | 1241 |
| 61 | Ga0068855_100888572 | 3300005563 | Bacteria | 942 |
| 62 | Ga0070664_100000031 | 3300005564 | Bacteria | 88513 |
| 63 | Ga0070664_100136424 | 3300005564 | Unclassified | 2158 |
| 64 | Ga0068857_100112449 | 3300005577 | Bacteria | 2448 |
| 65 | Ga0068857_100180185 | 3300005577 | Bacteria | 1923 |
| 66 | Ga0068854_100105007 | 3300005578 | Bacteria | 2123 |
| 67 | Ga0068856_100006935 | 3300005614 | Bacteria | 11082 |
| 68 | Ga0068856_100954449 | 3300005614 | Bacteria | 876 |
| 69 | Ga0068852_100000419 | 3300005616 | Bacteria | 28349 |
| 70 | Ga0068852_100004388 | 3300005616 | Bacteria | 9969 |
| 71 | Ga0068852_100228912 | 3300005616 | Unclassified | 1771 |
| 72 | Ga0068852_100254661 | 3300005616 | Bacteria | 1683 |
| 73 | Ga0068864_100113933 | 3300005618 | Unclassified | 2411 |
| 74 | Ga0068866_10016342 | 3300005718 | Unclassified | 3317 |
| 75 | Ga0068861_100008740 | 3300005719 | Bacteria | 6971 |
| 76 | Ga0068851_10192018 | 3300005834 | Unclassified | 1136 |
| 77 | Ga0068870_10005393 | 3300005840 | Bacteria | 5582 |
| 78 | Ga0068863_100247459 | 3300005841 | Unclassified | 1721 |
| 79 | Ga0068858_100083390 | 3300005842 | Unclassified | 2972 |
| 80 | Ga0068858_100460839 | 3300005842 | Bacteria | 1226 |
| 81 | Ga0068862_100003806 | 3300005844 | Bacteria | 12852 |
| 82 | Ga0068862_100157739 | 3300005844 | Bacteria | 2024 |
| 83 | Ga0070716_100097098 | 3300006173 | Bacteria | 1797 |
| 84 | Ga0097621_100229386 | 3300006237 | Unclassified | 1621 |
| 85 | Ga0097621_100409053 | 3300006237 | Bacteria | 1216 |
| 86 | Ga0068871_100083438 | 3300006358 | Unclassified | 2650 |
| 87 | Ga0075428_100058770 | 3300006844 | Bacteria | 4210 |
| 88 | Ga0075430_100033935 | 3300006846 | Bacteria | 4330 |
| 89 | Ga0075431_100009013 | 3300006847 | Bacteria | 10003 |
| 90 | Ga0075429_100113295 | 3300006880 | Bacteria | 2371 |
| 91 | Ga0105240_10000313 | 3300009093 | Bacteria | 93046 |
| 92 | Ga0105240_10001599 | 3300009093 | Bacteria | 38474 |
| 93 | Ga0105240_10003744 | 3300009093 | Bacteria | 23493 |
| 94 | Ga0105240_10055209 | 3300009093 | Bacteria | 4974 |
| 95 | Ga0105240_10370367 | 3300009093 | Unclassified | 1620 |
| 96 | Ga0105240_10445422 | 3300009093 | Bacteria | 1450 |
| 97 | Ga0105240_10604207 | 3300009093 | Bacteria | 1207 |
| 98 | Ga0111539_10073356 | 3300009094 | Bacteria | 4036 |
| 99 | Ga0105245_10119710 | 3300009098 | Unclassified | 2458 |
| 100 | Ga0105247_10008699 | 3300009101 | Bacteria | 6189 |
| 101 | Ga0105247_10033413 | 3300009101 | Bacteria | 3129 |
| 102 | Ga0105241_10165129 | 3300009174 | Bacteria | 1824 |
| 103 | Ga0105241_10330624 | 3300009174 | Unclassified | 1317 |
| 104 | Ga0105241_10618696 | 3300009174 | Bacteria | 980 |
| 105 | Ga0105241_10867877 | 3300009174 | Bacteria | 836 |
| 106 | Ga0105242_10180702 | 3300009176 | Unclassified | 1861 |
| 107 | Ga0105237_10058191 | 3300009545 | Bacteria | 3869 |
| 108 | Ga0105237_10089184 | 3300009545 | Bacteria | 3073 |
| 109 | Ga0105237_10107001 | 3300009545 | Bacteria | 2789 |
| 110 | Ga0105237_10173220 | 3300009545 | Bacteria | 2158 |
| 111 | Ga0105238_10037348 | 3300009551 | Bacteria | 4938 |
| 112 | Ga0105238_10108609 | 3300009551 | Bacteria | 2756 |
| 113 | Ga0105238_10284574 | 3300009551 | Bacteria | 1635 |
| 114 | Ga0105238_11222077 | 3300009551 | Unclassified | 776 |
| 115 | Ga0105249_10147931 | 3300009553 | Unclassified | 2258 |
| 116 | Ga0105239_10061687 | 3300010375 | Bacteria | 4115 |
| 117 | Ga0105239_11326672 | 3300010375 | Bacteria | 830 |
| 118 | Ga0105246_10027745 | 3300011119 | Bacteria | 3714 |
| 119 | Ga0157371_10006475 | 3300013102 | Bacteria | 9652 |
| 120 | Ga0157371_10636715 | 3300013102 | Unclassified | 795 |
| 121 | Ga0157370_10000890 | 3300013104 | Bacteria | 37928 |
| 122 | Ga0157370_10001159 | 3300013104 | Bacteria | 32877 |
| 123 | Ga0157370_10024505 | 3300013104 | Bacteria | 5977 |
| 124 | Ga0157370_10309975 | 3300013104 | Bacteria | 1456 |
| 125 | Ga0157370_11096460 | 3300013104 | Bacteria | 719 |
| 126 | Ga0157369_10001971 | 3300013105 | Bacteria | 24762 |
| 127 | Ga0157369_10012332 | 3300013105 | Bacteria | 9706 |
| 128 | Ga0157369_10075816 | 3300013105 | Bacteria | 3605 |
| 129 | Ga0157369_10191681 | 3300013105 | Unclassified | 2148 |
| 130 | Ga0157369_10193284 | 3300013105 | Bacteria | 2137 |
| 131 | Ga0157369_10200695 | 3300013105 | Bacteria | 2094 |
| 132 | Ga0157369_10635937 | 3300013105 | Bacteria | 1101 |
| 133 | Ga0157374_10409986 | 3300013296 | Unclassified | 1353 |
| 134 | Ga0157378_10137428 | 3300013297 | Unclassified | 2266 |
| 135 | Ga0157372_10000389 | 3300013307 | Bacteria | 48742 |
| 136 | Ga0157372_10002980 | 3300013307 | Bacteria | 18240 |
| 137 | Ga0157372_10167664 | 3300013307 | Unclassified | 2540 |
| 138 | Ga0157372_10444858 | 3300013307 | Bacteria | 1510 |
| 139 | Ga0157372_10535361 | 3300013307 | Bacteria | 1365 |
| 140 | Ga0157372_12172343 | 3300013307 | Bacteria | 638 |
| 141 | Ga0157375_11394229 | 3300013308 | Unclassified | 825 |
| 142 | Ga0157380_10006498 | 3300014326 | Bacteria | 8241 |
| 143 | Ga0157379_10288409 | 3300014968 | Unclassified | 1494 |
| 144 | Ga0157379_10302239 | 3300014968 | Bacteria | 1458 |
| 145 | Ga0157379_10457475 | 3300014968 | Bacteria | 1179 |
| 146 | Ga0163161_10028222 | 3300017792 | Unclassified | 3984 |
| 147 | Ga0213873_10125797 | 3300021358 | Bacteria | 756 |
| 148 | Ga0207656_10356125 | 3300025321 | Bacteria | 731 |
| 149 | Ga0207642_10321350 | 3300025899 | Unclassified | 904 |
| 150 | Ga0207710_10240328 | 3300025900 | Unclassified | 903 |
| 151 | Ga0207699_10004009 | 3300025906 | Bacteria | 7044 |
| 152 | Ga0207645_10000489 | 3300025907 | Bacteria | 32760 |
| 153 | Ga0207645_10130756 | 3300025907 | Unclassified | 1634 |
| 154 | Ga0207643_10008148 | 3300025908 | Bacteria | 5623 |
| 155 | Ga0207643_10312742 | 3300025908 | Bacteria | 979 |
| 156 | Ga0207705_10129191 | 3300025909 | Bacteria | 1879 |
| 157 | Ga0207654_10282114 | 3300025911 | Unclassified | 1124 |
| 158 | Ga0207707_10009440 | 3300025912 | Bacteria | 8461 |
| 159 | Ga0207707_10101333 | 3300025912 | Bacteria | 2517 |
| 160 | Ga0207707_10217902 | 3300025912 | Bacteria | 1662 |
| 161 | Ga0207707_10326077 | 3300025912 | Bacteria | 1325 |
| 162 | Ga0207695_10000035 | 3300025913 | Bacteria | 486590 |
| 163 | Ga0207695_10002075 | 3300025913 | Bacteria | 30551 |
| 164 | Ga0207695_10275190 | 3300025913 | Bacteria | 1578 |
| 165 | Ga0207695_10280454 | 3300025913 | Bacteria | 1560 |
| 166 | Ga0207695_10594735 | 3300025913 | Bacteria | 987 |
| 167 | Ga0207695_10732536 | 3300025913 | Unclassified | 869 |
| 168 | Ga0207671_10107155 | 3300025914 | Bacteria | 2122 |
| 169 | Ga0207671_10149282 | 3300025914 | Bacteria | 1805 |
| 170 | Ga0207660_10017745 | 3300025917 | Bacteria | 4734 |
| 171 | Ga0207660_10047168 | 3300025917 | Bacteria | 3044 |
| 172 | Ga0207660_10253387 | 3300025917 | Bacteria | 1390 |
| 173 | Ga0207660_10537151 | 3300025917 | Bacteria | 950 |
| 174 | Ga0207657_10003311 | 3300025919 | Bacteria | 17234 |
| 175 | Ga0207649_10001460 | 3300025920 | Bacteria | 13909 |
| 176 | Ga0207652_10000495 | 3300025921 | Bacteria | 40151 |
| 177 | Ga0207652_10020397 | 3300025921 | Bacteria | 5457 |
| 178 | Ga0207652_10138274 | 3300025921 | Bacteria | 2176 |
| 179 | Ga0207652_10270434 | 3300025921 | Bacteria | 1533 |
| 180 | Ga0207652_10722246 | 3300025921 | Bacteria | 888 |
| 181 | Ga0207681_10213243 | 3300025923 | Bacteria | 1489 |
| 182 | Ga0207681_10724689 | 3300025923 | Unclassified | 828 |
| 183 | Ga0207694_10011564 | 3300025924 | Bacteria | 6659 |
| 184 | Ga0207650_10295802 | 3300025925 | Unclassified | 1321 |
| 185 | Ga0207664_10772438 | 3300025929 | Bacteria | 864 |
| 186 | Ga0207706_10000977 | 3300025933 | Bacteria | 29153 |
| 187 | Ga0207706_10310630 | 3300025933 | Unclassified | 1373 |
| 188 | Ga0207669_10262494 | 3300025937 | Bacteria | 1292 |
| 189 | Ga0207704_10103280 | 3300025938 | Unclassified | 1906 |
| 190 | Ga0207665_10180155 | 3300025939 | Bacteria | 1530 |
| 191 | Ga0207691_10004423 | 3300025940 | Bacteria | 13619 |
| 192 | Ga0207711_10079575 | 3300025941 | Unclassified | 2861 |
| 193 | Ga0207689_10022205 | 3300025942 | Bacteria | 5335 |
| 194 | Ga0207661_10061098 | 3300025944 | Bacteria | 3043 |
| 195 | Ga0207661_10091045 | 3300025944 | Unclassified | 2541 |
| 196 | Ga0207661_10149690 | 3300025944 | Bacteria | 2016 |
| 197 | Ga0207661_10175543 | 3300025944 | Bacteria | 1868 |
| 198 | Ga0207679_10000127 | 3300025945 | Bacteria | 62374 |
| 199 | Ga0207679_10095297 | 3300025945 | Bacteria | 2313 |
| 200 | Ga0207667_10000121 | 3300025949 | Bacteria | 121976 |
| 201 | Ga0207667_10003471 | 3300025949 | Bacteria | 19453 |
| 202 | Ga0207667_10054196 | 3300025949 | Bacteria | 4218 |
| 203 | Ga0207667_10146184 | 3300025949 | Bacteria | 2433 |
| 204 | Ga0207667_10196309 | 3300025949 | Unclassified | 2070 |
| 205 | Ga0207667_10246924 | 3300025949 | Bacteria | 1826 |
| 206 | Ga0207667_10482278 | 3300025949 | Unclassified | 1259 |
| 207 | Ga0207651_10787480 | 3300025960 | Unclassified | 842 |
| 208 | Ga0207668_10023694 | 3300025972 | Unclassified | 3951 |
| 209 | Ga0207668_10092984 | 3300025972 | Bacteria | 2221 |
| 210 | Ga0207658_10160986 | 3300025986 | Unclassified | 1839 |
| 211 | Ga0207703_10168185 | 3300026035 | Unclassified | 1926 |
| 212 | Ga0207703_10229684 | 3300026035 | Bacteria | 1663 |
| 213 | Ga0207678_10346968 | 3300026067 | Unclassified | 1280 |
| 214 | Ga0207702_10028212 | 3300026078 | Bacteria | 4664 |
| 215 | Ga0207702_10300157 | 3300026078 | Unclassified | 1524 |
| 216 | Ga0207702_10388219 | 3300026078 | Bacteria | 1344 |
| 217 | Ga0207648_10037022 | 3300026089 | Bacteria | 4298 |
| 218 | Ga0207674_10204318 | 3300026116 | Bacteria | 1925 |
| 219 | Ga0207675_100000202 | 3300026118 | Bacteria | 55213 |
| 220 | Ga0207683_10000920 | 3300026121 | Bacteria | 27089 |
| 221 | Ga0207683_11289463 | 3300026121 | Bacteria | 676 |
| 222 | Ga0207698_10000575 | 3300026142 | Bacteria | 21456 |
| 223 | Ga0207698_10037359 | 3300026142 | Bacteria | 3576 |
| 224 | Ga0209973_1005015 | 3300027252 | Bacteria | 1390 |
| 225 | Ga0209967_1006867 | 3300027364 | Bacteria | 1550 |
| 226 | Ga0209984_1004617 | 3300027424 | Bacteria | 1628 |
| 227 | Ga0209982_1012926 | 3300027552 | Bacteria | 1256 |
| 228 | Ga0209970_1005089 | 3300027614 | Bacteria | 2172 |
| 229 | Ga0210002_1005689 | 3300027617 | Bacteria | 1874 |
| 230 | Ga0209971_1004876 | 3300027682 | Bacteria | 3188 |
| 231 | Ga0209998_10037015 | 3300027717 | Bacteria | 1098 |
| 232 | Ga0209974_10045031 | 3300027876 | Bacteria | 1473 |
| 233 | Ga0268265_10003863 | 3300028380 | Bacteria | 10577 |
| 234 | Ga0268265_10154678 | 3300028380 | Bacteria | 1939 |
| 235 | Ga0265339_10040951 | 3300031249 | Bacteria | 2574 |
| 236 | Ga0265316_10225453 | 3300031344 | Unclassified | 1382 |
| 237 | Ga0307513_10305372 | 3300031456 | Bacteria | 1356 |
| 238 | Ga0307408_100375835 | 3300031548 | Bacteria | 1213 |
| 239 | Ga0316576_10410392 | 3300031727 | Bacteria | 1003 |
| 240 | Ga0307416_100324851 | 3300032002 | Bacteria | 1543 |
| 241 | Ga0373954_0132408 | 3300035118 | Bacteria | 1214 |
| 242 | Ga0373946_0330221 | 3300035171 | Bacteria | 759 |
| 243 | Ga0316574_0022831 | 3300035398 | Bacteria | 3730 |
| 244 | Ga0373927_0014804 | 3300035695 | Bacteria | 5158 |
| 245 | Ga0373947_0233130 | 3300035725 | Bacteria | 1213 |
| 246 | Ga0395899_0646629 | 3300037312 | Unclassified | 669 |
| 247 | Ga0395900_0753639 | 3300037418 | Unclassified | 904 |
| 248 | Ga0395898_0192225 | 3300037466 | Bacteria | 1950 |
| 249 | Ga0395898_0267635 | 3300037466 | Bacteria | 1630 |
| 250 | Ga0395901_1593145 | 3300038443 | Unclassified | 607 |
| 251 | Ga0436360_1369309 | 3300039438 | Bacteria | 1667 |
| 252 | Ga0436362_1250422 | 3300039453 | Bacteria | 1076 |
| 253 | Ga0450898_020157 | 3300042134 | Bacteria | 1166 |
| 254 | Ga0451577_0006196 | 3300042876 | Bacteria | 12011 |
| 255 | Ga0466964_0001846 | 3300044706 | Bacteria | 7373 |
| 256 | Ga0453684_0061957 | 3300044712 | Bacteria | 4796 |
| 257 | Ga0466971_0000216 | 3300044719 | Bacteria | 22087 |
| 258 | Ga0466968_0027460 | 3300044735 | Bacteria | 2343 |
| 259 | Ga0466957_0013272 | 3300044842 | Bacteria | 4779 |
| 260 | Ga0451576_0007174 | 3300045051 | Bacteria | 13430 |
| 261 | Ga0451576_0881402 | 3300045051 | Bacteria | 939 |
| 262 | Ga0495592_0497984 | 3300046454 | Bacteria | 756 |
| 263 | Ga0495580_0041108 | 3300046472 | Bacteria | 3298 |
| 264 | Ga0495580_0101940 | 3300046472 | Bacteria | 1996 |
| 265 | Ga0495630_0498672 | 3300046517 | Bacteria | 934 |
| 266 | Ga0495657_0232022 | 3300046675 | Bacteria | 1116 |
| 267 | Ga0495581_0507510 | 3300047315 | Bacteria | 701 |
| 268 | Ga0496102_0099345 | 3300048905 | Bacteria | 2701 |
| 269 | Ga0496104_0025773 | 3300048907 | Bacteria | 5422 |
| 270 | Ga0496105_0039515 | 3300048908 | Bacteria | 3889 |
| 271 | Ga0496107_0745843 | 3300048910 | Bacteria | 719 |
| 272 | Ga0496110_0022106 | 3300048913 | Bacteria | 5395 |
| 273 | Ga0496114_1149771 | 3300048917 | Unclassified | 662 |
| 274 | Ga0496115_0241590 | 3300048918 | Unclassified | 1488 |
| 275 | Ga0496118_0080717 | 3300048921 | Bacteria | 2288 |
| 276 | Ga0496126_0016341 | 3300048929 | Bacteria | 7424 |
| 277 | Ga0496126_0609721 | 3300048929 | Bacteria | 859 |
| 278 | Ga0501034_0023355 | 3300049571 | Bacteria | 6301 |
| 279 | Ga0501036_0127307 | 3300049572 | Bacteria | 2151 |
| 280 | Ga0501040_0192881 | 3300049576 | Bacteria | 1446 |
| 281 | Ga0501043_0365230 | 3300049579 | Bacteria | 1095 |
| 282 | Ga0501046_0116484 | 3300049580 | Bacteria | 2036 |
| 283 | Ga0501046_0597256 | 3300049580 | Bacteria | 784 |
| 284 | Ga0501047_0010533 | 3300049581 | Bacteria | 8743 |
| 285 | Ga0501047_0014855 | 3300049581 | Bacteria | 7411 |
| 286 | Ga0501048_0118532 | 3300049582 | Bacteria | 1870 |
| 287 | Ga0501070_0080497 | 3300049586 | Bacteria | 2695 |
| 288 | Ga0501070_0843271 | 3300049586 | Bacteria | 717 |
| 289 | Ga0501072_0157706 | 3300049588 | Bacteria | 1810 |
| 290 | Ga0501073_0084040 | 3300049589 | Bacteria | 2215 |
| 291 | Ga0501074_0035662 | 3300049590 | Bacteria | 3604 |
| 292 | Ga0501074_0135931 | 3300049590 | Bacteria | 1758 |
| 293 | Ga0501075_0211638 | 3300049591 | Bacteria | 1479 |
| 294 | Ga0501076_0082697 | 3300049592 | Bacteria | 2578 |
| 295 | Ga0501250_025363 | 3300049680 | Bacteria | 794 |
| 296 | Ga0501252_019367 | 3300049682 | Bacteria | 878 |
| 297 | Ga0501079_0146194 | 3300049741 | Bacteria | 1842 |
| 298 | Ga0501080_0000303 | 3300049742 | Bacteria | 37542 |
| 299 | Ga0501080_0015424 | 3300049742 | Bacteria | 7043 |
| 300 | Ga0501080_0287121 | 3300049742 | Bacteria | 1495 |
| 301 | Ga0501083_0343800 | 3300049744 | Bacteria | 970 |
| 302 | Ga0501083_0649649 | 3300049744 | Bacteria | 686 |
| 303 | Ga0495612_0034773 | 3300053078 | Bacteria | 2041 |
| 304 | Ga0500583_0340111 | 3300053092 | Bacteria | 729 |
| 305 | Ga0500641_0199822 | 3300053096 | Bacteria | 854 |
| 306 | Ga0500614_023190 | 3300053123 | Bacteria | 1457 |
| 307 | Ga0500588_0000189 | 3300053146 | Bacteria | 8574 |
| 308 | Ga0500616_0037011 | 3300053153 | Bacteria | 2644 |
| 309 | Ga0500637_0020184 | 3300053178 | Bacteria | 3605 |
| 310 | Ga0501082_0018136 | 3300060353 | Bacteria | 6061 |
| 311 | Ga0466962_0014106 | 3300061719 | Bacteria | 3850 |
| 312 | Ga0466962_0053956 | 3300061719 | Bacteria | 1921 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_1149771 | Ga0496114_1149771_193_645 | 138 |
| 2 | 3300046472 | Ga0495580_0101940 | Ga0495580_0101940_883_1422 | 158 |
| 3 | 3300048905 | Ga0496102_0099345 | Ga0496102_0099345_1187_1726 | 158 |
| 4 | 3300048921 | Ga0496118_0080717 | Ga0496118_0080717_802_1341 | 158 |
| 5 | 3300031249 | Ga0265339_10040951 | Ga0265339_100409512 | 162 |
| 6 | 3300031344 | Ga0265316_10225453 | Ga0265316_102254532 | 162 |
| 7 | 3300035171 | Ga0373946_0330221 | Ga0373946_0330221_62_589 | 163 |
| 8 | 3300005336 | Ga0070680_100511333 | Ga0070680_1005113332 | 166 |
| 9 | 3300005458 | Ga0070681_10268525 | Ga0070681_102685252 | 166 |
| 10 | 3300005530 | Ga0070679_100127755 | Ga0070679_1001277552 | 166 |
| 11 | 3300005563 | Ga0068855_100888572 | Ga0068855_1008885721 | 166 |
| 12 | 3300005842 | Ga0068858_100460839 | Ga0068858_1004608392 | 166 |
| 13 | 3300009174 | Ga0105241_10867877 | Ga0105241_108678772 | 166 |
| 14 | 3300013104 | Ga0157370_10024505 | Ga0157370_100245053 | 166 |
| 15 | 3300025921 | Ga0207652_10138274 | Ga0207652_101382742 | 166 |
| 16 | 3300025949 | Ga0207667_10146184 | Ga0207667_101461843 | 166 |
| 17 | 3300026035 | Ga0207703_10229684 | Ga0207703_102296842 | 166 |
| 18 | 3300049571 | Ga0501034_0023355 | Ga0501034_0023355_4747_5262 | 166 |
| 19 | 3300049579 | Ga0501043_0365230 | Ga0501043_0365230_477_992 | 166 |
| 20 | 3300049580 | Ga0501046_0116484 | Ga0501046_0116484_336_851 | 166 |
| 21 | 3300049580 | Ga0501046_0597256 | Ga0501046_0597256_85_600 | 166 |
| 22 | 3300049581 | Ga0501047_0010533 | Ga0501047_0010533_106_621 | 166 |
| 23 | 3300049581 | Ga0501047_0014855 | Ga0501047_0014855_4678_5193 | 166 |
| 24 | 3300049586 | Ga0501070_0080497 | Ga0501070_0080497_1241_1753 | 166 |
| 25 | 3300049586 | Ga0501070_0843271 | Ga0501070_0843271_142_657 | 166 |
| 26 | 3300049589 | Ga0501073_0084040 | Ga0501073_0084040_559_1071 | 166 |
| 27 | 3300049590 | Ga0501074_0035662 | Ga0501074_0035662_2424_2939 | 166 |
| 28 | 3300049590 | Ga0501074_0135931 | Ga0501074_0135931_453_968 | 166 |
| 29 | 3300049741 | Ga0501079_0146194 | Ga0501079_0146194_392_904 | 166 |
| 30 | 3300049742 | Ga0501080_0000303 | Ga0501080_0000303_34867_35382 | 166 |
| 31 | 3300049742 | Ga0501080_0015424 | Ga0501080_0015424_851_1366 | 166 |
| 32 | 3300049744 | Ga0501083_0649649 | Ga0501083_0649649_88_603 | 166 |
| 33 | 3300060353 | Ga0501082_0018136 | Ga0501082_0018136_234_749 | 166 |
| 34 | 3300005295 | Ga0065707_10436918 | Ga0065707_104369181 | 167 |
| 35 | 3300005327 | Ga0070658_10027226 | Ga0070658_100272264 | 167 |
| 36 | 3300005329 | Ga0070683_100002653 | Ga0070683_10000265313 | 167 |
| 37 | 3300005329 | Ga0070683_100077527 | Ga0070683_1000775272 | 167 |
| 38 | 3300005329 | Ga0070683_100081484 | Ga0070683_1000814843 | 167 |
| 39 | 3300005329 | Ga0070683_100092836 | Ga0070683_1000928362 | 167 |
| 40 | 3300005329 | Ga0070683_100369576 | Ga0070683_1003695762 | 167 |
| 41 | 3300005331 | Ga0070670_100046058 | Ga0070670_1000460585 | 167 |
| 42 | 3300005333 | Ga0070677_10080657 | Ga0070677_100806571 | 167 |
| 43 | 3300005334 | Ga0068869_100016970 | Ga0068869_1000169702 | 167 |
| 44 | 3300005335 | Ga0070666_10042346 | Ga0070666_100423463 | 167 |
| 45 | 3300005336 | Ga0070680_100002400 | Ga0070680_10000240010 | 167 |
| 46 | 3300005336 | Ga0070680_100027729 | Ga0070680_1000277293 | 167 |
| 47 | 3300005336 | Ga0070680_100495480 | Ga0070680_1004954802 | 167 |
| 48 | 3300005338 | Ga0068868_100081556 | Ga0068868_1000815562 | 167 |
| 49 | 3300005338 | Ga0068868_100081703 | Ga0068868_1000817032 | 167 |
| 50 | 3300005339 | Ga0070660_100001007 | Ga0070660_1000010072 | 167 |
| 51 | 3300005339 | Ga0070660_100379302 | Ga0070660_1003793023 | 167 |
| 52 | 3300005344 | Ga0070661_100000558 | Ga0070661_1000005586 | 167 |
| 53 | 3300005344 | Ga0070661_100890481 | Ga0070661_1008904812 | 167 |
| 54 | 3300005345 | Ga0070692_10106281 | Ga0070692_101062812 | 167 |
| 55 | 3300005347 | Ga0070668_100136713 | Ga0070668_1001367132 | 167 |
| 56 | 3300005354 | Ga0070675_100328139 | Ga0070675_1003281392 | 167 |
| 57 | 3300005367 | Ga0070667_100232980 | Ga0070667_1002329803 | 167 |
| 58 | 3300005436 | Ga0070713_100051630 | Ga0070713_1000516302 | 167 |
| 59 | 3300005436 | Ga0070713_100128057 | Ga0070713_1001280572 | 167 |
| 60 | 3300005439 | Ga0070711_100428074 | Ga0070711_1004280742 | 167 |
| 61 | 3300005444 | Ga0070694_100410349 | Ga0070694_1004103492 | 167 |
| 62 | 3300005456 | Ga0070678_100063803 | Ga0070678_1000638033 | 167 |
| 63 | 3300005456 | Ga0070678_101006503 | Ga0070678_1010065031 | 167 |
| 64 | 3300005457 | Ga0070662_100024935 | Ga0070662_1000249352 | 167 |
| 65 | 3300005458 | Ga0070681_10011416 | Ga0070681_100114168 | 167 |
| 66 | 3300005458 | Ga0070681_10011526 | Ga0070681_100115264 | 167 |
| 67 | 3300005458 | Ga0070681_10094207 | Ga0070681_100942072 | 167 |
| 68 | 3300005458 | Ga0070681_10102224 | Ga0070681_101022242 | 167 |
| 69 | 3300005458 | Ga0070681_10258551 | Ga0070681_102585512 | 167 |
| 70 | 3300005518 | Ga0070699_100063380 | Ga0070699_1000633802 | 167 |
| 71 | 3300005518 | Ga0070699_101093880 | Ga0070699_1010938802 | 167 |
| 72 | 3300005530 | Ga0070679_100000289 | Ga0070679_1000002892 | 167 |
| 73 | 3300005530 | Ga0070679_100030866 | Ga0070679_1000308668 | 167 |
| 74 | 3300005530 | Ga0070679_100181923 | Ga0070679_1001819231 | 167 |
| 75 | 3300005530 | Ga0070679_100368793 | Ga0070679_1003687932 | 167 |
| 76 | 3300005535 | Ga0070684_100031600 | Ga0070684_1000316004 | 167 |
| 77 | 3300005535 | Ga0070684_100041571 | Ga0070684_1000415714 | 167 |
| 78 | 3300005539 | Ga0068853_100079563 | Ga0068853_1000795632 | 167 |
| 79 | 3300005543 | Ga0070672_100010784 | Ga0070672_1000107845 | 167 |
| 80 | 3300005545 | Ga0070695_100120736 | Ga0070695_1001207362 | 167 |
| 81 | 3300005546 | Ga0070696_100463367 | Ga0070696_1004633671 | 167 |
| 82 | 3300005548 | Ga0070665_100106460 | Ga0070665_1001064604 | 167 |
| 83 | 3300005563 | Ga0068855_100010788 | Ga0068855_1000107888 | 167 |
| 84 | 3300005563 | Ga0068855_100029363 | Ga0068855_10002936311 | 167 |
| 85 | 3300005563 | Ga0068855_100037860 | Ga0068855_1000378603 | 167 |
| 86 | 3300005563 | Ga0068855_100115859 | Ga0068855_1001158593 | 167 |
| 87 | 3300005563 | Ga0068855_100383397 | Ga0068855_1003833972 | 167 |
| 88 | 3300005563 | Ga0068855_100422988 | Ga0068855_1004229882 | 167 |
| 89 | 3300005563 | Ga0068855_100464987 | Ga0068855_1004649872 | 167 |
| 90 | 3300005563 | Ga0068855_100556752 | Ga0068855_1005567522 | 167 |
| 91 | 3300005564 | Ga0070664_100000031 | Ga0070664_10000003128 | 167 |
| 92 | 3300005564 | Ga0070664_100136424 | Ga0070664_1001364243 | 167 |
| 93 | 3300005577 | Ga0068857_100112449 | Ga0068857_1001124491 | 167 |
| 94 | 3300005577 | Ga0068857_100180185 | Ga0068857_1001801852 | 167 |
| 95 | 3300005578 | Ga0068854_100105007 | Ga0068854_1001050072 | 167 |
| 96 | 3300005614 | Ga0068856_100006935 | Ga0068856_1000069352 | 167 |
| 97 | 3300005614 | Ga0068856_100954449 | Ga0068856_1009544491 | 167 |
| 98 | 3300005616 | Ga0068852_100000419 | Ga0068852_10000041911 | 167 |
| 99 | 3300005616 | Ga0068852_100004388 | Ga0068852_1000043888 | 167 |
| 100 | 3300005616 | Ga0068852_100228912 | Ga0068852_1002289122 | 167 |
| 101 | 3300005616 | Ga0068852_100254661 | Ga0068852_1002546612 | 167 |
| 102 | 3300005618 | Ga0068864_100113933 | Ga0068864_1001139333 | 167 |
| 103 | 3300005718 | Ga0068866_10016342 | Ga0068866_100163422 | 167 |
| 104 | 3300005719 | Ga0068861_100008740 | Ga0068861_1000087404 | 167 |
| 105 | 3300005834 | Ga0068851_10192018 | Ga0068851_101920182 | 167 |
| 106 | 3300005840 | Ga0068870_10005393 | Ga0068870_100053934 | 167 |
| 107 | 3300005841 | Ga0068863_100247459 | Ga0068863_1002474593 | 167 |
| 108 | 3300005842 | Ga0068858_100083390 | Ga0068858_1000833904 | 167 |
| 109 | 3300005844 | Ga0068862_100003806 | Ga0068862_10000380610 | 167 |
| 110 | 3300005844 | Ga0068862_100157739 | Ga0068862_1001577392 | 167 |
| 111 | 3300006173 | Ga0070716_100097098 | Ga0070716_1000970982 | 167 |
| 112 | 3300006237 | Ga0097621_100229386 | Ga0097621_1002293863 | 167 |
| 113 | 3300006237 | Ga0097621_100409053 | Ga0097621_1004090532 | 167 |
| 114 | 3300006358 | Ga0068871_100083438 | Ga0068871_1000834383 | 167 |
| 115 | 3300006844 | Ga0075428_100058770 | Ga0075428_1000587704 | 167 |
| 116 | 3300006846 | Ga0075430_100033935 | Ga0075430_1000339352 | 167 |
| 117 | 3300006847 | Ga0075431_100009013 | Ga0075431_1000090132 | 167 |
| 118 | 3300006880 | Ga0075429_100113295 | Ga0075429_1001132952 | 167 |
| 119 | 3300009093 | Ga0105240_10000313 | Ga0105240_1000031350 | 167 |
| 120 | 3300009093 | Ga0105240_10001599 | Ga0105240_1000159927 | 167 |
| 121 | 3300009093 | Ga0105240_10003744 | Ga0105240_1000374422 | 167 |
| 122 | 3300009093 | Ga0105240_10055209 | Ga0105240_100552095 | 167 |
| 123 | 3300009093 | Ga0105240_10370367 | Ga0105240_103703672 | 167 |
| 124 | 3300009093 | Ga0105240_10445422 | Ga0105240_104454222 | 167 |
| 125 | 3300009093 | Ga0105240_10604207 | Ga0105240_106042073 | 167 |
| 126 | 3300009094 | Ga0111539_10073356 | Ga0111539_100733562 | 167 |
| 127 | 3300009098 | Ga0105245_10119710 | Ga0105245_101197103 | 167 |
| 128 | 3300009101 | Ga0105247_10008699 | Ga0105247_100086996 | 167 |
| 129 | 3300009101 | Ga0105247_10033413 | Ga0105247_100334133 | 167 |
| 130 | 3300009174 | Ga0105241_10165129 | Ga0105241_101651291 | 167 |
| 131 | 3300009174 | Ga0105241_10330624 | Ga0105241_103306243 | 167 |
| 132 | 3300009174 | Ga0105241_10618696 | Ga0105241_106186962 | 167 |
| 133 | 3300009176 | Ga0105242_10180702 | Ga0105242_101807023 | 167 |
| 134 | 3300009545 | Ga0105237_10058191 | Ga0105237_100581913 | 167 |
| 135 | 3300009545 | Ga0105237_10089184 | Ga0105237_100891844 | 167 |
| 136 | 3300009545 | Ga0105237_10107001 | Ga0105237_101070013 | 167 |
| 137 | 3300009545 | Ga0105237_10173220 | Ga0105237_101732203 | 167 |
| 138 | 3300009551 | Ga0105238_10037348 | Ga0105238_100373484 | 167 |
| 139 | 3300009551 | Ga0105238_10108609 | Ga0105238_101086092 | 167 |
| 140 | 3300009551 | Ga0105238_10284574 | Ga0105238_102845742 | 167 |
| 141 | 3300009551 | Ga0105238_11222077 | Ga0105238_112220772 | 167 |
| 142 | 3300009553 | Ga0105249_10147931 | Ga0105249_101479315 | 167 |
| 143 | 3300010375 | Ga0105239_10061687 | Ga0105239_100616873 | 167 |
| 144 | 3300010375 | Ga0105239_11326672 | Ga0105239_113266721 | 167 |
| 145 | 3300011119 | Ga0105246_10027745 | Ga0105246_100277452 | 167 |
| 146 | 3300013102 | Ga0157371_10006475 | Ga0157371_100064752 | 167 |
| 147 | 3300013102 | Ga0157371_10636715 | Ga0157371_106367152 | 167 |
| 148 | 3300013104 | Ga0157370_10000890 | Ga0157370_1000089027 | 167 |
| 149 | 3300013104 | Ga0157370_10001159 | Ga0157370_1000115928 | 167 |
| 150 | 3300013104 | Ga0157370_10309975 | Ga0157370_103099752 | 167 |
| 151 | 3300013104 | Ga0157370_11096460 | Ga0157370_110964602 | 167 |
| 152 | 3300013105 | Ga0157369_10001971 | Ga0157369_1000197113 | 167 |
| 153 | 3300013105 | Ga0157369_10012332 | Ga0157369_100123323 | 167 |
| 154 | 3300013105 | Ga0157369_10075816 | Ga0157369_100758162 | 167 |
| 155 | 3300013105 | Ga0157369_10191681 | Ga0157369_101916811 | 167 |
| 156 | 3300013105 | Ga0157369_10193284 | Ga0157369_101932843 | 167 |
| 157 | 3300013105 | Ga0157369_10200695 | Ga0157369_102006952 | 167 |
| 158 | 3300013105 | Ga0157369_10635937 | Ga0157369_106359372 | 167 |
| 159 | 3300013296 | Ga0157374_10409986 | Ga0157374_104099862 | 167 |
| 160 | 3300013297 | Ga0157378_10137428 | Ga0157378_101374282 | 167 |
| 161 | 3300013307 | Ga0157372_10000389 | Ga0157372_1000038932 | 167 |
| 162 | 3300013307 | Ga0157372_10002980 | Ga0157372_1000298012 | 167 |
| 163 | 3300013307 | Ga0157372_10167664 | Ga0157372_101676644 | 167 |
| 164 | 3300013307 | Ga0157372_10444858 | Ga0157372_104448581 | 167 |
| 165 | 3300013307 | Ga0157372_10535361 | Ga0157372_105353612 | 167 |
| 166 | 3300013307 | Ga0157372_12172343 | Ga0157372_121723431 | 167 |
| 167 | 3300013308 | Ga0157375_11394229 | Ga0157375_113942291 | 167 |
| 168 | 3300014326 | Ga0157380_10006498 | Ga0157380_100064988 | 167 |
| 169 | 3300014968 | Ga0157379_10288409 | Ga0157379_102884092 | 167 |
| 170 | 3300014968 | Ga0157379_10302239 | Ga0157379_103022392 | 167 |
| 171 | 3300014968 | Ga0157379_10457475 | Ga0157379_104574752 | 167 |
| 172 | 3300017792 | Ga0163161_10028222 | Ga0163161_100282224 | 167 |
| 173 | 3300021358 | Ga0213873_10125797 | Ga0213873_101257971 | 167 |
| 174 | 3300025321 | Ga0207656_10356125 | Ga0207656_103561252 | 167 |
| 175 | 3300025899 | Ga0207642_10321350 | Ga0207642_103213502 | 167 |
| 176 | 3300025900 | Ga0207710_10240328 | Ga0207710_102403282 | 167 |
| 177 | 3300025906 | Ga0207699_10004009 | Ga0207699_100040091 | 167 |
| 178 | 3300025907 | Ga0207645_10000489 | Ga0207645_1000048918 | 167 |
| 179 | 3300025907 | Ga0207645_10130756 | Ga0207645_101307562 | 167 |
| 180 | 3300025908 | Ga0207643_10008148 | Ga0207643_100081482 | 167 |
| 181 | 3300025908 | Ga0207643_10312742 | Ga0207643_103127421 | 167 |
| 182 | 3300025909 | Ga0207705_10129191 | Ga0207705_101291912 | 167 |
| 183 | 3300025911 | Ga0207654_10282114 | Ga0207654_102821142 | 167 |
| 184 | 3300025912 | Ga0207707_10009440 | Ga0207707_100094403 | 167 |
| 185 | 3300025912 | Ga0207707_10101333 | Ga0207707_101013332 | 167 |
| 186 | 3300025912 | Ga0207707_10217902 | Ga0207707_102179022 | 167 |
| 187 | 3300025912 | Ga0207707_10326077 | Ga0207707_103260772 | 167 |
| 188 | 3300025913 | Ga0207695_10000035 | Ga0207695_10000035136 | 167 |
| 189 | 3300025913 | Ga0207695_10002075 | Ga0207695_1000207520 | 167 |
| 190 | 3300025913 | Ga0207695_10275190 | Ga0207695_102751901 | 167 |
| 191 | 3300025913 | Ga0207695_10280454 | Ga0207695_102804542 | 167 |
| 192 | 3300025913 | Ga0207695_10594735 | Ga0207695_105947352 | 167 |
| 193 | 3300025913 | Ga0207695_10732536 | Ga0207695_107325361 | 167 |
| 194 | 3300025914 | Ga0207671_10107155 | Ga0207671_101071552 | 167 |
| 195 | 3300025914 | Ga0207671_10149282 | Ga0207671_101492822 | 167 |
| 196 | 3300025917 | Ga0207660_10017745 | Ga0207660_100177454 | 167 |
| 197 | 3300025917 | Ga0207660_10047168 | Ga0207660_100471682 | 167 |
| 198 | 3300025917 | Ga0207660_10253387 | Ga0207660_102533872 | 167 |
| 199 | 3300025917 | Ga0207660_10537151 | Ga0207660_105371512 | 167 |
| 200 | 3300025919 | Ga0207657_10003311 | Ga0207657_1000331114 | 167 |
| 201 | 3300025920 | Ga0207649_10001460 | Ga0207649_100014609 | 167 |
| 202 | 3300025921 | Ga0207652_10000495 | Ga0207652_1000049513 | 167 |
| 203 | 3300025921 | Ga0207652_10020397 | Ga0207652_100203972 | 167 |
| 204 | 3300025921 | Ga0207652_10270434 | Ga0207652_102704342 | 167 |
| 205 | 3300025921 | Ga0207652_10722246 | Ga0207652_107222462 | 167 |
| 206 | 3300025923 | Ga0207681_10213243 | Ga0207681_102132432 | 167 |
| 207 | 3300025923 | Ga0207681_10724689 | Ga0207681_107246892 | 167 |
| 208 | 3300025924 | Ga0207694_10011564 | Ga0207694_100115642 | 167 |
| 209 | 3300025925 | Ga0207650_10295802 | Ga0207650_102958022 | 167 |
| 210 | 3300025929 | Ga0207664_10772438 | Ga0207664_107724382 | 167 |
| 211 | 3300025933 | Ga0207706_10000977 | Ga0207706_100009778 | 167 |
| 212 | 3300025933 | Ga0207706_10310630 | Ga0207706_103106302 | 167 |
| 213 | 3300025937 | Ga0207669_10262494 | Ga0207669_102624942 | 167 |
| 214 | 3300025938 | Ga0207704_10103280 | Ga0207704_101032803 | 167 |
| 215 | 3300025939 | Ga0207665_10180155 | Ga0207665_101801552 | 167 |
| 216 | 3300025940 | Ga0207691_10004423 | Ga0207691_100044237 | 167 |
| 217 | 3300025941 | Ga0207711_10079575 | Ga0207711_100795752 | 167 |
| 218 | 3300025942 | Ga0207689_10022205 | Ga0207689_100222056 | 167 |
| 219 | 3300025944 | Ga0207661_10061098 | Ga0207661_100610983 | 167 |
| 220 | 3300025944 | Ga0207661_10091045 | Ga0207661_100910452 | 167 |
| 221 | 3300025944 | Ga0207661_10149690 | Ga0207661_101496902 | 167 |
| 222 | 3300025944 | Ga0207661_10175543 | Ga0207661_101755432 | 167 |
| 223 | 3300025945 | Ga0207679_10000127 | Ga0207679_1000012736 | 167 |
| 224 | 3300025945 | Ga0207679_10095297 | Ga0207679_100952973 | 167 |
| 225 | 3300025949 | Ga0207667_10000121 | Ga0207667_1000012149 | 167 |
| 226 | 3300025949 | Ga0207667_10003471 | Ga0207667_1000347112 | 167 |
| 227 | 3300025949 | Ga0207667_10054196 | Ga0207667_100541963 | 167 |
| 228 | 3300025949 | Ga0207667_10196309 | Ga0207667_101963093 | 167 |
| 229 | 3300025949 | Ga0207667_10246924 | Ga0207667_102469242 | 167 |
| 230 | 3300025949 | Ga0207667_10482278 | Ga0207667_104822782 | 167 |
| 231 | 3300025960 | Ga0207651_10787480 | Ga0207651_107874802 | 167 |
| 232 | 3300025972 | Ga0207668_10023694 | Ga0207668_100236944 | 167 |
| 233 | 3300025972 | Ga0207668_10092984 | Ga0207668_100929842 | 167 |
| 234 | 3300025986 | Ga0207658_10160986 | Ga0207658_101609862 | 167 |
| 235 | 3300026035 | Ga0207703_10168185 | Ga0207703_101681851 | 167 |
| 236 | 3300026067 | Ga0207678_10346968 | Ga0207678_103469682 | 167 |
| 237 | 3300026078 | Ga0207702_10028212 | Ga0207702_100282122 | 167 |
| 238 | 3300026078 | Ga0207702_10300157 | Ga0207702_103001572 | 167 |
| 239 | 3300026078 | Ga0207702_10388219 | Ga0207702_103882192 | 167 |
| 240 | 3300026089 | Ga0207648_10037022 | Ga0207648_100370222 | 167 |
| 241 | 3300026116 | Ga0207674_10204318 | Ga0207674_102043182 | 167 |
| 242 | 3300026118 | Ga0207675_100000202 | Ga0207675_1000002026 | 167 |
| 243 | 3300026121 | Ga0207683_10000920 | Ga0207683_1000092021 | 167 |
| 244 | 3300026121 | Ga0207683_11289463 | Ga0207683_112894631 | 167 |
| 245 | 3300026142 | Ga0207698_10000575 | Ga0207698_100005757 | 167 |
| 246 | 3300026142 | Ga0207698_10037359 | Ga0207698_100373593 | 167 |
| 247 | 3300027252 | Ga0209973_1005015 | Ga0209973_10050152 | 167 |
| 248 | 3300027364 | Ga0209967_1006867 | Ga0209967_10068672 | 167 |
| 249 | 3300027424 | Ga0209984_1004617 | Ga0209984_10046172 | 167 |
| 250 | 3300027552 | Ga0209982_1012926 | Ga0209982_10129262 | 167 |
| 251 | 3300027614 | Ga0209970_1005089 | Ga0209970_10050892 | 167 |
| 252 | 3300027617 | Ga0210002_1005689 | Ga0210002_10056892 | 167 |
| 253 | 3300027682 | Ga0209971_1004876 | Ga0209971_10048762 | 167 |
| 254 | 3300027717 | Ga0209998_10037015 | Ga0209998_100370152 | 167 |
| 255 | 3300027876 | Ga0209974_10045031 | Ga0209974_100450313 | 167 |
| 256 | 3300028380 | Ga0268265_10003863 | Ga0268265_100038632 | 167 |
| 257 | 3300028380 | Ga0268265_10154678 | Ga0268265_101546783 | 167 |
| 258 | 3300031456 | Ga0307513_10305372 | Ga0307513_103053721 | 167 |
| 259 | 3300031548 | Ga0307408_100375835 | Ga0307408_1003758351 | 167 |
| 260 | 3300031727 | Ga0316576_10410392 | Ga0316576_104103922 | 167 |
| 261 | 3300032002 | Ga0307416_100324851 | Ga0307416_1003248512 | 167 |
| 262 | 3300035118 | Ga0373954_0132408 | Ga0373954_0132408_643_1182 | 167 |
| 263 | 3300035398 | Ga0316574_0022831 | Ga0316574_0022831_682_1218 | 167 |
| 264 | 3300035695 | Ga0373927_0014804 | Ga0373927_0014804_101_640 | 167 |
| 265 | 3300035725 | Ga0373947_0233130 | Ga0373947_0233130_181_720 | 167 |
| 266 | 3300037312 | Ga0395899_0646629 | Ga0395899_0646629_94_630 | 167 |
| 267 | 3300037418 | Ga0395900_0753639 | Ga0395900_0753639_224_760 | 167 |
| 268 | 3300037466 | Ga0395898_0192225 | Ga0395898_0192225_1315_1863 | 167 |
| 269 | 3300037466 | Ga0395898_0267635 | Ga0395898_0267635_1073_1600 | 167 |
| 270 | 3300038443 | Ga0395901_1593145 | Ga0395901_1593145_13_540 | 167 |
| 271 | 3300039438 | Ga0436360_1369309 | Ga0436360_1369309_569_1123 | 167 |
| 272 | 3300039453 | Ga0436362_1250422 | Ga0436362_1250422_228_761 | 167 |
| 273 | 3300042134 | Ga0450898_020157 | Ga0450898_020157_296_799 | 167 |
| 274 | 3300042876 | Ga0451577_0006196 | Ga0451577_0006196_4652_5164 | 167 |
| 275 | 3300044706 | Ga0466964_0001846 | Ga0466964_0001846_1351_1893 | 167 |
| 276 | 3300044712 | Ga0453684_0061957 | Ga0453684_0061957_771_1283 | 167 |
| 277 | 3300044719 | Ga0466971_0000216 | Ga0466971_0000216_3833_4375 | 167 |
| 278 | 3300044735 | Ga0466968_0027460 | Ga0466968_0027460_204_746 | 167 |
| 279 | 3300044842 | Ga0466957_0013272 | Ga0466957_0013272_3094_3636 | 167 |
| 280 | 3300045051 | Ga0451576_0007174 | Ga0451576_0007174_2102_2614 | 167 |
| 281 | 3300045051 | Ga0451576_0881402 | Ga0451576_0881402_285_797 | 167 |
| 282 | 3300046454 | Ga0495592_0497984 | Ga0495592_0497984_193_732 | 167 |
| 283 | 3300046472 | Ga0495580_0041108 | Ga0495580_0041108_2725_3264 | 167 |
| 284 | 3300046517 | Ga0495630_0498672 | Ga0495630_0498672_134_673 | 167 |
| 285 | 3300046675 | Ga0495657_0232022 | Ga0495657_0232022_550_1089 | 167 |
| 286 | 3300047315 | Ga0495581_0507510 | Ga0495581_0507510_86_625 | 167 |
| 287 | 3300048907 | Ga0496104_0025773 | Ga0496104_0025773_2044_2583 | 167 |
| 288 | 3300048908 | Ga0496105_0039515 | Ga0496105_0039515_3184_3705 | 167 |
| 289 | 3300048910 | Ga0496107_0745843 | Ga0496107_0745843_143_661 | 167 |
| 290 | 3300048913 | Ga0496110_0022106 | Ga0496110_0022106_777_1316 | 167 |
| 291 | 3300048918 | Ga0496115_0241590 | Ga0496115_0241590_146_658 | 167 |
| 292 | 3300048929 | Ga0496126_0016341 | Ga0496126_0016341_2303_2857 | 167 |
| 293 | 3300048929 | Ga0496126_0609721 | Ga0496126_0609721_140_646 | 167 |
| 294 | 3300049572 | Ga0501036_0127307 | Ga0501036_0127307_1564_2067 | 167 |
| 295 | 3300049576 | Ga0501040_0192881 | Ga0501040_0192881_755_1258 | 167 |
| 296 | 3300049582 | Ga0501048_0118532 | Ga0501048_0118532_1023_1526 | 167 |
| 297 | 3300049588 | Ga0501072_0157706 | Ga0501072_0157706_1224_1727 | 167 |
| 298 | 3300049591 | Ga0501075_0211638 | Ga0501075_0211638_173_676 | 167 |
| 299 | 3300049592 | Ga0501076_0082697 | Ga0501076_0082697_1927_2430 | 167 |
| 300 | 3300049680 | Ga0501250_025363 | Ga0501250_025363_160_672 | 167 |
| 301 | 3300049682 | Ga0501252_019367 | Ga0501252_019367_156_668 | 167 |
| 302 | 3300049742 | Ga0501080_0287121 | Ga0501080_0287121_566_1087 | 167 |
| 303 | 3300049744 | Ga0501083_0343800 | Ga0501083_0343800_330_851 | 167 |
| 304 | 3300053078 | Ga0495612_0034773 | Ga0495612_0034773_547_1116 | 167 |
| 305 | 3300053092 | Ga0500583_0340111 | Ga0500583_0340111_22_537 | 167 |
| 306 | 3300053096 | Ga0500641_0199822 | Ga0500641_0199822_267_812 | 167 |
| 307 | 3300053123 | Ga0500614_023190 | Ga0500614_023190_413_928 | 167 |
| 308 | 3300053146 | Ga0500588_0000189 | Ga0500588_0000189_5985_6500 | 167 |
| 309 | 3300053153 | Ga0500616_0037011 | Ga0500616_0037011_1835_2401 | 167 |
| 310 | 3300053178 | Ga0500637_0020184 | Ga0500637_0020184_916_1437 | 167 |
| 311 | 3300061719 | Ga0466962_0014106 | Ga0466962_0014106_2971_3513 | 167 |
| 312 | 3300061719 | Ga0466962_0053956 | Ga0466962_0053956_1228_1767 | 167 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6cfw-assembly1.cif.gz_J | cryoem structure of a respiratory membrane-bound hydrogenase | 0.8479 | 36 | 166 |
| 7nz1-assembly1.cif.gz_B | respiratory complex i from escherichia coli - focused refinement of cytoplasmic arm | 0.8179 | 47 | 162 |
| 7q5y-assembly4.cif.gz_X | structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus | 0.8065 | 42 | 162 |
| 6ziy-assembly1.cif.gz_6 | respiratory complex i from thermus thermophilus, nadh dataset, major state | 0.7876 | 28 | 166 |
| 7p7k-assembly1.cif.gz_B | complex i from e. coli, ddm/lmng-purified, with dq, resting state | 0.7848 | 29 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6cfwJ00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8479 | 36 | 166 | 3.40.50.12280 |
| af_I6XUD2_20_159_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8465 | 41 | 167 | 3.40.50.12280 |
| af_P77668_14_171_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8412 | 22 | 166 | 3.40.50.12280 |
| af_Q57936_1_148_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.813 | 34 | 166 | 3.40.50.12280 |
| 6cfwJ00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7782 | 36 | 166 | 3.40.50.12280 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5BXF0-F1-model_v4 | NADH:ubiquinone oxidoreductase-like 20kDa subunit domain-containing protein | 0.8909 | 26 | 166 |
GO:0051539
|
| AF-A0A7V7WGZ4-F1-model_v4 | Formate hydrogenlyase | 0.8902 | 41 | 166 |
GO:0016829
GO:0051539 |
| AF-A0A850SI50-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoB (EC 1.6.5.11) | 0.8874 | 27 | 167 |
GO:0008137
GO:0048038 GO:0051539 |
| AF-A0A800BTY2-F1-model_v4 | NADH-quinone oxidoreductase subunit B | 0.8852 | 41 | 166 |
GO:0008137
GO:0046872 GO:0048038 GO:0051539 |
| AF-A0A2C6MH50-F1-model_v4 | NADH dehydrogenase | 0.8843 | 19 | 166 |
GO:0051539
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar