F401693

General Info

Members Datasets Scaffolds Average Seq Length
312 188 312 174

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10061687|Ga0105239_100616873
Length 207
Sequence MLKTLRQIVSIGIVTEPPPSADETLRMRERPGDPGASTAALRARLDERIRIVLGRALCIRHIDAGSCNGCELEIQALNNPIYNLEGLGIRFVASPRHADLLLVTGPVSRHMEVALRRTYEATPDPKLVVALGDCGCTGGIFGESYASRGRVSEVIPVDVAIPGCPPSPTRILQGILTALSASPAKNVARDLPSTAAPTASDSVAPRR

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
176 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
182 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
183 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
184 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0
Rhizoplane 2.24
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10436918 3300005295 Bacteria 814
2 Ga0070658_10027226 3300005327 Bacteria 4589
3 Ga0070683_100002653 3300005329 Bacteria 14305
4 Ga0070683_100077527 3300005329 Unclassified 3108
5 Ga0070683_100081484 3300005329 Bacteria 3030
6 Ga0070683_100092836 3300005329 Bacteria 2835
7 Ga0070683_100369576 3300005329 Bacteria 1366
8 Ga0070670_100046058 3300005331 Bacteria 3750
9 Ga0070677_10080657 3300005333 Bacteria 1391
10 Ga0068869_100016970 3300005334 Bacteria 4924
11 Ga0070666_10042346 3300005335 Unclassified 3046
12 Ga0070680_100002400 3300005336 Bacteria 13868
13 Ga0070680_100027729 3300005336 Bacteria 4537
14 Ga0070680_100495480 3300005336 Bacteria 1045
15 Ga0070680_100511333 3300005336 Bacteria 1028
16 Ga0068868_100081556 3300005338 Bacteria 2593
17 Ga0068868_100081703 3300005338 Unclassified 2591
18 Ga0070660_100001007 3300005339 Bacteria 18914
19 Ga0070660_100379302 3300005339 Unclassified 1167
20 Ga0070661_100000558 3300005344 Bacteria 28462
21 Ga0070661_100890481 3300005344 Unclassified 734
22 Ga0070692_10106281 3300005345 Bacteria 1546
23 Ga0070668_100136713 3300005347 Unclassified 1972
24 Ga0070675_100328139 3300005354 Unclassified 1353
25 Ga0070667_100232980 3300005367 Unclassified 1642
26 Ga0070713_100051630 3300005436 Bacteria 3401
27 Ga0070713_100128057 3300005436 Bacteria 2236
28 Ga0070711_100428074 3300005439 Bacteria 1080
29 Ga0070694_100410349 3300005444 Bacteria 1062
30 Ga0070678_100063803 3300005456 Unclassified 2727
31 Ga0070678_101006503 3300005456 Bacteria 766
32 Ga0070662_100024935 3300005457 Unclassified 4126
33 Ga0070681_10011416 3300005458 Bacteria 8792
34 Ga0070681_10011526 3300005458 Bacteria 8750
35 Ga0070681_10094207 3300005458 Bacteria 2943
36 Ga0070681_10102224 3300005458 Bacteria 2811
37 Ga0070681_10258551 3300005458 Bacteria 1653
38 Ga0070681_10268525 3300005458 Bacteria 1617
39 Ga0070699_100063380 3300005518 Bacteria 3205
40 Ga0070699_101093880 3300005518 Bacteria 731
41 Ga0070679_100000289 3300005530 Bacteria 42702
42 Ga0070679_100030866 3300005530 Bacteria 5295
43 Ga0070679_100127755 3300005530 Bacteria 2524
44 Ga0070679_100181923 3300005530 Bacteria 2074
45 Ga0070679_100368793 3300005530 Bacteria 1383
46 Ga0070684_100031600 3300005535 Bacteria 4509
47 Ga0070684_100041571 3300005535 Unclassified 3964
48 Ga0068853_100079563 3300005539 Unclassified 2866
49 Ga0070672_100010784 3300005543 Bacteria 6350
50 Ga0070695_100120736 3300005545 Bacteria 1792
51 Ga0070696_100463367 3300005546 Bacteria 1002
52 Ga0070665_100106460 3300005548 Unclassified 2806
53 Ga0068855_100010788 3300005563 Bacteria 11029
54 Ga0068855_100029363 3300005563 Bacteria 6575
55 Ga0068855_100037860 3300005563 Bacteria 5732
56 Ga0068855_100115859 3300005563 Bacteria 3071
57 Ga0068855_100383397 3300005563 Bacteria 1543
58 Ga0068855_100422988 3300005563 Bacteria 1457
59 Ga0068855_100464987 3300005563 Unclassified 1379
60 Ga0068855_100556752 3300005563 Unclassified 1241
61 Ga0068855_100888572 3300005563 Bacteria 942
62 Ga0070664_100000031 3300005564 Bacteria 88513
63 Ga0070664_100136424 3300005564 Unclassified 2158
64 Ga0068857_100112449 3300005577 Bacteria 2448
65 Ga0068857_100180185 3300005577 Bacteria 1923
66 Ga0068854_100105007 3300005578 Bacteria 2123
67 Ga0068856_100006935 3300005614 Bacteria 11082
68 Ga0068856_100954449 3300005614 Bacteria 876
69 Ga0068852_100000419 3300005616 Bacteria 28349
70 Ga0068852_100004388 3300005616 Bacteria 9969
71 Ga0068852_100228912 3300005616 Unclassified 1771
72 Ga0068852_100254661 3300005616 Bacteria 1683
73 Ga0068864_100113933 3300005618 Unclassified 2411
74 Ga0068866_10016342 3300005718 Unclassified 3317
75 Ga0068861_100008740 3300005719 Bacteria 6971
76 Ga0068851_10192018 3300005834 Unclassified 1136
77 Ga0068870_10005393 3300005840 Bacteria 5582
78 Ga0068863_100247459 3300005841 Unclassified 1721
79 Ga0068858_100083390 3300005842 Unclassified 2972
80 Ga0068858_100460839 3300005842 Bacteria 1226
81 Ga0068862_100003806 3300005844 Bacteria 12852
82 Ga0068862_100157739 3300005844 Bacteria 2024
83 Ga0070716_100097098 3300006173 Bacteria 1797
84 Ga0097621_100229386 3300006237 Unclassified 1621
85 Ga0097621_100409053 3300006237 Bacteria 1216
86 Ga0068871_100083438 3300006358 Unclassified 2650
87 Ga0075428_100058770 3300006844 Bacteria 4210
88 Ga0075430_100033935 3300006846 Bacteria 4330
89 Ga0075431_100009013 3300006847 Bacteria 10003
90 Ga0075429_100113295 3300006880 Bacteria 2371
91 Ga0105240_10000313 3300009093 Bacteria 93046
92 Ga0105240_10001599 3300009093 Bacteria 38474
93 Ga0105240_10003744 3300009093 Bacteria 23493
94 Ga0105240_10055209 3300009093 Bacteria 4974
95 Ga0105240_10370367 3300009093 Unclassified 1620
96 Ga0105240_10445422 3300009093 Bacteria 1450
97 Ga0105240_10604207 3300009093 Bacteria 1207
98 Ga0111539_10073356 3300009094 Bacteria 4036
99 Ga0105245_10119710 3300009098 Unclassified 2458
100 Ga0105247_10008699 3300009101 Bacteria 6189
101 Ga0105247_10033413 3300009101 Bacteria 3129
102 Ga0105241_10165129 3300009174 Bacteria 1824
103 Ga0105241_10330624 3300009174 Unclassified 1317
104 Ga0105241_10618696 3300009174 Bacteria 980
105 Ga0105241_10867877 3300009174 Bacteria 836
106 Ga0105242_10180702 3300009176 Unclassified 1861
107 Ga0105237_10058191 3300009545 Bacteria 3869
108 Ga0105237_10089184 3300009545 Bacteria 3073
109 Ga0105237_10107001 3300009545 Bacteria 2789
110 Ga0105237_10173220 3300009545 Bacteria 2158
111 Ga0105238_10037348 3300009551 Bacteria 4938
112 Ga0105238_10108609 3300009551 Bacteria 2756
113 Ga0105238_10284574 3300009551 Bacteria 1635
114 Ga0105238_11222077 3300009551 Unclassified 776
115 Ga0105249_10147931 3300009553 Unclassified 2258
116 Ga0105239_10061687 3300010375 Bacteria 4115
117 Ga0105239_11326672 3300010375 Bacteria 830
118 Ga0105246_10027745 3300011119 Bacteria 3714
119 Ga0157371_10006475 3300013102 Bacteria 9652
120 Ga0157371_10636715 3300013102 Unclassified 795
121 Ga0157370_10000890 3300013104 Bacteria 37928
122 Ga0157370_10001159 3300013104 Bacteria 32877
123 Ga0157370_10024505 3300013104 Bacteria 5977
124 Ga0157370_10309975 3300013104 Bacteria 1456
125 Ga0157370_11096460 3300013104 Bacteria 719
126 Ga0157369_10001971 3300013105 Bacteria 24762
127 Ga0157369_10012332 3300013105 Bacteria 9706
128 Ga0157369_10075816 3300013105 Bacteria 3605
129 Ga0157369_10191681 3300013105 Unclassified 2148
130 Ga0157369_10193284 3300013105 Bacteria 2137
131 Ga0157369_10200695 3300013105 Bacteria 2094
132 Ga0157369_10635937 3300013105 Bacteria 1101
133 Ga0157374_10409986 3300013296 Unclassified 1353
134 Ga0157378_10137428 3300013297 Unclassified 2266
135 Ga0157372_10000389 3300013307 Bacteria 48742
136 Ga0157372_10002980 3300013307 Bacteria 18240
137 Ga0157372_10167664 3300013307 Unclassified 2540
138 Ga0157372_10444858 3300013307 Bacteria 1510
139 Ga0157372_10535361 3300013307 Bacteria 1365
140 Ga0157372_12172343 3300013307 Bacteria 638
141 Ga0157375_11394229 3300013308 Unclassified 825
142 Ga0157380_10006498 3300014326 Bacteria 8241
143 Ga0157379_10288409 3300014968 Unclassified 1494
144 Ga0157379_10302239 3300014968 Bacteria 1458
145 Ga0157379_10457475 3300014968 Bacteria 1179
146 Ga0163161_10028222 3300017792 Unclassified 3984
147 Ga0213873_10125797 3300021358 Bacteria 756
148 Ga0207656_10356125 3300025321 Bacteria 731
149 Ga0207642_10321350 3300025899 Unclassified 904
150 Ga0207710_10240328 3300025900 Unclassified 903
151 Ga0207699_10004009 3300025906 Bacteria 7044
152 Ga0207645_10000489 3300025907 Bacteria 32760
153 Ga0207645_10130756 3300025907 Unclassified 1634
154 Ga0207643_10008148 3300025908 Bacteria 5623
155 Ga0207643_10312742 3300025908 Bacteria 979
156 Ga0207705_10129191 3300025909 Bacteria 1879
157 Ga0207654_10282114 3300025911 Unclassified 1124
158 Ga0207707_10009440 3300025912 Bacteria 8461
159 Ga0207707_10101333 3300025912 Bacteria 2517
160 Ga0207707_10217902 3300025912 Bacteria 1662
161 Ga0207707_10326077 3300025912 Bacteria 1325
162 Ga0207695_10000035 3300025913 Bacteria 486590
163 Ga0207695_10002075 3300025913 Bacteria 30551
164 Ga0207695_10275190 3300025913 Bacteria 1578
165 Ga0207695_10280454 3300025913 Bacteria 1560
166 Ga0207695_10594735 3300025913 Bacteria 987
167 Ga0207695_10732536 3300025913 Unclassified 869
168 Ga0207671_10107155 3300025914 Bacteria 2122
169 Ga0207671_10149282 3300025914 Bacteria 1805
170 Ga0207660_10017745 3300025917 Bacteria 4734
171 Ga0207660_10047168 3300025917 Bacteria 3044
172 Ga0207660_10253387 3300025917 Bacteria 1390
173 Ga0207660_10537151 3300025917 Bacteria 950
174 Ga0207657_10003311 3300025919 Bacteria 17234
175 Ga0207649_10001460 3300025920 Bacteria 13909
176 Ga0207652_10000495 3300025921 Bacteria 40151
177 Ga0207652_10020397 3300025921 Bacteria 5457
178 Ga0207652_10138274 3300025921 Bacteria 2176
179 Ga0207652_10270434 3300025921 Bacteria 1533
180 Ga0207652_10722246 3300025921 Bacteria 888
181 Ga0207681_10213243 3300025923 Bacteria 1489
182 Ga0207681_10724689 3300025923 Unclassified 828
183 Ga0207694_10011564 3300025924 Bacteria 6659
184 Ga0207650_10295802 3300025925 Unclassified 1321
185 Ga0207664_10772438 3300025929 Bacteria 864
186 Ga0207706_10000977 3300025933 Bacteria 29153
187 Ga0207706_10310630 3300025933 Unclassified 1373
188 Ga0207669_10262494 3300025937 Bacteria 1292
189 Ga0207704_10103280 3300025938 Unclassified 1906
190 Ga0207665_10180155 3300025939 Bacteria 1530
191 Ga0207691_10004423 3300025940 Bacteria 13619
192 Ga0207711_10079575 3300025941 Unclassified 2861
193 Ga0207689_10022205 3300025942 Bacteria 5335
194 Ga0207661_10061098 3300025944 Bacteria 3043
195 Ga0207661_10091045 3300025944 Unclassified 2541
196 Ga0207661_10149690 3300025944 Bacteria 2016
197 Ga0207661_10175543 3300025944 Bacteria 1868
198 Ga0207679_10000127 3300025945 Bacteria 62374
199 Ga0207679_10095297 3300025945 Bacteria 2313
200 Ga0207667_10000121 3300025949 Bacteria 121976
201 Ga0207667_10003471 3300025949 Bacteria 19453
202 Ga0207667_10054196 3300025949 Bacteria 4218
203 Ga0207667_10146184 3300025949 Bacteria 2433
204 Ga0207667_10196309 3300025949 Unclassified 2070
205 Ga0207667_10246924 3300025949 Bacteria 1826
206 Ga0207667_10482278 3300025949 Unclassified 1259
207 Ga0207651_10787480 3300025960 Unclassified 842
208 Ga0207668_10023694 3300025972 Unclassified 3951
209 Ga0207668_10092984 3300025972 Bacteria 2221
210 Ga0207658_10160986 3300025986 Unclassified 1839
211 Ga0207703_10168185 3300026035 Unclassified 1926
212 Ga0207703_10229684 3300026035 Bacteria 1663
213 Ga0207678_10346968 3300026067 Unclassified 1280
214 Ga0207702_10028212 3300026078 Bacteria 4664
215 Ga0207702_10300157 3300026078 Unclassified 1524
216 Ga0207702_10388219 3300026078 Bacteria 1344
217 Ga0207648_10037022 3300026089 Bacteria 4298
218 Ga0207674_10204318 3300026116 Bacteria 1925
219 Ga0207675_100000202 3300026118 Bacteria 55213
220 Ga0207683_10000920 3300026121 Bacteria 27089
221 Ga0207683_11289463 3300026121 Bacteria 676
222 Ga0207698_10000575 3300026142 Bacteria 21456
223 Ga0207698_10037359 3300026142 Bacteria 3576
224 Ga0209973_1005015 3300027252 Bacteria 1390
225 Ga0209967_1006867 3300027364 Bacteria 1550
226 Ga0209984_1004617 3300027424 Bacteria 1628
227 Ga0209982_1012926 3300027552 Bacteria 1256
228 Ga0209970_1005089 3300027614 Bacteria 2172
229 Ga0210002_1005689 3300027617 Bacteria 1874
230 Ga0209971_1004876 3300027682 Bacteria 3188
231 Ga0209998_10037015 3300027717 Bacteria 1098
232 Ga0209974_10045031 3300027876 Bacteria 1473
233 Ga0268265_10003863 3300028380 Bacteria 10577
234 Ga0268265_10154678 3300028380 Bacteria 1939
235 Ga0265339_10040951 3300031249 Bacteria 2574
236 Ga0265316_10225453 3300031344 Unclassified 1382
237 Ga0307513_10305372 3300031456 Bacteria 1356
238 Ga0307408_100375835 3300031548 Bacteria 1213
239 Ga0316576_10410392 3300031727 Bacteria 1003
240 Ga0307416_100324851 3300032002 Bacteria 1543
241 Ga0373954_0132408 3300035118 Bacteria 1214
242 Ga0373946_0330221 3300035171 Bacteria 759
243 Ga0316574_0022831 3300035398 Bacteria 3730
244 Ga0373927_0014804 3300035695 Bacteria 5158
245 Ga0373947_0233130 3300035725 Bacteria 1213
246 Ga0395899_0646629 3300037312 Unclassified 669
247 Ga0395900_0753639 3300037418 Unclassified 904
248 Ga0395898_0192225 3300037466 Bacteria 1950
249 Ga0395898_0267635 3300037466 Bacteria 1630
250 Ga0395901_1593145 3300038443 Unclassified 607
251 Ga0436360_1369309 3300039438 Bacteria 1667
252 Ga0436362_1250422 3300039453 Bacteria 1076
253 Ga0450898_020157 3300042134 Bacteria 1166
254 Ga0451577_0006196 3300042876 Bacteria 12011
255 Ga0466964_0001846 3300044706 Bacteria 7373
256 Ga0453684_0061957 3300044712 Bacteria 4796
257 Ga0466971_0000216 3300044719 Bacteria 22087
258 Ga0466968_0027460 3300044735 Bacteria 2343
259 Ga0466957_0013272 3300044842 Bacteria 4779
260 Ga0451576_0007174 3300045051 Bacteria 13430
261 Ga0451576_0881402 3300045051 Bacteria 939
262 Ga0495592_0497984 3300046454 Bacteria 756
263 Ga0495580_0041108 3300046472 Bacteria 3298
264 Ga0495580_0101940 3300046472 Bacteria 1996
265 Ga0495630_0498672 3300046517 Bacteria 934
266 Ga0495657_0232022 3300046675 Bacteria 1116
267 Ga0495581_0507510 3300047315 Bacteria 701
268 Ga0496102_0099345 3300048905 Bacteria 2701
269 Ga0496104_0025773 3300048907 Bacteria 5422
270 Ga0496105_0039515 3300048908 Bacteria 3889
271 Ga0496107_0745843 3300048910 Bacteria 719
272 Ga0496110_0022106 3300048913 Bacteria 5395
273 Ga0496114_1149771 3300048917 Unclassified 662
274 Ga0496115_0241590 3300048918 Unclassified 1488
275 Ga0496118_0080717 3300048921 Bacteria 2288
276 Ga0496126_0016341 3300048929 Bacteria 7424
277 Ga0496126_0609721 3300048929 Bacteria 859
278 Ga0501034_0023355 3300049571 Bacteria 6301
279 Ga0501036_0127307 3300049572 Bacteria 2151
280 Ga0501040_0192881 3300049576 Bacteria 1446
281 Ga0501043_0365230 3300049579 Bacteria 1095
282 Ga0501046_0116484 3300049580 Bacteria 2036
283 Ga0501046_0597256 3300049580 Bacteria 784
284 Ga0501047_0010533 3300049581 Bacteria 8743
285 Ga0501047_0014855 3300049581 Bacteria 7411
286 Ga0501048_0118532 3300049582 Bacteria 1870
287 Ga0501070_0080497 3300049586 Bacteria 2695
288 Ga0501070_0843271 3300049586 Bacteria 717
289 Ga0501072_0157706 3300049588 Bacteria 1810
290 Ga0501073_0084040 3300049589 Bacteria 2215
291 Ga0501074_0035662 3300049590 Bacteria 3604
292 Ga0501074_0135931 3300049590 Bacteria 1758
293 Ga0501075_0211638 3300049591 Bacteria 1479
294 Ga0501076_0082697 3300049592 Bacteria 2578
295 Ga0501250_025363 3300049680 Bacteria 794
296 Ga0501252_019367 3300049682 Bacteria 878
297 Ga0501079_0146194 3300049741 Bacteria 1842
298 Ga0501080_0000303 3300049742 Bacteria 37542
299 Ga0501080_0015424 3300049742 Bacteria 7043
300 Ga0501080_0287121 3300049742 Bacteria 1495
301 Ga0501083_0343800 3300049744 Bacteria 970
302 Ga0501083_0649649 3300049744 Bacteria 686
303 Ga0495612_0034773 3300053078 Bacteria 2041
304 Ga0500583_0340111 3300053092 Bacteria 729
305 Ga0500641_0199822 3300053096 Bacteria 854
306 Ga0500614_023190 3300053123 Bacteria 1457
307 Ga0500588_0000189 3300053146 Bacteria 8574
308 Ga0500616_0037011 3300053153 Bacteria 2644
309 Ga0500637_0020184 3300053178 Bacteria 3605
310 Ga0501082_0018136 3300060353 Bacteria 6061
311 Ga0466962_0014106 3300061719 Bacteria 3850
312 Ga0466962_0053956 3300061719 Bacteria 1921

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_1149771 Ga0496114_1149771_193_645 138
2 3300046472 Ga0495580_0101940 Ga0495580_0101940_883_1422 158
3 3300048905 Ga0496102_0099345 Ga0496102_0099345_1187_1726 158
4 3300048921 Ga0496118_0080717 Ga0496118_0080717_802_1341 158
5 3300031249 Ga0265339_10040951 Ga0265339_100409512 162
6 3300031344 Ga0265316_10225453 Ga0265316_102254532 162
7 3300035171 Ga0373946_0330221 Ga0373946_0330221_62_589 163
8 3300005336 Ga0070680_100511333 Ga0070680_1005113332 166
9 3300005458 Ga0070681_10268525 Ga0070681_102685252 166
10 3300005530 Ga0070679_100127755 Ga0070679_1001277552 166
11 3300005563 Ga0068855_100888572 Ga0068855_1008885721 166
12 3300005842 Ga0068858_100460839 Ga0068858_1004608392 166
13 3300009174 Ga0105241_10867877 Ga0105241_108678772 166
14 3300013104 Ga0157370_10024505 Ga0157370_100245053 166
15 3300025921 Ga0207652_10138274 Ga0207652_101382742 166
16 3300025949 Ga0207667_10146184 Ga0207667_101461843 166
17 3300026035 Ga0207703_10229684 Ga0207703_102296842 166
18 3300049571 Ga0501034_0023355 Ga0501034_0023355_4747_5262 166
19 3300049579 Ga0501043_0365230 Ga0501043_0365230_477_992 166
20 3300049580 Ga0501046_0116484 Ga0501046_0116484_336_851 166
21 3300049580 Ga0501046_0597256 Ga0501046_0597256_85_600 166
22 3300049581 Ga0501047_0010533 Ga0501047_0010533_106_621 166
23 3300049581 Ga0501047_0014855 Ga0501047_0014855_4678_5193 166
24 3300049586 Ga0501070_0080497 Ga0501070_0080497_1241_1753 166
25 3300049586 Ga0501070_0843271 Ga0501070_0843271_142_657 166
26 3300049589 Ga0501073_0084040 Ga0501073_0084040_559_1071 166
27 3300049590 Ga0501074_0035662 Ga0501074_0035662_2424_2939 166
28 3300049590 Ga0501074_0135931 Ga0501074_0135931_453_968 166
29 3300049741 Ga0501079_0146194 Ga0501079_0146194_392_904 166
30 3300049742 Ga0501080_0000303 Ga0501080_0000303_34867_35382 166
31 3300049742 Ga0501080_0015424 Ga0501080_0015424_851_1366 166
32 3300049744 Ga0501083_0649649 Ga0501083_0649649_88_603 166
33 3300060353 Ga0501082_0018136 Ga0501082_0018136_234_749 166
34 3300005295 Ga0065707_10436918 Ga0065707_104369181 167
35 3300005327 Ga0070658_10027226 Ga0070658_100272264 167
36 3300005329 Ga0070683_100002653 Ga0070683_10000265313 167
37 3300005329 Ga0070683_100077527 Ga0070683_1000775272 167
38 3300005329 Ga0070683_100081484 Ga0070683_1000814843 167
39 3300005329 Ga0070683_100092836 Ga0070683_1000928362 167
40 3300005329 Ga0070683_100369576 Ga0070683_1003695762 167
41 3300005331 Ga0070670_100046058 Ga0070670_1000460585 167
42 3300005333 Ga0070677_10080657 Ga0070677_100806571 167
43 3300005334 Ga0068869_100016970 Ga0068869_1000169702 167
44 3300005335 Ga0070666_10042346 Ga0070666_100423463 167
45 3300005336 Ga0070680_100002400 Ga0070680_10000240010 167
46 3300005336 Ga0070680_100027729 Ga0070680_1000277293 167
47 3300005336 Ga0070680_100495480 Ga0070680_1004954802 167
48 3300005338 Ga0068868_100081556 Ga0068868_1000815562 167
49 3300005338 Ga0068868_100081703 Ga0068868_1000817032 167
50 3300005339 Ga0070660_100001007 Ga0070660_1000010072 167
51 3300005339 Ga0070660_100379302 Ga0070660_1003793023 167
52 3300005344 Ga0070661_100000558 Ga0070661_1000005586 167
53 3300005344 Ga0070661_100890481 Ga0070661_1008904812 167
54 3300005345 Ga0070692_10106281 Ga0070692_101062812 167
55 3300005347 Ga0070668_100136713 Ga0070668_1001367132 167
56 3300005354 Ga0070675_100328139 Ga0070675_1003281392 167
57 3300005367 Ga0070667_100232980 Ga0070667_1002329803 167
58 3300005436 Ga0070713_100051630 Ga0070713_1000516302 167
59 3300005436 Ga0070713_100128057 Ga0070713_1001280572 167
60 3300005439 Ga0070711_100428074 Ga0070711_1004280742 167
61 3300005444 Ga0070694_100410349 Ga0070694_1004103492 167
62 3300005456 Ga0070678_100063803 Ga0070678_1000638033 167
63 3300005456 Ga0070678_101006503 Ga0070678_1010065031 167
64 3300005457 Ga0070662_100024935 Ga0070662_1000249352 167
65 3300005458 Ga0070681_10011416 Ga0070681_100114168 167
66 3300005458 Ga0070681_10011526 Ga0070681_100115264 167
67 3300005458 Ga0070681_10094207 Ga0070681_100942072 167
68 3300005458 Ga0070681_10102224 Ga0070681_101022242 167
69 3300005458 Ga0070681_10258551 Ga0070681_102585512 167
70 3300005518 Ga0070699_100063380 Ga0070699_1000633802 167
71 3300005518 Ga0070699_101093880 Ga0070699_1010938802 167
72 3300005530 Ga0070679_100000289 Ga0070679_1000002892 167
73 3300005530 Ga0070679_100030866 Ga0070679_1000308668 167
74 3300005530 Ga0070679_100181923 Ga0070679_1001819231 167
75 3300005530 Ga0070679_100368793 Ga0070679_1003687932 167
76 3300005535 Ga0070684_100031600 Ga0070684_1000316004 167
77 3300005535 Ga0070684_100041571 Ga0070684_1000415714 167
78 3300005539 Ga0068853_100079563 Ga0068853_1000795632 167
79 3300005543 Ga0070672_100010784 Ga0070672_1000107845 167
80 3300005545 Ga0070695_100120736 Ga0070695_1001207362 167
81 3300005546 Ga0070696_100463367 Ga0070696_1004633671 167
82 3300005548 Ga0070665_100106460 Ga0070665_1001064604 167
83 3300005563 Ga0068855_100010788 Ga0068855_1000107888 167
84 3300005563 Ga0068855_100029363 Ga0068855_10002936311 167
85 3300005563 Ga0068855_100037860 Ga0068855_1000378603 167
86 3300005563 Ga0068855_100115859 Ga0068855_1001158593 167
87 3300005563 Ga0068855_100383397 Ga0068855_1003833972 167
88 3300005563 Ga0068855_100422988 Ga0068855_1004229882 167
89 3300005563 Ga0068855_100464987 Ga0068855_1004649872 167
90 3300005563 Ga0068855_100556752 Ga0068855_1005567522 167
91 3300005564 Ga0070664_100000031 Ga0070664_10000003128 167
92 3300005564 Ga0070664_100136424 Ga0070664_1001364243 167
93 3300005577 Ga0068857_100112449 Ga0068857_1001124491 167
94 3300005577 Ga0068857_100180185 Ga0068857_1001801852 167
95 3300005578 Ga0068854_100105007 Ga0068854_1001050072 167
96 3300005614 Ga0068856_100006935 Ga0068856_1000069352 167
97 3300005614 Ga0068856_100954449 Ga0068856_1009544491 167
98 3300005616 Ga0068852_100000419 Ga0068852_10000041911 167
99 3300005616 Ga0068852_100004388 Ga0068852_1000043888 167
100 3300005616 Ga0068852_100228912 Ga0068852_1002289122 167
101 3300005616 Ga0068852_100254661 Ga0068852_1002546612 167
102 3300005618 Ga0068864_100113933 Ga0068864_1001139333 167
103 3300005718 Ga0068866_10016342 Ga0068866_100163422 167
104 3300005719 Ga0068861_100008740 Ga0068861_1000087404 167
105 3300005834 Ga0068851_10192018 Ga0068851_101920182 167
106 3300005840 Ga0068870_10005393 Ga0068870_100053934 167
107 3300005841 Ga0068863_100247459 Ga0068863_1002474593 167
108 3300005842 Ga0068858_100083390 Ga0068858_1000833904 167
109 3300005844 Ga0068862_100003806 Ga0068862_10000380610 167
110 3300005844 Ga0068862_100157739 Ga0068862_1001577392 167
111 3300006173 Ga0070716_100097098 Ga0070716_1000970982 167
112 3300006237 Ga0097621_100229386 Ga0097621_1002293863 167
113 3300006237 Ga0097621_100409053 Ga0097621_1004090532 167
114 3300006358 Ga0068871_100083438 Ga0068871_1000834383 167
115 3300006844 Ga0075428_100058770 Ga0075428_1000587704 167
116 3300006846 Ga0075430_100033935 Ga0075430_1000339352 167
117 3300006847 Ga0075431_100009013 Ga0075431_1000090132 167
118 3300006880 Ga0075429_100113295 Ga0075429_1001132952 167
119 3300009093 Ga0105240_10000313 Ga0105240_1000031350 167
120 3300009093 Ga0105240_10001599 Ga0105240_1000159927 167
121 3300009093 Ga0105240_10003744 Ga0105240_1000374422 167
122 3300009093 Ga0105240_10055209 Ga0105240_100552095 167
123 3300009093 Ga0105240_10370367 Ga0105240_103703672 167
124 3300009093 Ga0105240_10445422 Ga0105240_104454222 167
125 3300009093 Ga0105240_10604207 Ga0105240_106042073 167
126 3300009094 Ga0111539_10073356 Ga0111539_100733562 167
127 3300009098 Ga0105245_10119710 Ga0105245_101197103 167
128 3300009101 Ga0105247_10008699 Ga0105247_100086996 167
129 3300009101 Ga0105247_10033413 Ga0105247_100334133 167
130 3300009174 Ga0105241_10165129 Ga0105241_101651291 167
131 3300009174 Ga0105241_10330624 Ga0105241_103306243 167
132 3300009174 Ga0105241_10618696 Ga0105241_106186962 167
133 3300009176 Ga0105242_10180702 Ga0105242_101807023 167
134 3300009545 Ga0105237_10058191 Ga0105237_100581913 167
135 3300009545 Ga0105237_10089184 Ga0105237_100891844 167
136 3300009545 Ga0105237_10107001 Ga0105237_101070013 167
137 3300009545 Ga0105237_10173220 Ga0105237_101732203 167
138 3300009551 Ga0105238_10037348 Ga0105238_100373484 167
139 3300009551 Ga0105238_10108609 Ga0105238_101086092 167
140 3300009551 Ga0105238_10284574 Ga0105238_102845742 167
141 3300009551 Ga0105238_11222077 Ga0105238_112220772 167
142 3300009553 Ga0105249_10147931 Ga0105249_101479315 167
143 3300010375 Ga0105239_10061687 Ga0105239_100616873 167
144 3300010375 Ga0105239_11326672 Ga0105239_113266721 167
145 3300011119 Ga0105246_10027745 Ga0105246_100277452 167
146 3300013102 Ga0157371_10006475 Ga0157371_100064752 167
147 3300013102 Ga0157371_10636715 Ga0157371_106367152 167
148 3300013104 Ga0157370_10000890 Ga0157370_1000089027 167
149 3300013104 Ga0157370_10001159 Ga0157370_1000115928 167
150 3300013104 Ga0157370_10309975 Ga0157370_103099752 167
151 3300013104 Ga0157370_11096460 Ga0157370_110964602 167
152 3300013105 Ga0157369_10001971 Ga0157369_1000197113 167
153 3300013105 Ga0157369_10012332 Ga0157369_100123323 167
154 3300013105 Ga0157369_10075816 Ga0157369_100758162 167
155 3300013105 Ga0157369_10191681 Ga0157369_101916811 167
156 3300013105 Ga0157369_10193284 Ga0157369_101932843 167
157 3300013105 Ga0157369_10200695 Ga0157369_102006952 167
158 3300013105 Ga0157369_10635937 Ga0157369_106359372 167
159 3300013296 Ga0157374_10409986 Ga0157374_104099862 167
160 3300013297 Ga0157378_10137428 Ga0157378_101374282 167
161 3300013307 Ga0157372_10000389 Ga0157372_1000038932 167
162 3300013307 Ga0157372_10002980 Ga0157372_1000298012 167
163 3300013307 Ga0157372_10167664 Ga0157372_101676644 167
164 3300013307 Ga0157372_10444858 Ga0157372_104448581 167
165 3300013307 Ga0157372_10535361 Ga0157372_105353612 167
166 3300013307 Ga0157372_12172343 Ga0157372_121723431 167
167 3300013308 Ga0157375_11394229 Ga0157375_113942291 167
168 3300014326 Ga0157380_10006498 Ga0157380_100064988 167
169 3300014968 Ga0157379_10288409 Ga0157379_102884092 167
170 3300014968 Ga0157379_10302239 Ga0157379_103022392 167
171 3300014968 Ga0157379_10457475 Ga0157379_104574752 167
172 3300017792 Ga0163161_10028222 Ga0163161_100282224 167
173 3300021358 Ga0213873_10125797 Ga0213873_101257971 167
174 3300025321 Ga0207656_10356125 Ga0207656_103561252 167
175 3300025899 Ga0207642_10321350 Ga0207642_103213502 167
176 3300025900 Ga0207710_10240328 Ga0207710_102403282 167
177 3300025906 Ga0207699_10004009 Ga0207699_100040091 167
178 3300025907 Ga0207645_10000489 Ga0207645_1000048918 167
179 3300025907 Ga0207645_10130756 Ga0207645_101307562 167
180 3300025908 Ga0207643_10008148 Ga0207643_100081482 167
181 3300025908 Ga0207643_10312742 Ga0207643_103127421 167
182 3300025909 Ga0207705_10129191 Ga0207705_101291912 167
183 3300025911 Ga0207654_10282114 Ga0207654_102821142 167
184 3300025912 Ga0207707_10009440 Ga0207707_100094403 167
185 3300025912 Ga0207707_10101333 Ga0207707_101013332 167
186 3300025912 Ga0207707_10217902 Ga0207707_102179022 167
187 3300025912 Ga0207707_10326077 Ga0207707_103260772 167
188 3300025913 Ga0207695_10000035 Ga0207695_10000035136 167
189 3300025913 Ga0207695_10002075 Ga0207695_1000207520 167
190 3300025913 Ga0207695_10275190 Ga0207695_102751901 167
191 3300025913 Ga0207695_10280454 Ga0207695_102804542 167
192 3300025913 Ga0207695_10594735 Ga0207695_105947352 167
193 3300025913 Ga0207695_10732536 Ga0207695_107325361 167
194 3300025914 Ga0207671_10107155 Ga0207671_101071552 167
195 3300025914 Ga0207671_10149282 Ga0207671_101492822 167
196 3300025917 Ga0207660_10017745 Ga0207660_100177454 167
197 3300025917 Ga0207660_10047168 Ga0207660_100471682 167
198 3300025917 Ga0207660_10253387 Ga0207660_102533872 167
199 3300025917 Ga0207660_10537151 Ga0207660_105371512 167
200 3300025919 Ga0207657_10003311 Ga0207657_1000331114 167
201 3300025920 Ga0207649_10001460 Ga0207649_100014609 167
202 3300025921 Ga0207652_10000495 Ga0207652_1000049513 167
203 3300025921 Ga0207652_10020397 Ga0207652_100203972 167
204 3300025921 Ga0207652_10270434 Ga0207652_102704342 167
205 3300025921 Ga0207652_10722246 Ga0207652_107222462 167
206 3300025923 Ga0207681_10213243 Ga0207681_102132432 167
207 3300025923 Ga0207681_10724689 Ga0207681_107246892 167
208 3300025924 Ga0207694_10011564 Ga0207694_100115642 167
209 3300025925 Ga0207650_10295802 Ga0207650_102958022 167
210 3300025929 Ga0207664_10772438 Ga0207664_107724382 167
211 3300025933 Ga0207706_10000977 Ga0207706_100009778 167
212 3300025933 Ga0207706_10310630 Ga0207706_103106302 167
213 3300025937 Ga0207669_10262494 Ga0207669_102624942 167
214 3300025938 Ga0207704_10103280 Ga0207704_101032803 167
215 3300025939 Ga0207665_10180155 Ga0207665_101801552 167
216 3300025940 Ga0207691_10004423 Ga0207691_100044237 167
217 3300025941 Ga0207711_10079575 Ga0207711_100795752 167
218 3300025942 Ga0207689_10022205 Ga0207689_100222056 167
219 3300025944 Ga0207661_10061098 Ga0207661_100610983 167
220 3300025944 Ga0207661_10091045 Ga0207661_100910452 167
221 3300025944 Ga0207661_10149690 Ga0207661_101496902 167
222 3300025944 Ga0207661_10175543 Ga0207661_101755432 167
223 3300025945 Ga0207679_10000127 Ga0207679_1000012736 167
224 3300025945 Ga0207679_10095297 Ga0207679_100952973 167
225 3300025949 Ga0207667_10000121 Ga0207667_1000012149 167
226 3300025949 Ga0207667_10003471 Ga0207667_1000347112 167
227 3300025949 Ga0207667_10054196 Ga0207667_100541963 167
228 3300025949 Ga0207667_10196309 Ga0207667_101963093 167
229 3300025949 Ga0207667_10246924 Ga0207667_102469242 167
230 3300025949 Ga0207667_10482278 Ga0207667_104822782 167
231 3300025960 Ga0207651_10787480 Ga0207651_107874802 167
232 3300025972 Ga0207668_10023694 Ga0207668_100236944 167
233 3300025972 Ga0207668_10092984 Ga0207668_100929842 167
234 3300025986 Ga0207658_10160986 Ga0207658_101609862 167
235 3300026035 Ga0207703_10168185 Ga0207703_101681851 167
236 3300026067 Ga0207678_10346968 Ga0207678_103469682 167
237 3300026078 Ga0207702_10028212 Ga0207702_100282122 167
238 3300026078 Ga0207702_10300157 Ga0207702_103001572 167
239 3300026078 Ga0207702_10388219 Ga0207702_103882192 167
240 3300026089 Ga0207648_10037022 Ga0207648_100370222 167
241 3300026116 Ga0207674_10204318 Ga0207674_102043182 167
242 3300026118 Ga0207675_100000202 Ga0207675_1000002026 167
243 3300026121 Ga0207683_10000920 Ga0207683_1000092021 167
244 3300026121 Ga0207683_11289463 Ga0207683_112894631 167
245 3300026142 Ga0207698_10000575 Ga0207698_100005757 167
246 3300026142 Ga0207698_10037359 Ga0207698_100373593 167
247 3300027252 Ga0209973_1005015 Ga0209973_10050152 167
248 3300027364 Ga0209967_1006867 Ga0209967_10068672 167
249 3300027424 Ga0209984_1004617 Ga0209984_10046172 167
250 3300027552 Ga0209982_1012926 Ga0209982_10129262 167
251 3300027614 Ga0209970_1005089 Ga0209970_10050892 167
252 3300027617 Ga0210002_1005689 Ga0210002_10056892 167
253 3300027682 Ga0209971_1004876 Ga0209971_10048762 167
254 3300027717 Ga0209998_10037015 Ga0209998_100370152 167
255 3300027876 Ga0209974_10045031 Ga0209974_100450313 167
256 3300028380 Ga0268265_10003863 Ga0268265_100038632 167
257 3300028380 Ga0268265_10154678 Ga0268265_101546783 167
258 3300031456 Ga0307513_10305372 Ga0307513_103053721 167
259 3300031548 Ga0307408_100375835 Ga0307408_1003758351 167
260 3300031727 Ga0316576_10410392 Ga0316576_104103922 167
261 3300032002 Ga0307416_100324851 Ga0307416_1003248512 167
262 3300035118 Ga0373954_0132408 Ga0373954_0132408_643_1182 167
263 3300035398 Ga0316574_0022831 Ga0316574_0022831_682_1218 167
264 3300035695 Ga0373927_0014804 Ga0373927_0014804_101_640 167
265 3300035725 Ga0373947_0233130 Ga0373947_0233130_181_720 167
266 3300037312 Ga0395899_0646629 Ga0395899_0646629_94_630 167
267 3300037418 Ga0395900_0753639 Ga0395900_0753639_224_760 167
268 3300037466 Ga0395898_0192225 Ga0395898_0192225_1315_1863 167
269 3300037466 Ga0395898_0267635 Ga0395898_0267635_1073_1600 167
270 3300038443 Ga0395901_1593145 Ga0395901_1593145_13_540 167
271 3300039438 Ga0436360_1369309 Ga0436360_1369309_569_1123 167
272 3300039453 Ga0436362_1250422 Ga0436362_1250422_228_761 167
273 3300042134 Ga0450898_020157 Ga0450898_020157_296_799 167
274 3300042876 Ga0451577_0006196 Ga0451577_0006196_4652_5164 167
275 3300044706 Ga0466964_0001846 Ga0466964_0001846_1351_1893 167
276 3300044712 Ga0453684_0061957 Ga0453684_0061957_771_1283 167
277 3300044719 Ga0466971_0000216 Ga0466971_0000216_3833_4375 167
278 3300044735 Ga0466968_0027460 Ga0466968_0027460_204_746 167
279 3300044842 Ga0466957_0013272 Ga0466957_0013272_3094_3636 167
280 3300045051 Ga0451576_0007174 Ga0451576_0007174_2102_2614 167
281 3300045051 Ga0451576_0881402 Ga0451576_0881402_285_797 167
282 3300046454 Ga0495592_0497984 Ga0495592_0497984_193_732 167
283 3300046472 Ga0495580_0041108 Ga0495580_0041108_2725_3264 167
284 3300046517 Ga0495630_0498672 Ga0495630_0498672_134_673 167
285 3300046675 Ga0495657_0232022 Ga0495657_0232022_550_1089 167
286 3300047315 Ga0495581_0507510 Ga0495581_0507510_86_625 167
287 3300048907 Ga0496104_0025773 Ga0496104_0025773_2044_2583 167
288 3300048908 Ga0496105_0039515 Ga0496105_0039515_3184_3705 167
289 3300048910 Ga0496107_0745843 Ga0496107_0745843_143_661 167
290 3300048913 Ga0496110_0022106 Ga0496110_0022106_777_1316 167
291 3300048918 Ga0496115_0241590 Ga0496115_0241590_146_658 167
292 3300048929 Ga0496126_0016341 Ga0496126_0016341_2303_2857 167
293 3300048929 Ga0496126_0609721 Ga0496126_0609721_140_646 167
294 3300049572 Ga0501036_0127307 Ga0501036_0127307_1564_2067 167
295 3300049576 Ga0501040_0192881 Ga0501040_0192881_755_1258 167
296 3300049582 Ga0501048_0118532 Ga0501048_0118532_1023_1526 167
297 3300049588 Ga0501072_0157706 Ga0501072_0157706_1224_1727 167
298 3300049591 Ga0501075_0211638 Ga0501075_0211638_173_676 167
299 3300049592 Ga0501076_0082697 Ga0501076_0082697_1927_2430 167
300 3300049680 Ga0501250_025363 Ga0501250_025363_160_672 167
301 3300049682 Ga0501252_019367 Ga0501252_019367_156_668 167
302 3300049742 Ga0501080_0287121 Ga0501080_0287121_566_1087 167
303 3300049744 Ga0501083_0343800 Ga0501083_0343800_330_851 167
304 3300053078 Ga0495612_0034773 Ga0495612_0034773_547_1116 167
305 3300053092 Ga0500583_0340111 Ga0500583_0340111_22_537 167
306 3300053096 Ga0500641_0199822 Ga0500641_0199822_267_812 167
307 3300053123 Ga0500614_023190 Ga0500614_023190_413_928 167
308 3300053146 Ga0500588_0000189 Ga0500588_0000189_5985_6500 167
309 3300053153 Ga0500616_0037011 Ga0500616_0037011_1835_2401 167
310 3300053178 Ga0500637_0020184 Ga0500637_0020184_916_1437 167
311 3300061719 Ga0466962_0014106 Ga0466962_0014106_2971_3513 167
312 3300061719 Ga0466962_0053956 Ga0466962_0053956_1228_1767 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

67

178

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cfw-assembly1.cif.gz_J cryoem structure of a respiratory membrane-bound hydrogenase 0.8479 36 166
7nz1-assembly1.cif.gz_B respiratory complex i from escherichia coli - focused refinement of cytoplasmic arm 0.8179 47 162
7q5y-assembly4.cif.gz_X structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus 0.8065 42 162
6ziy-assembly1.cif.gz_6 respiratory complex i from thermus thermophilus, nadh dataset, major state 0.7876 28 166
7p7k-assembly1.cif.gz_B complex i from e. coli, ddm/lmng-purified, with dq, resting state 0.7848 29 166
ID Description Score Start End Superfamily
6cfwJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8479 36 166 3.40.50.12280
af_I6XUD2_20_159_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8465 41 167 3.40.50.12280
af_P77668_14_171_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8412 22 166 3.40.50.12280
af_Q57936_1_148_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.813 34 166 3.40.50.12280
6cfwJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7782 36 166 3.40.50.12280
ID Description Score Start End GO Terms
AF-A0A3D5BXF0-F1-model_v4 NADH:ubiquinone oxidoreductase-like 20kDa subunit domain-containing protein 0.8909 26 166 GO:0051539
AF-A0A7V7WGZ4-F1-model_v4 Formate hydrogenlyase 0.8902 41 166 GO:0016829
GO:0051539
AF-A0A850SI50-F1-model_v4 NADH-quinone oxidoreductase subunit NuoB (EC 1.6.5.11) 0.8874 27 167 GO:0008137
GO:0048038
GO:0051539
AF-A0A800BTY2-F1-model_v4 NADH-quinone oxidoreductase subunit B 0.8852 41 166 GO:0008137
GO:0046872
GO:0048038
GO:0051539
AF-A0A2C6MH50-F1-model_v4 NADH dehydrogenase 0.8843 19 166 GO:0051539

Feature Viewer

pLDDT pTM Quality
82.53 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map