F401792

General Info

Members Datasets Scaffolds Average Seq Length
312 201 624 457

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0033992|Ga0395900_0033992_2144_3673
Length 509
Sequence MGAGIRVAPSRAQREKRDADVVAPATCDNAAMHAPPSPHPPIITDADGWRSRDLAVLWHPCTQMREHMLEGASGDGRRGHAMPLVPIARGEGAWLVGQDGRRYLDAVSSWWTNLFGHGEPRIAEAIATQARTLEQVILAGFSHMPAVELAERLLALAPRQPDRAPLAKVFYADNGSAGVEVALKMAFHWFRNRGETARTKFVALENGYHGETLGALAVGDIPLYRRVYAPLLAEALFAPSPDAFMAEPGETAAQCAERAADALAALLARHAGEVCALILEPRVQCAGGMRMHDPAYLRRARALCDAHGVFLIADEIAVGFGRTGTLFASEQSGVMPDLLCLSKGLTGGFLPLAAVLATQQLYDGFLDDSRERAFLHSHSYTGNPLACAAALASLSIFDSDDVLARNRGTAGRMAALAAPMGELPHVADVRQAGMIVAFELAPGGDRRAAFDPALRVGLRAYRAALERGVVLRPLGDILYWMPPYCIDEAQLQLLADTTRAAILEATACA

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
43 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
73 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
74 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
86 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
87 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
88 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
89 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
90 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
91 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
92 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
93 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
96 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
97 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
98 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
107 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
146 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
147 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
148 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
149 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
150 2643221559 Lysobacter sp. Root559 Isolate Unclassified
151 2643221573 Lysobacter sp. Root604 Isolate Unclassified
152 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
153 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
154 2643221586 Lysobacter sp. Root667 Isolate Unclassified
155 2643221593 Lysobacter sp. Root690 Isolate Unclassified
156 2643221612 Lysobacter sp. Root76 Isolate Unclassified
157 2643221695 Lysobacter sp. Root494 Isolate Unclassified
158 2643221720 Lysobacter sp. Root916 Isolate Unclassified
159 2643221727 Lysobacter sp. Root96 Isolate Unclassified
160 2643221728 Lysobacter sp. Root983 Isolate Unclassified
161 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
162 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
163 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
164 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
165 2818991457 Xanthomonas translucens 569 Isolate Unclassified
166 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
167 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
168 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
169 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
170 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
171 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
172 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
173 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
174 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
175 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
176 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
177 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
178 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
179 2919513703 Luteimonas sp. 3794 Isolate Unclassified
180 2919675420 Luteimonas terrae 4099 Isolate Unclassified
181 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
182 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
183 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
184 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
185 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
186 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
187 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
188 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
189 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
190 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
191 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
192 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
193 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
194 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
195 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
196 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
197 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
198 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
199 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
200 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
201 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.05
Metatranscriptomes 0
Isolates 17.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 25
Nodule 0.32
Rhizoplane 2.24
Rhizosphere 49.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0033992 3300037418 Bacteria 5248
2 SwRhRL2b_contig_221884 2162886007 Bacteria 5498
3 JGI25152J39213_1000061 3300002773 Bacteria 73011
4 JGI25152J39213_1000126 3300002773 Bacteria 52109
5 JGI25150J39212_1000180 3300002774 Bacteria 35477
6 JGI25151J46595_10000177 3300003187 Bacteria 81432
7 JGI25151J46595_10000361 3300003187 Bacteria 47909
8 JGI25151J46595_10014322 3300003187 Bacteria 3536
9 JGI25153J46596_10000130 3300003215 Bacteria 81432
10 rootH2_10008711 3300003320 Bacteria 6134
11 Ga0055526_1000072 3300003771 Bacteria 94464
12 Ga0055526_1000147 3300003771 Bacteria 62211
13 Ga0055537_1000085 3300003773 Bacteria 67908
14 Ga0055537_1000412 3300003773 Bacteria 28027
15 Ga0055524_1000173 3300003775 Bacteria 73388
16 Ga0055524_1023432 3300003775 Bacteria 1987
17 Ga0055536_1000521 3300003781 Bacteria 26542
18 Ga0055536_1004631 3300003781 Bacteria 6963
19 Ga0055536_1010220 3300003781 Bacteria 3756
20 Ga0055534_1000077 3300003784 Bacteria 76400
21 Ga0055534_1000113 3300003784 Bacteria 59704
22 Ga0055528_1000085 3300003790 Bacteria 73426
23 Ga0055528_1002862 3300003790 Bacteria 8987
24 Ga0055530_10003178 3300003791 Bacteria 9641
25 Ga0055530_10003463 3300003791 Bacteria 8962
26 Ga0055530_10025101 3300003791 Bacteria 1673
27 Ga0055531_10009552 3300003794 Bacteria 4946
28 Ga0055531_10019392 3300003794 Bacteria 2753
29 Ga0055531_10019995 3300003794 Bacteria 2673
30 Ga0058692_1000011 3300003856 Bacteria 321321
31 Ga0058692_1000015 3300003856 Bacteria 295729
32 Ga0065704_10070923 3300005289 Bacteria 14558
33 Ga0065715_10142641 3300005293 Bacteria 1830
34 Ga0070670_100005498 3300005331 Bacteria 10695
35 Ga0070669_100011739 3300005353 Bacteria 6214
36 Ga0070671_100115342 3300005355 Bacteria 2258
37 Ga0070674_100096027 3300005356 Bacteria 2150
38 Ga0068853_100020368 3300005539 Bacteria 5516
39 Ga0070672_100007671 3300005543 Bacteria 7344
40 Ga0070693_100008577 3300005547 Bacteria 5049
41 Ga0070665_100068834 3300005548 Bacteria 3548
42 Ga0070665_100072802 3300005548 Bacteria 3443
43 Ga0068864_100077027 3300005618 Bacteria 2915
44 Ga0081539_10028040 3300005985 Bacteria 3550
45 Ga0075364_10069158 3300006051 Bacteria 2323
46 Ga0075367_10032436 3300006178 Bacteria 3006
47 Ga0105251_10020582 3300009011 Bacteria 3463
48 Ga0105243_10015815 3300009148 Bacteria 5707
49 Ga0105032_100071 3300009979 Bacteria 11396
50 Ga0157373_10146027 3300013100 Bacteria 1664
51 Ga0157373_10151573 3300013100 Bacteria 1631
52 Ga0157371_10001197 3300013102 Bacteria 27801
53 Ga0157371_10011929 3300013102 Bacteria 6665
54 Ga0157371_10093269 3300013102 Bacteria 2133
55 Ga0157370_10005494 3300013104 Bacteria 14213
56 Ga0157369_10127381 3300013105 Bacteria 2698
57 Ga0157378_10099511 3300013297 Bacteria 2653
58 Ga0182008_10000640 3300014497 Bacteria 25569
59 Ga0182008_10010122 3300014497 Bacteria 5057
60 Ga0182006_1044797 3300015261 Bacteria 1724
61 Ga0182007_10000026 3300015262 Bacteria 168694
62 Ga0182005_1000473 3300015265 Bacteria 20871
63 Ga0182005_1003337 3300015265 Bacteria 5474
64 Ga0183360_10001 3300015689 Bacteria 3943671
65 Ga0163161_10001795 3300017792 Bacteria 15661
66 Ga0163161_10004161 3300017792 Bacteria 10115
67 Ga0207425_1000066 3300025245 Bacteria 125463
68 Ga0207425_1002465 3300025245 Bacteria 6496
69 Ga0209129_1000135 3300025258 Bacteria 125520
70 Ga0209565_1000001 3300025263 Bacteria 2950419
71 Ga0209565_1000023 3300025263 Bacteria 388244
72 Ga0209673_1000001 3300025273 Bacteria 3176258
73 Ga0209673_1000116 3300025273 Bacteria 175933
74 Ga0209673_1004470 3300025273 Bacteria 7479
75 Ga0209130_1003179 3300025284 Bacteria 7252
76 Ga0209675_1000001 3300025291 Bacteria 2950293
77 Ga0209675_1000154 3300025291 Bacteria 89426
78 Ga0209676_1000129 3300025292 Bacteria 187495
79 Ga0209676_1000189 3300025292 Bacteria 141166
80 Ga0209676_1000339 3300025292 Bacteria 89252
81 Ga0209676_1000352 3300025292 Bacteria 87022
82 Ga0209676_1000742 3300025292 Bacteria 44232
83 Ga0209676_1001943 3300025292 Bacteria 16653
84 Ga0209676_1001947 3300025292 Bacteria 16626
85 Ga0209676_1005129 3300025292 Bacteria 6976
86 Ga0209676_1005501 3300025292 Bacteria 6588
87 Ga0209025_1000006 3300025294 Bacteria 1153444
88 Ga0209025_1000013 3300025294 Bacteria 871757
89 Ga0209025_1002378 3300025294 Bacteria 20139
90 Ga0209025_1052730 3300025294 Bacteria 1603
91 Ga0209564_1000001 3300025295 Bacteria 3176258
92 Ga0209564_1000106 3300025295 Bacteria 216131
93 Ga0209564_1018808 3300025295 Bacteria 2612
94 Ga0209758_1000014 3300025297 Bacteria 871757
95 Ga0209758_1015597 3300025297 Bacteria 3921
96 Ga0209050_1000338 3300025298 Bacteria 92924
97 Ga0209050_1002193 3300025298 Bacteria 17607
98 Ga0209050_1002440 3300025298 Bacteria 15951
99 Ga0209050_1005770 3300025298 Bacteria 7626
100 Ga0209256_1000006 3300025299 Bacteria 1250310
101 Ga0209256_1001432 3300025299 Bacteria 24710
102 Ga0209256_1006432 3300025299 Bacteria 6225
103 Ga0209051_1001118 3300025303 Bacteria 24497
104 Ga0209051_1019964 3300025303 Bacteria 2907
105 Ga0209257_1000062 3300025304 Bacteria 362413
106 Ga0209257_1000241 3300025304 Bacteria 127802
107 Ga0209257_1000343 3300025304 Bacteria 96876
108 Ga0209257_1000759 3300025304 Bacteria 48492
109 Ga0209257_1000802 3300025304 Bacteria 45783
110 Ga0209257_1001069 3300025304 Bacteria 36154
111 Ga0209257_1017586 3300025304 Bacteria 2805
112 Ga0207713_1018704 3300025735 Bacteria 3421
113 Ga0207662_10061513 3300025918 Bacteria 2254
114 Ga0207657_10023031 3300025919 Bacteria 5810
115 Ga0207652_10135777 3300025921 Bacteria 2197
116 Ga0207681_10006737 3300025923 Bacteria 7050
117 Ga0207706_10214665 3300025933 Bacteria 1686
118 Ga0207709_10000853 3300025935 Bacteria 23315
119 Ga0207709_10035374 3300025935 Bacteria 2952
120 Ga0207691_10004898 3300025940 Bacteria 12938
121 Ga0209371_1000007 3300027312 Bacteria 1050654
122 Ga0209371_1000011 3300027312 Bacteria 848456
123 Ga0209995_1002253 3300027471 Bacteria 3038
124 Ga0209974_10013597 3300027876 Bacteria 2711
125 Ga0268266_10046498 3300028379 Bacteria 3715
126 Ga0268265_10072848 3300028380 Bacteria 2681
127 Ga0268256_1000008 3300030500 Bacteria 1050654
128 Ga0268256_1000011 3300030500 Bacteria 848625
129 Ga0316176_1031032 3300030732 Bacteria 9743
130 Ga0316182_1094399 3300030745 Bacteria 2477
131 Ga0307513_10002077 3300031456 Bacteria 28129
132 Ga0307513_10179280 3300031456 Bacteria 1984
133 Ga0307408_100025050 3300031548 Bacteria 4082
134 Ga0307413_10000612 3300031824 Bacteria 11995
135 Ga0307413_10133464 3300031824 Bacteria 1703
136 Ga0307406_10001113 3300031901 Bacteria 14995
137 Ga0307406_10005194 3300031901 Bacteria 7111
138 Ga0307412_10000891 3300031911 Bacteria 17184
139 Ga0307412_10077593 3300031911 Bacteria 2285
140 Ga0307414_10000419 3300032004 Bacteria 22890
141 Ga0307414_10000786 3300032004 Bacteria 16189
142 Ga0307414_10000817 3300032004 Bacteria 15911
143 Ga0307414_10007814 3300032004 Bacteria 6032
144 Ga0307414_10021365 3300032004 Bacteria 4059
145 Ga0307414_10028326 3300032004 Bacteria 3632
146 Ga0307414_10103163 3300032004 Bacteria 2151
147 Ga0307414_10137308 3300032004 Bacteria 1908
148 Ga0307414_10138862 3300032004 Bacteria 1899
149 Ga0307411_10002372 3300032005 Bacteria 8289
150 Ga0307411_10043916 3300032005 Bacteria 2863
151 Ga0395898_0127721 3300037466 Bacteria 2436
152 Ga0395905_0010224 3300037471 Bacteria 9144
153 Ga0395905_0012366 3300037471 Bacteria 8216
154 Ga0395901_0005945 3300038443 Bacteria 12360
155 Ga0237819_00312 3300038705 Bacteria 17856
156 Ga0439436_0001383 3300041404 Bacteria 7000
157 Ga0439439_0000612 3300041406 Bacteria 6286
158 Ga0439447_000511 3300041407 Bacteria 14435
159 Ga0439465_0000228 3300041413 Bacteria 15171
160 Ga0451793_1563625 3300041452 Bacteria 2733
161 Ga0451800_0771528 3300041459 Bacteria 2893
162 Ga0451804_0822332 3300041463 Bacteria 3028
163 Ga0451807_1470259 3300041486 Bacteria 1782
164 Ga0451853_1281237 3300041512 Bacteria 1510
165 Ga0439445_0002285 3300042004 Bacteria 4253
166 Ga0439432_003171 3300042006 Bacteria 6116
167 Ga0439432_009874 3300042006 Bacteria 3320
168 Ga0439432_016693 3300042006 Bacteria 2469
169 Ga0439449_0000758 3300042007 Bacteria 12399
170 Ga0439449_0010841 3300042007 Bacteria 3439
171 Ga0439449_0021000 3300042007 Bacteria 2446
172 Ga0439462_0006159 3300042015 Bacteria 2975
173 Ga0451577_0049156 3300042876 Bacteria 3766
174 Ga0453684_0000136 3300044712 Bacteria 323402
175 Ga0451576_0000025 3300045051 Bacteria 427980
176 Ga0466967_0113621 3300045976 Bacteria 2492
177 Ga0495638_0003232 3300046460 Bacteria 12884
178 Ga0495631_0006578 3300046518 Bacteria 5986
179 Ga0495643_0001702 3300046522 Bacteria 19104
180 Ga0495663_0001840 3300046525 Bacteria 6539
181 Ga0495656_0001146 3300046615 Bacteria 8596
182 Ga0495656_0013752 3300046615 Bacteria 3018
183 Ga0495668_0000741 3300046616 Bacteria 39039
184 Ga0495625_0028963 3300046660 Bacteria 4145
185 Ga0495671_0025807 3300046692 Bacteria 3051
186 Ga0495672_0001255 3300047320 Bacteria 25465
187 Ga0495672_0055062 3300047320 Bacteria 2322
188 Ga0495677_0020251 3300047445 Bacteria 2412
189 Ga0495686_0002192 3300047472 Bacteria 18987
190 Ga0495686_0011004 3300047472 Bacteria 6399
191 Ga0496105_0016360 3300048908 Bacteria 5921
192 Ga0496110_0198096 3300048913 Bacteria 1824
193 Ga0496114_0018460 3300048917 Bacteria 5639
194 Ga0496116_0000534 3300048919 Bacteria 51055
195 Ga0496116_0024452 3300048919 Bacteria 4468
196 Ga0496117_0000969 3300048920 Bacteria 43962
197 Ga0496117_0002121 3300048920 Bacteria 25987
198 Ga0496117_0003739 3300048920 Bacteria 17429
199 Ga0496117_0011685 3300048920 Bacteria 7836
200 Ga0496117_0020315 3300048920 Bacteria 5417
201 Ga0496118_0001996 3300048921 Bacteria 28924
202 Ga0496118_0002316 3300048921 Bacteria 25860
203 Ga0496118_0005003 3300048921 Bacteria 15313
204 Ga0496119_0002660 3300048922 Bacteria 19331
205 Ga0496119_0008133 3300048922 Bacteria 9285
206 Ga0496120_0000245 3300048923 Bacteria 92114
207 Ga0496120_0000561 3300048923 Bacteria 56621
208 Ga0496121_0000676 3300048924 Bacteria 63634
209 Ga0496121_0004221 3300048924 Bacteria 19586
210 Ga0496121_0006280 3300048924 Bacteria 14856
211 Ga0496121_0020512 3300048924 Bacteria 6535
212 Ga0496122_0000874 3300048925 Bacteria 56703
213 Ga0496122_0016430 3300048925 Bacteria 7003
214 Ga0496122_0031516 3300048925 Bacteria 4411
215 Ga0496122_0032191 3300048925 Bacteria 4342
216 Ga0496123_0000461 3300048926 Bacteria 71380
217 Ga0496123_0019839 3300048926 Bacteria 5278
218 Ga0496123_0030425 3300048926 Bacteria 3952
219 Ga0496123_0047346 3300048926 Bacteria 2906
220 Ga0496124_0002127 3300048927 Bacteria 26652
221 Ga0496124_0004852 3300048927 Bacteria 15470
222 Ga0496124_0007845 3300048927 Bacteria 11258
223 Ga0496124_0024906 3300048927 Bacteria 5429
224 Ga0496125_0010897 3300048928 Bacteria 9142
225 Ga0496125_0016608 3300048928 Bacteria 7059
226 Ga0496125_0026777 3300048928 Bacteria 5240
227 Ga0496125_0058435 3300048928 Bacteria 3115
228 Ga0496126_0002264 3300048929 Bacteria 26540
229 Ga0496126_0011579 3300048929 Bacteria 9106
230 Ga0496126_0019968 3300048929 Bacteria 6584
231 Ga0501290_001304 3300049513 Bacteria 3458
232 Ga0501031_0000922 3300049568 Bacteria 17740
233 Ga0501031_0026869 3300049568 Bacteria 3752
234 Ga0501033_0000799 3300049570 Bacteria 28871
235 Ga0501034_0000513 3300049571 Bacteria 62217
236 Ga0501034_0004197 3300049571 Bacteria 16085
237 Ga0501034_0049682 3300049571 Bacteria 4231
238 Ga0501036_0013331 3300049572 Bacteria 6827
239 Ga0501037_0001206 3300049573 Bacteria 19108
240 Ga0501038_0001851 3300049574 Bacteria 19540
241 Ga0501039_0051488 3300049575 Bacteria 3186
242 Ga0501043_0002271 3300049579 Bacteria 16349
243 Ga0501043_0042749 3300049579 Bacteria 3561
244 Ga0501047_0034348 3300049581 Bacteria 4896
245 Ga0501068_0037170 3300049584 Bacteria 2915
246 Ga0501252_002429 3300049682 Bacteria 1847
247 Ga0501080_0002101 3300049742 Bacteria 17301
248 Ga0501265_002132 3300049762 Bacteria 2252
249 Ga0501035_0001246 3300049822 Bacteria 26448
250 Ga0501044_0040023 3300049823 Bacteria 4887
251 Ga0501044_0062006 3300049823 Bacteria 3823
252 nmdc:mga00v17_26148_c1 3300050491 Bacteria 3398
253 nmdc:mga00v17_37058_c1 3300050491 Bacteria 2910
254 nmdc:mga00v17_57751_c1 3300050491 Bacteria 2375
255 nmdc:mga00v17_67768_c1 3300050491 Bacteria 2206
256 Ga0500634_0000107 3300053161 Bacteria 31282
257 2525556258 2524614729 Bacteria 3091755
258 2547503372 2547132130 Bacteria 4660562
259 2578457338 2576861471 Bacteria 4648976
260 2630649488 2627854209 Bacteria 3093011
261 2643815529 2643221559 Bacteria 4424915
262 2643881778 2643221573 Bacteria 4784121
263 2643907198 2643221579 Bacteria 4443405
264 2643915108 2643221581 Bacteria 3893603
265 2643941174 2643221586 Bacteria 4446529
266 2643976258 2643221593 Bacteria 6296053
267 2644079753 2643221612 Bacteria 4361984
268 2644530439 2643221695 Bacteria 3441323
269 2644663064 2643221720 Bacteria 4694283
270 2644696096 2643221727 Bacteria 4415595
271 2644699780 2643221728 Bacteria 4797149
272 2747950728 2747842428 Bacteria 4689383
273 2748016593 2747842501 Bacteria 5293829
274 2765580149 2765235840 Bacteria 4663337
275 2816518821 2816332141 Bacteria 4436036
276 2819660789 2818991457 Bacteria 5323295
277 2842393917 2842391507 Bacteria 4486072
278 2852652454 2852649853 Bacteria 4036942
279 2852686657 2852684882 Bacteria 5463342
280 2857444854 2857442823 Bacteria 4562550
281 2874222837 2874220319 Bacteria 4594709
282 2894414401 2894414249 Bacteria 4405451
283 2895501359 2895498888 Bacteria 5283788
284 2895514502 2895511927 Bacteria 6802080
285 2895524016 2895522137 Bacteria 3284416
286 2895527504 2895525241 Bacteria 3388457
287 2919092753 2919089067 Bacteria 4560942
288 2919132598 2919130084 Bacteria 5301837
289 2919138034 2919134579 Bacteria 4480386
290 2919515058 2919513703 Bacteria 3844312
291 2919676321 2919675420 Bacteria 3969095
292 2923519353 2923516293 Bacteria 3716336
293 2928499636 2928496128 Bacteria 4631123
294 2929196767 2929195423 Bacteria 5325372
295 2931383705 2931380184 Bacteria 4455911
296 2937615155 2937610967 Bacteria 4618818
297 2939589453 2939589442 Bacteria 4214238
298 2939626605 2939622612 Bacteria 4698046
299 2939629478 2939626828 Bacteria 4695272
300 2941479074 2941475908 Bacteria 4145589
301 2941490902 2941489479 Bacteria 6313767
302 2961049602 2961047084 Bacteria 4594415
303 2961066781 2961064222 Bacteria 4749990
304 2974307974 2974307012 Bacteria 4172388
305 2977248710 2977247770 Bacteria 4160543
306 2984516822 2984514374 Bacteria 4172479
307 2995950217 2995948881 Bacteria 6358104
308 8002871325 8002869464 Bacteria 3588529
309 8003015112 8003014200 Bacteria 4059994
310 8021623927 8021622325 Bacteria 4844743
311 8021629533 8021626552 Bacteria 4665214
312 8021648069 8021648035 Bacteria 4772378
313 Ga0395900_0033992
314 SwRhRL2b_contig_221884
315 JGI25152J39213_1000061
316 JGI25152J39213_1000126
317 JGI25150J39212_1000180
318 JGI25151J46595_10000177
319 JGI25151J46595_10000361
320 JGI25151J46595_10014322
321 JGI25153J46596_10000130
322 rootH2_10008711
323 Ga0055526_1000072
324 Ga0055526_1000147
325 Ga0055537_1000085
326 Ga0055537_1000412
327 Ga0055524_1000173
328 Ga0055524_1023432
329 Ga0055536_1000521
330 Ga0055536_1004631
331 Ga0055536_1010220
332 Ga0055534_1000077
333 Ga0055534_1000113
334 Ga0055528_1000085
335 Ga0055528_1002862
336 Ga0055530_10003178
337 Ga0055530_10003463
338 Ga0055530_10025101
339 Ga0055531_10009552
340 Ga0055531_10019392
341 Ga0055531_10019995
342 Ga0058692_1000011
343 Ga0058692_1000015
344 Ga0065704_10070923
345 Ga0065715_10142641
346 Ga0070670_100005498
347 Ga0070669_100011739
348 Ga0070671_100115342
349 Ga0070674_100096027
350 Ga0068853_100020368
351 Ga0070672_100007671
352 Ga0070693_100008577
353 Ga0070665_100068834
354 Ga0070665_100072802
355 Ga0068864_100077027
356 Ga0081539_10028040
357 Ga0075364_10069158
358 Ga0075367_10032436
359 Ga0105251_10020582
360 Ga0105243_10015815
361 Ga0105032_100071
362 Ga0157373_10146027
363 Ga0157373_10151573
364 Ga0157371_10001197
365 Ga0157371_10011929
366 Ga0157371_10093269
367 Ga0157370_10005494
368 Ga0157369_10127381
369 Ga0157378_10099511
370 Ga0182008_10000640
371 Ga0182008_10010122
372 Ga0182006_1044797
373 Ga0182007_10000026
374 Ga0182005_1000473
375 Ga0182005_1003337
376 Ga0183360_10001
377 Ga0163161_10001795
378 Ga0163161_10004161
379 Ga0207425_1000066
380 Ga0207425_1002465
381 Ga0209129_1000135
382 Ga0209565_1000001
383 Ga0209565_1000023
384 Ga0209673_1000001
385 Ga0209673_1000116
386 Ga0209673_1004470
387 Ga0209130_1003179
388 Ga0209675_1000001
389 Ga0209675_1000154
390 Ga0209676_1000129
391 Ga0209676_1000189
392 Ga0209676_1000339
393 Ga0209676_1000352
394 Ga0209676_1000742
395 Ga0209676_1001943
396 Ga0209676_1001947
397 Ga0209676_1005129
398 Ga0209676_1005501
399 Ga0209025_1000006
400 Ga0209025_1000013
401 Ga0209025_1002378
402 Ga0209025_1052730
403 Ga0209564_1000001
404 Ga0209564_1000106
405 Ga0209564_1018808
406 Ga0209758_1000014
407 Ga0209758_1015597
408 Ga0209050_1000338
409 Ga0209050_1002193
410 Ga0209050_1002440
411 Ga0209050_1005770
412 Ga0209256_1000006
413 Ga0209256_1001432
414 Ga0209256_1006432
415 Ga0209051_1001118
416 Ga0209051_1019964
417 Ga0209257_1000062
418 Ga0209257_1000241
419 Ga0209257_1000343
420 Ga0209257_1000759
421 Ga0209257_1000802
422 Ga0209257_1001069
423 Ga0209257_1017586
424 Ga0207713_1018704
425 Ga0207662_10061513
426 Ga0207657_10023031
427 Ga0207652_10135777
428 Ga0207681_10006737
429 Ga0207706_10214665
430 Ga0207709_10000853
431 Ga0207709_10035374
432 Ga0207691_10004898
433 Ga0209371_1000007
434 Ga0209371_1000011
435 Ga0209995_1002253
436 Ga0209974_10013597
437 Ga0268266_10046498
438 Ga0268265_10072848
439 Ga0268256_1000008
440 Ga0268256_1000011
441 Ga0316176_1031032
442 Ga0316182_1094399
443 Ga0307513_10002077
444 Ga0307513_10179280
445 Ga0307408_100025050
446 Ga0307413_10000612
447 Ga0307413_10133464
448 Ga0307406_10001113
449 Ga0307406_10005194
450 Ga0307412_10000891
451 Ga0307412_10077593
452 Ga0307414_10000419
453 Ga0307414_10000786
454 Ga0307414_10000817
455 Ga0307414_10007814
456 Ga0307414_10021365
457 Ga0307414_10028326
458 Ga0307414_10103163
459 Ga0307414_10137308
460 Ga0307414_10138862
461 Ga0307411_10002372
462 Ga0307411_10043916
463 Ga0395898_0127721
464 Ga0395905_0010224
465 Ga0395905_0012366
466 Ga0395901_0005945
467 Ga0237819_00312
468 Ga0439436_0001383
469 Ga0439439_0000612
470 Ga0439447_000511
471 Ga0439465_0000228
472 Ga0451793_1563625
473 Ga0451800_0771528
474 Ga0451804_0822332
475 Ga0451807_1470259
476 Ga0451853_1281237
477 Ga0439445_0002285
478 Ga0439432_003171
479 Ga0439432_009874
480 Ga0439432_016693
481 Ga0439449_0000758
482 Ga0439449_0010841
483 Ga0439449_0021000
484 Ga0439462_0006159
485 Ga0451577_0049156
486 Ga0453684_0000136
487 Ga0451576_0000025
488 Ga0466967_0113621
489 Ga0495638_0003232
490 Ga0495631_0006578
491 Ga0495643_0001702
492 Ga0495663_0001840
493 Ga0495656_0001146
494 Ga0495656_0013752
495 Ga0495668_0000741
496 Ga0495625_0028963
497 Ga0495671_0025807
498 Ga0495672_0001255
499 Ga0495672_0055062
500 Ga0495677_0020251
501 Ga0495686_0002192
502 Ga0495686_0011004
503 Ga0496105_0016360
504 Ga0496110_0198096
505 Ga0496114_0018460
506 Ga0496116_0000534
507 Ga0496116_0024452
508 Ga0496117_0000969
509 Ga0496117_0002121
510 Ga0496117_0003739
511 Ga0496117_0011685
512 Ga0496117_0020315
513 Ga0496118_0001996
514 Ga0496118_0002316
515 Ga0496118_0005003
516 Ga0496119_0002660
517 Ga0496119_0008133
518 Ga0496120_0000245
519 Ga0496120_0000561
520 Ga0496121_0000676
521 Ga0496121_0004221
522 Ga0496121_0006280
523 Ga0496121_0020512
524 Ga0496122_0000874
525 Ga0496122_0016430
526 Ga0496122_0031516
527 Ga0496122_0032191
528 Ga0496123_0000461
529 Ga0496123_0019839
530 Ga0496123_0030425
531 Ga0496123_0047346
532 Ga0496124_0002127
533 Ga0496124_0004852
534 Ga0496124_0007845
535 Ga0496124_0024906
536 Ga0496125_0010897
537 Ga0496125_0016608
538 Ga0496125_0026777
539 Ga0496125_0058435
540 Ga0496126_0002264
541 Ga0496126_0011579
542 Ga0496126_0019968
543 Ga0501290_001304
544 Ga0501031_0000922
545 Ga0501031_0026869
546 Ga0501033_0000799
547 Ga0501034_0000513
548 Ga0501034_0004197
549 Ga0501034_0049682
550 Ga0501036_0013331
551 Ga0501037_0001206
552 Ga0501038_0001851
553 Ga0501039_0051488
554 Ga0501043_0002271
555 Ga0501043_0042749
556 Ga0501047_0034348
557 Ga0501068_0037170
558 Ga0501252_002429
559 Ga0501080_0002101
560 Ga0501265_002132
561 Ga0501035_0001246
562 Ga0501044_0040023
563 Ga0501044_0062006
564 nmdc:mga00v17_26148_c1
565 nmdc:mga00v17_37058_c1
566 nmdc:mga00v17_57751_c1
567 nmdc:mga00v17_67768_c1
568 Ga0500634_0000107
569 2525556258
570 2547503372
571 2578457338
572 2630649488
573 2643815529
574 2643881778
575 2643907198
576 2643915108
577 2643941174
578 2643976258
579 2644079753
580 2644530439
581 2644663064
582 2644696096
583 2644699780
584 2747950728
585 2748016593
586 2765580149
587 2816518821
588 2819660789
589 2842393917
590 2852652454
591 2852686657
592 2857444854
593 2874222837
594 2894414401
595 2895501359
596 2895514502
597 2895524016
598 2895527504
599 2919092753
600 2919132598
601 2919138034
602 2919515058
603 2919676321
604 2923519353
605 2928499636
606 2929196767
607 2931383705
608 2937615155
609 2939589453
610 2939626605
611 2939629478
612 2941479074
613 2941490902
614 2961049602
615 2961066781
616 2974307974
617 2977248710
618 2984516822
619 2995950217
620 8002871325
621 8003015112
622 8021623927
623 8021629533
624 8021648069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

76

502

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wnn-assembly1.cif.gz_B bacillus subtilis bioa in complex with amino donor l-lys 0.9413 14 461
6wnn-assembly1.cif.gz_A bacillus subtilis bioa in complex with amino donor l-lys 0.9402 14 461
3dod-assembly1.cif.gz_B crystal structure of plp bound 7,8-diaminopelargonic acid synthase in bacillus subtilis 0.9382 14 461
6wnn-assembly1.cif.gz_B bacillus subtilis bioa in complex with amino donor l-lys 0.9347 14 461
6wnn-assembly1.cif.gz_A bacillus subtilis bioa in complex with amino donor l-lys 0.9316 14 461
ID Description Score Start End Superfamily
af_Q58696_356_454_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9414 357 452 3.90.1150.10
4adeB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9396 73 350 3.40.640.10
4e3rA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9392 359 461 3.90.1150.10
3drdA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9337 73 353 3.40.640.10
6gwiA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9325 355 461 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A7Y4XV30-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9588 222 460 GO:0004015
GO:0009102
GO:0030170
AF-A0A7C4DJ38-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9526 217 460 GO:0004015
GO:0009102
GO:0030170
AF-A0A6L7EEF3-F1-model_v4 deleted 0.9524 212 319
AF-A0A259CED8-F1-model_v4 Aspartate aminotransferase family protein 0.9476 339 461 GO:0008483
GO:0030170
AF-A0A2E7SPK3-F1-model_v4 Adenosylmethionine--8-amino-7-oxononanoate transaminase 0.9442 212 459 GO:0004015
GO:0009102
GO:0030170

Map