F402018
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 313 | 178 | 313 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10271125|Ga0070676_102711251 |
| Length | 269 |
| Sequence | MAISLVETIADLRVRVAARRSEGPLGLVPTMGALHEGHASLIRQARAECATVVVTIFVNPIQFDRPEDLERYPRSLDVDARLCESLGVDLVFAECKVEVGRLADHLCGRFRPGHFSGVATVVLKLFDIVQADRSYFGEKDAQQLAVIRRLVSDFNVPTTIVGVPTVREADGLALSSRNQRLDASERQLAPALYRALQEVRRAIESGTTSVSDLTRRASDQIPGDARLRLEYFEIVDPIDFQPVEHVSGPVVAAGALWVGTTRLIDNIRI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 141 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 150 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 152 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 153 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 163 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 164 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 166 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 168 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 169 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 1.28 |
| Rhizosphere | 98.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10029506 | 3300002459 | Bacteria | 1139 |
| 2 | Ga0065714_10084618 | 3300005288 | Bacteria | 2189 |
| 3 | Ga0065712_10068386 | 3300005290 | Bacteria | 11051 |
| 4 | Ga0065715_10010124 | 3300005293 | Bacteria | 2900 |
| 5 | Ga0065715_10092008 | 3300005293 | Bacteria | 5394 |
| 6 | Ga0070658_10096567 | 3300005327 | Bacteria | 2440 |
| 7 | Ga0070676_10271125 | 3300005328 | Bacteria | 1140 |
| 8 | Ga0070683_100006352 | 3300005329 | Bacteria | 9912 |
| 9 | Ga0070683_100040474 | 3300005329 | Bacteria | 4285 |
| 10 | Ga0070690_100013406 | 3300005330 | Bacteria | 4842 |
| 11 | Ga0070670_100037240 | 3300005331 | Bacteria | 4185 |
| 12 | Ga0070677_10000496 | 3300005333 | Bacteria | 13547 |
| 13 | Ga0068869_100027596 | 3300005334 | Bacteria | 3960 |
| 14 | Ga0068869_100048678 | 3300005334 | Bacteria | 3066 |
| 15 | Ga0070666_10014675 | 3300005335 | Bacteria | 4989 |
| 16 | Ga0070666_10098663 | 3300005335 | Unclassified | 2012 |
| 17 | Ga0070680_100021987 | 3300005336 | Bacteria | 5073 |
| 18 | Ga0068868_100023620 | 3300005338 | Bacteria | 4655 |
| 19 | Ga0070660_100110976 | 3300005339 | Bacteria | 2181 |
| 20 | Ga0070689_100048634 | 3300005340 | Bacteria | 3271 |
| 21 | Ga0070691_10000971 | 3300005341 | Bacteria | 11706 |
| 22 | Ga0070661_100023881 | 3300005344 | Bacteria | 4386 |
| 23 | Ga0070661_100046600 | 3300005344 | Bacteria | 3171 |
| 24 | Ga0070661_100169990 | 3300005344 | Bacteria | 1655 |
| 25 | Ga0070668_100060167 | 3300005347 | Bacteria | 2941 |
| 26 | Ga0070675_100012320 | 3300005354 | Bacteria | 6702 |
| 27 | Ga0070675_100153594 | 3300005354 | Bacteria | 1975 |
| 28 | Ga0070671_100029958 | 3300005355 | Bacteria | 4490 |
| 29 | Ga0070671_100044624 | 3300005355 | Bacteria | 3684 |
| 30 | Ga0070674_100001307 | 3300005356 | Bacteria | 13100 |
| 31 | Ga0070674_100028541 | 3300005356 | Bacteria | 3666 |
| 32 | Ga0070673_100012223 | 3300005364 | Bacteria | 5887 |
| 33 | Ga0070673_100057442 | 3300005364 | Bacteria | 3074 |
| 34 | Ga0070673_100194461 | 3300005364 | Bacteria | 1744 |
| 35 | Ga0070667_100010221 | 3300005367 | Bacteria | 7753 |
| 36 | Ga0070711_100120473 | 3300005439 | Unclassified | 1940 |
| 37 | Ga0070700_100046940 | 3300005441 | Bacteria | 2671 |
| 38 | Ga0070663_100149249 | 3300005455 | Bacteria | 1791 |
| 39 | Ga0070678_100039522 | 3300005456 | Bacteria | 3329 |
| 40 | Ga0070678_100437850 | 3300005456 | Bacteria | 1142 |
| 41 | Ga0070662_100053139 | 3300005457 | Bacteria | 2931 |
| 42 | Ga0070662_100196116 | 3300005457 | Bacteria | 1599 |
| 43 | Ga0070662_100221121 | 3300005457 | Bacteria | 1511 |
| 44 | Ga0070681_10012206 | 3300005458 | Bacteria | 8519 |
| 45 | Ga0068867_100023579 | 3300005459 | Bacteria | 4405 |
| 46 | Ga0070685_10189062 | 3300005466 | Bacteria | 1331 |
| 47 | Ga0070679_100007679 | 3300005530 | Bacteria | 10096 |
| 48 | Ga0070684_100007521 | 3300005535 | Bacteria | 8478 |
| 49 | Ga0070697_100315630 | 3300005536 | Bacteria | 1345 |
| 50 | Ga0068853_100053631 | 3300005539 | Bacteria | 3472 |
| 51 | Ga0070672_100074118 | 3300005543 | Bacteria | 2715 |
| 52 | Ga0070672_100110282 | 3300005543 | Bacteria | 2242 |
| 53 | Ga0070672_100451639 | 3300005543 | Bacteria | 1107 |
| 54 | Ga0070686_100038123 | 3300005544 | Bacteria | 2985 |
| 55 | Ga0070686_100159181 | 3300005544 | Bacteria | 1589 |
| 56 | Ga0070686_100375270 | 3300005544 | Bacteria | 1075 |
| 57 | Ga0070696_100047646 | 3300005546 | Bacteria | 2974 |
| 58 | Ga0070704_100264109 | 3300005549 | Bacteria | 1419 |
| 59 | Ga0070664_100105408 | 3300005564 | Bacteria | 2455 |
| 60 | Ga0070664_100141467 | 3300005564 | Bacteria | 2119 |
| 61 | Ga0070664_100570177 | 3300005564 | Bacteria | 1048 |
| 62 | Ga0068857_100017792 | 3300005577 | Bacteria | 6231 |
| 63 | Ga0068857_100056533 | 3300005577 | Bacteria | 3482 |
| 64 | Ga0068857_100064000 | 3300005577 | Bacteria | 3269 |
| 65 | Ga0068857_100116408 | 3300005577 | Bacteria | 2405 |
| 66 | Ga0068854_100189873 | 3300005578 | Bacteria | 1609 |
| 67 | Ga0068856_100005958 | 3300005614 | Bacteria | 11998 |
| 68 | Ga0068852_100254090 | 3300005616 | Bacteria | 1685 |
| 69 | Ga0068859_100024131 | 3300005617 | Bacteria | 6102 |
| 70 | Ga0068859_100143377 | 3300005617 | Bacteria | 2462 |
| 71 | Ga0068859_100288534 | 3300005617 | Bacteria | 1734 |
| 72 | Ga0068859_100375021 | 3300005617 | Bacteria | 1518 |
| 73 | Ga0068859_100559386 | 3300005617 | Bacteria | 1238 |
| 74 | Ga0068864_100043788 | 3300005618 | Bacteria | 3834 |
| 75 | Ga0068864_100072993 | 3300005618 | Bacteria | 2992 |
| 76 | Ga0068861_100101018 | 3300005719 | Bacteria | 2294 |
| 77 | Ga0068870_10001387 | 3300005840 | Bacteria | 9797 |
| 78 | Ga0068870_10008581 | 3300005840 | Bacteria | 4602 |
| 79 | Ga0068870_10018910 | 3300005840 | Bacteria | 3335 |
| 80 | Ga0068870_10062247 | 3300005840 | Bacteria | 2009 |
| 81 | Ga0068863_100012661 | 3300005841 | Bacteria | 8135 |
| 82 | Ga0068858_100017000 | 3300005842 | Bacteria | 6830 |
| 83 | Ga0068858_100227608 | 3300005842 | Bacteria | 1767 |
| 84 | Ga0068860_100041624 | 3300005843 | Bacteria | 4388 |
| 85 | Ga0068860_100260511 | 3300005843 | Bacteria | 1690 |
| 86 | Ga0068860_100603858 | 3300005843 | Bacteria | 1103 |
| 87 | Ga0068862_100262592 | 3300005844 | Bacteria | 1577 |
| 88 | Ga0068862_100679671 | 3300005844 | Unclassified | 995 |
| 89 | Ga0075432_10041019 | 3300006058 | Bacteria | 1616 |
| 90 | Ga0068871_100034508 | 3300006358 | Bacteria | 4014 |
| 91 | Ga0075428_100000786 | 3300006844 | Bacteria | 33072 |
| 92 | Ga0075428_100022011 | 3300006844 | Bacteria | 7056 |
| 93 | Ga0075428_100068878 | 3300006844 | Bacteria | 3870 |
| 94 | Ga0075428_100167812 | 3300006844 | Bacteria | 2381 |
| 95 | Ga0075428_100177567 | 3300006844 | Bacteria | 2306 |
| 96 | Ga0075430_100001331 | 3300006846 | Bacteria | 19957 |
| 97 | Ga0075430_100065740 | 3300006846 | Bacteria | 3046 |
| 98 | Ga0075430_100088848 | 3300006846 | Bacteria | 2585 |
| 99 | Ga0075430_100191866 | 3300006846 | Bacteria | 1698 |
| 100 | Ga0075431_100001181 | 3300006847 | Bacteria | 23559 |
| 101 | Ga0075431_100007844 | 3300006847 | Bacteria | 10640 |
| 102 | Ga0075431_100146433 | 3300006847 | Bacteria | 2434 |
| 103 | Ga0075433_10009974 | 3300006852 | Bacteria | 7611 |
| 104 | Ga0075434_100019701 | 3300006871 | Bacteria | 6530 |
| 105 | Ga0075434_100034089 | 3300006871 | Bacteria | 5026 |
| 106 | Ga0075434_100053004 | 3300006871 | Bacteria | 4031 |
| 107 | Ga0075429_100005213 | 3300006880 | Bacteria | 11180 |
| 108 | Ga0075429_100014552 | 3300006880 | Bacteria | 6818 |
| 109 | Ga0075429_100025940 | 3300006880 | Bacteria | 5087 |
| 110 | Ga0075429_100351608 | 3300006880 | Bacteria | 1290 |
| 111 | Ga0075436_100002834 | 3300006914 | Bacteria | 11873 |
| 112 | Ga0097620_100024131 | 3300006931 | Bacteria | 6102 |
| 113 | Ga0097620_100143383 | 3300006931 | Bacteria | 2462 |
| 114 | Ga0097620_100288548 | 3300006931 | Bacteria | 1734 |
| 115 | Ga0097620_100375038 | 3300006931 | Bacteria | 1518 |
| 116 | Ga0097620_100559262 | 3300006931 | Bacteria | 1238 |
| 117 | Ga0075435_100377438 | 3300007076 | Bacteria | 1218 |
| 118 | Ga0105240_10000519 | 3300009093 | Bacteria | 70908 |
| 119 | Ga0105240_10139665 | 3300009093 | Bacteria | 2898 |
| 120 | Ga0111539_10004949 | 3300009094 | Bacteria | 17332 |
| 121 | Ga0111539_10008729 | 3300009094 | Bacteria | 12857 |
| 122 | Ga0111539_10049693 | 3300009094 | Bacteria | 5000 |
| 123 | Ga0111539_10536728 | 3300009094 | Bacteria | 1363 |
| 124 | Ga0105245_10017657 | 3300009098 | Bacteria | 6228 |
| 125 | Ga0105245_10165706 | 3300009098 | Bacteria | 2101 |
| 126 | Ga0105245_10699073 | 3300009098 | Bacteria | 1047 |
| 127 | Ga0105247_10179869 | 3300009101 | Bacteria | 1411 |
| 128 | Ga0114129_10007194 | 3300009147 | Bacteria | 15838 |
| 129 | Ga0114129_10036864 | 3300009147 | Bacteria | 6905 |
| 130 | Ga0114129_10100757 | 3300009147 | Bacteria | 3996 |
| 131 | Ga0114129_10331033 | 3300009147 | Bacteria | 2022 |
| 132 | Ga0114129_10867227 | 3300009147 | Bacteria | 1146 |
| 133 | Ga0105241_10009414 | 3300009174 | Bacteria | 7174 |
| 134 | Ga0105242_10471312 | 3300009176 | Unclassified | 1188 |
| 135 | Ga0105248_10210940 | 3300009177 | Bacteria | 2188 |
| 136 | Ga0105248_10325155 | 3300009177 | Bacteria | 1732 |
| 137 | Ga0105237_10024200 | 3300009545 | Bacteria | 6213 |
| 138 | Ga0105238_10023408 | 3300009551 | Bacteria | 6295 |
| 139 | Ga0105249_10004857 | 3300009553 | Bacteria | 11597 |
| 140 | Ga0105249_10774503 | 3300009553 | Unclassified | 1022 |
| 141 | Ga0105239_10012504 | 3300010375 | Bacteria | 9455 |
| 142 | Ga0105239_10026797 | 3300010375 | Bacteria | 6343 |
| 143 | Ga0105239_10541355 | 3300010375 | Bacteria | 1326 |
| 144 | Ga0105246_10012907 | 3300011119 | Bacteria | 5227 |
| 145 | Ga0157370_10035916 | 3300013104 | Bacteria | 4812 |
| 146 | Ga0157369_10012234 | 3300013105 | Bacteria | 9744 |
| 147 | Ga0157374_10166172 | 3300013296 | Bacteria | 2150 |
| 148 | Ga0157374_10480051 | 3300013296 | Bacteria | 1246 |
| 149 | Ga0157378_10015855 | 3300013297 | Bacteria | 6599 |
| 150 | Ga0163162_10006226 | 3300013306 | Bacteria | 11566 |
| 151 | Ga0163162_10051704 | 3300013306 | Bacteria | 4123 |
| 152 | Ga0157372_10014421 | 3300013307 | Bacteria | 8454 |
| 153 | Ga0157372_10027373 | 3300013307 | Bacteria | 6207 |
| 154 | Ga0157372_10130109 | 3300013307 | Bacteria | 2895 |
| 155 | Ga0157375_10063475 | 3300013308 | Bacteria | 3675 |
| 156 | Ga0157375_10193611 | 3300013308 | Bacteria | 2188 |
| 157 | Ga0163163_10002201 | 3300014325 | Bacteria | 16409 |
| 158 | Ga0163163_10321241 | 3300014325 | Bacteria | 1602 |
| 159 | Ga0157380_10000640 | 3300014326 | Bacteria | 21595 |
| 160 | Ga0157380_10069422 | 3300014326 | Bacteria | 2843 |
| 161 | Ga0157380_10232707 | 3300014326 | Bacteria | 1656 |
| 162 | Ga0157380_10786091 | 3300014326 | Unclassified | 967 |
| 163 | Ga0157377_10004677 | 3300014745 | Bacteria | 6335 |
| 164 | Ga0157377_10029120 | 3300014745 | Bacteria | 2978 |
| 165 | Ga0157379_10050880 | 3300014968 | Bacteria | 3699 |
| 166 | Ga0157376_10073812 | 3300014969 | Bacteria | 2906 |
| 167 | Ga0207697_10001265 | 3300025315 | Bacteria | 13892 |
| 168 | Ga0207682_10004962 | 3300025893 | Bacteria | 5464 |
| 169 | Ga0207682_10007252 | 3300025893 | Bacteria | 4427 |
| 170 | Ga0207688_10075139 | 3300025901 | Bacteria | 1923 |
| 171 | Ga0207680_10026007 | 3300025903 | Bacteria | 3237 |
| 172 | Ga0207645_10003058 | 3300025907 | Bacteria | 12851 |
| 173 | Ga0207645_10032326 | 3300025907 | Bacteria | 3363 |
| 174 | Ga0207643_10001525 | 3300025908 | Bacteria | 13223 |
| 175 | Ga0207643_10038787 | 3300025908 | Bacteria | 2677 |
| 176 | Ga0207643_10097949 | 3300025908 | Bacteria | 1717 |
| 177 | Ga0207684_10166164 | 3300025910 | Bacteria | 1901 |
| 178 | Ga0207654_10037639 | 3300025911 | Bacteria | 2709 |
| 179 | Ga0207707_10000793 | 3300025912 | Bacteria | 30969 |
| 180 | Ga0207695_10000964 | 3300025913 | Bacteria | 51291 |
| 181 | Ga0207695_10005742 | 3300025913 | Bacteria | 16341 |
| 182 | Ga0207695_10291581 | 3300025913 | Bacteria | 1524 |
| 183 | Ga0207695_10341353 | 3300025913 | Bacteria | 1385 |
| 184 | Ga0207671_10025191 | 3300025914 | Bacteria | 4469 |
| 185 | Ga0207663_10192285 | 3300025916 | Bacteria | 1466 |
| 186 | Ga0207660_10008265 | 3300025917 | Bacteria | 6727 |
| 187 | Ga0207662_10001040 | 3300025918 | Bacteria | 12994 |
| 188 | Ga0207662_10011592 | 3300025918 | Bacteria | 4896 |
| 189 | Ga0207657_10097575 | 3300025919 | Bacteria | 2443 |
| 190 | Ga0207657_10164468 | 3300025919 | Unclassified | 1801 |
| 191 | Ga0207649_10121576 | 3300025920 | Unclassified | 1761 |
| 192 | Ga0207652_10009744 | 3300025921 | Bacteria | 7729 |
| 193 | Ga0207681_10077155 | 3300025923 | Bacteria | 2341 |
| 194 | Ga0207694_10005266 | 3300025924 | Bacteria | 9962 |
| 195 | Ga0207659_10012611 | 3300025926 | Bacteria | 5385 |
| 196 | Ga0207659_10035749 | 3300025926 | Bacteria | 3436 |
| 197 | Ga0207659_10084008 | 3300025926 | Bacteria | 2362 |
| 198 | Ga0207659_10084432 | 3300025926 | Bacteria | 2356 |
| 199 | Ga0207659_10141309 | 3300025926 | Bacteria | 1869 |
| 200 | Ga0207687_10010769 | 3300025927 | Bacteria | 5976 |
| 201 | Ga0207687_10105450 | 3300025927 | Bacteria | 2082 |
| 202 | Ga0207687_10560382 | 3300025927 | Bacteria | 959 |
| 203 | Ga0207644_10029556 | 3300025931 | Bacteria | 3803 |
| 204 | Ga0207690_10117303 | 3300025932 | Unclassified | 1927 |
| 205 | Ga0207706_10010919 | 3300025933 | Bacteria | 8283 |
| 206 | Ga0207706_10192619 | 3300025933 | Bacteria | 1789 |
| 207 | Ga0207686_10017621 | 3300025934 | Bacteria | 4028 |
| 208 | Ga0207709_10103501 | 3300025935 | Bacteria | 1887 |
| 209 | Ga0207670_10034311 | 3300025936 | Bacteria | 3278 |
| 210 | Ga0207670_10174390 | 3300025936 | Bacteria | 1615 |
| 211 | Ga0207669_10000672 | 3300025937 | Bacteria | 14741 |
| 212 | Ga0207669_10223554 | 3300025937 | Bacteria | 1383 |
| 213 | Ga0207704_10151064 | 3300025938 | Bacteria | 1639 |
| 214 | Ga0207691_10004019 | 3300025940 | Bacteria | 14255 |
| 215 | Ga0207691_10014137 | 3300025940 | Bacteria | 7615 |
| 216 | Ga0207691_10122766 | 3300025940 | Bacteria | 2300 |
| 217 | Ga0207711_10235022 | 3300025941 | Bacteria | 1679 |
| 218 | Ga0207689_10009117 | 3300025942 | Bacteria | 8588 |
| 219 | Ga0207689_10011380 | 3300025942 | Bacteria | 7624 |
| 220 | Ga0207661_10010741 | 3300025944 | Bacteria | 6600 |
| 221 | Ga0207661_10014810 | 3300025944 | Bacteria | 5721 |
| 222 | Ga0207661_10015364 | 3300025944 | Bacteria | 5632 |
| 223 | Ga0207679_10014360 | 3300025945 | Bacteria | 5206 |
| 224 | Ga0207667_10007231 | 3300025949 | Bacteria | 13398 |
| 225 | Ga0207667_10025979 | 3300025949 | Bacteria | 6405 |
| 226 | Ga0207712_10019812 | 3300025961 | Bacteria | 4397 |
| 227 | Ga0207712_10225262 | 3300025961 | Bacteria | 1501 |
| 228 | Ga0207658_10327452 | 3300025986 | Bacteria | 1328 |
| 229 | Ga0207703_10334412 | 3300026035 | Bacteria | 1390 |
| 230 | Ga0207708_10008617 | 3300026075 | Bacteria | 7545 |
| 231 | Ga0207641_10379922 | 3300026088 | Bacteria | 1353 |
| 232 | Ga0207648_10016008 | 3300026089 | Bacteria | 6872 |
| 233 | Ga0207648_10315293 | 3300026089 | Bacteria | 1404 |
| 234 | Ga0207676_10017720 | 3300026095 | Bacteria | 5167 |
| 235 | Ga0207676_10152278 | 3300026095 | Bacteria | 1993 |
| 236 | Ga0207674_10000320 | 3300026116 | Bacteria | 61127 |
| 237 | Ga0207674_10018287 | 3300026116 | Bacteria | 7620 |
| 238 | Ga0207674_10092623 | 3300026116 | Bacteria | 3011 |
| 239 | Ga0207674_10163839 | 3300026116 | Bacteria | 2178 |
| 240 | Ga0207674_10276451 | 3300026116 | Bacteria | 1627 |
| 241 | Ga0207675_100007903 | 3300026118 | Bacteria | 10027 |
| 242 | Ga0207675_100298845 | 3300026118 | Bacteria | 1568 |
| 243 | Ga0207683_10026394 | 3300026121 | Bacteria | 5013 |
| 244 | Ga0207683_10031763 | 3300026121 | Bacteria | 4584 |
| 245 | Ga0207683_10225059 | 3300026121 | Bacteria | 1710 |
| 246 | Ga0209971_1020725 | 3300027682 | Bacteria | 1564 |
| 247 | Ga0207428_10009716 | 3300027907 | Bacteria | 8620 |
| 248 | Ga0207428_10090034 | 3300027907 | Bacteria | 2384 |
| 249 | Ga0207428_10170656 | 3300027907 | Bacteria | 1648 |
| 250 | Ga0268265_10002584 | 3300028380 | Bacteria | 13512 |
| 251 | Ga0268264_10137629 | 3300028381 | Bacteria | 2173 |
| 252 | Ga0268264_10317304 | 3300028381 | Bacteria | 1472 |
| 253 | Ga0265330_10064779 | 3300031235 | Bacteria | 1587 |
| 254 | Ga0265340_10029510 | 3300031247 | Bacteria | 2754 |
| 255 | Ga0265331_10036632 | 3300031250 | Unclassified | 2407 |
| 256 | Ga0265316_10006992 | 3300031344 | Bacteria | 10692 |
| 257 | Ga0265316_10040312 | 3300031344 | Bacteria | 3744 |
| 258 | Ga0265313_10011578 | 3300031595 | Bacteria | 5470 |
| 259 | Ga0265314_10003569 | 3300031711 | Bacteria | 14986 |
| 260 | Ga0307416_100503671 | 3300032002 | Bacteria | 1276 |
| 261 | Ga0373932_0002999 | 3300035112 | Bacteria | 4141 |
| 262 | Ga0373953_0033874 | 3300035117 | Bacteria | 2000 |
| 263 | Ga0373954_0006606 | 3300035118 | Bacteria | 5062 |
| 264 | Ga0373954_0014664 | 3300035118 | Bacteria | 3496 |
| 265 | Ga0373957_0091083 | 3300035120 | Bacteria | 1212 |
| 266 | Ga0373955_0038866 | 3300035172 | Bacteria | 2537 |
| 267 | Ga0373927_0003188 | 3300035695 | Bacteria | 11821 |
| 268 | Ga0373933_0191645 | 3300035724 | Bacteria | 1306 |
| 269 | Ga0373937_0004792 | 3300036401 | Bacteria | 11490 |
| 270 | Ga0373937_0566230 | 3300036401 | Bacteria | 1079 |
| 271 | Ga0495639_0121658 | 3300046475 | Bacteria | 1245 |
| 272 | Ga0495594_0106577 | 3300046499 | Bacteria | 1578 |
| 273 | Ga0495665_0019045 | 3300046531 | Bacteria | 3690 |
| 274 | Ga0495586_0041978 | 3300046535 | Bacteria | 2464 |
| 275 | Ga0495658_0079146 | 3300046683 | Bacteria | 1925 |
| 276 | Ga0495674_0302662 | 3300047319 | Bacteria | 1306 |
| 277 | Ga0495675_0078791 | 3300047444 | Bacteria | 2075 |
| 278 | Ga0495684_0080082 | 3300047471 | Bacteria | 2480 |
| 279 | Ga0496102_0344726 | 3300048905 | Bacteria | 1403 |
| 280 | Ga0496104_0426138 | 3300048907 | Bacteria | 1239 |
| 281 | Ga0496108_0165353 | 3300048911 | Bacteria | 1913 |
| 282 | Ga0496113_0047209 | 3300048916 | Bacteria | 3200 |
| 283 | Ga0501041_0177673 | 3300049577 | Bacteria | 1333 |
| 284 | Ga0501249_024815 | 3300049679 | Bacteria | 1322 |
| 285 | Ga0501249_048247 | 3300049679 | Unclassified | 975 |
| 286 | Ga0501283_016390 | 3300049779 | Bacteria | 1149 |
| 287 | Ga0501044_0001575 | 3300049823 | Bacteria | 26679 |
| 288 | nmdc:mga05p37_14944_c1 | 3300050507 | Bacteria | 9319 |
| 289 | nmdc:mga05p37_198849_c1 | 3300050507 | Bacteria | 2429 |
| 290 | nmdc:mga05p37_314848_c1 | 3300050507 | Bacteria | 1854 |
| 291 | nmdc:mga09592_15261_c1 | 3300050508 | Bacteria | 6276 |
| 292 | nmdc:mga09592_16629_c1 | 3300050508 | Bacteria | 6020 |
| 293 | nmdc:mga09592_4540_c1 | 3300050508 | Bacteria | 11227 |
| 294 | nmdc:mga09592_6049_c1 | 3300050508 | Bacteria | 9871 |
| 295 | nmdc:mga0qj67_2456_c1 | 3300050509 | Bacteria | 13199 |
| 296 | nmdc:mga0qj67_3237_c1 | 3300050509 | Bacteria | 11722 |
| 297 | nmdc:mga0qj67_359635_c1 | 3300050509 | Bacteria | 1176 |
| 298 | nmdc:mga06r32_125051_c1 | 3300050510 | Bacteria | 2539 |
| 299 | nmdc:mga06r32_27711_c1 | 3300050510 | Bacteria | 5296 |
| 300 | nmdc:mga06r32_316409_c1 | 3300050510 | Bacteria | 1546 |
| 301 | nmdc:mga06r32_404687_c1 | 3300050510 | Bacteria | 1347 |
| 302 | nmdc:mga06r32_6086_c1 | 3300050510 | Bacteria | 10838 |
| 303 | nmdc:mga08y16_50153_c1 | 3300050511 | Bacteria | 4368 |
| 304 | nmdc:mga08y16_57893_c1 | 3300050511 | Bacteria | 4049 |
| 305 | nmdc:mga08y16_597385_c1 | 3300050511 | Bacteria | 1113 |
| 306 | nmdc:mga0n895_239759_c1 | 3300050512 | Bacteria | 1840 |
| 307 | nmdc:mga0n895_24503_c1 | 3300050512 | Bacteria | 5687 |
| 308 | nmdc:mga0n895_403_c1 | 3300050512 | Bacteria | 29107 |
| 309 | nmdc:mga0rr50_6397_c1 | 3300050513 | Bacteria | 7165 |
| 310 | nmdc:mga0a205_11163_c1 | 3300050515 | Bacteria | 8268 |
| 311 | nmdc:mga0a205_28378_c1 | 3300050515 | Bacteria | 5351 |
| 312 | nmdc:mga0a205_5280_c1 | 3300050515 | Bacteria | 11633 |
| 313 | Ga0500568_0001879 | 3300053139 | Bacteria | 12933 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049679 | Ga0501249_048247 | Ga0501249_048247_188_949 | 252 |
| 2 | 3300031711 | Ga0265314_10003569 | Ga0265314_100035697 | 253 |
| 3 | 3300006847 | Ga0075431_100146433 | Ga0075431_1001464332 | 254 |
| 4 | 3300009094 | Ga0111539_10004949 | Ga0111539_1000494914 | 254 |
| 5 | 3300009094 | Ga0111539_10049693 | Ga0111539_100496933 | 254 |
| 6 | 3300009147 | Ga0114129_10036864 | Ga0114129_100368642 | 254 |
| 7 | 3300050509 | nmdc:mga0qj67_359635_c1 | nmdc:mga0qj67_359635_c1_349_1122 | 254 |
| 8 | 3300050511 | nmdc:mga08y16_50153_c1 | nmdc:mga08y16_50153_c1_3226_3999 | 254 |
| 9 | 3300031595 | Ga0265313_10011578 | Ga0265313_100115783 | 260 |
| 10 | 3300025927 | Ga0207687_10560382 | Ga0207687_105603821 | 261 |
| 11 | 3300053139 | Ga0500568_0001879 | Ga0500568_0001879_6120_6965 | 264 |
| 12 | 3300005328 | Ga0070676_10271125 | Ga0070676_102711251 | 268 |
| 13 | 3300005354 | Ga0070675_100153594 | Ga0070675_1001535942 | 268 |
| 14 | 3300005577 | Ga0068857_100056533 | Ga0068857_1000565333 | 268 |
| 15 | 3300005840 | Ga0068870_10018910 | Ga0068870_100189103 | 268 |
| 16 | 3300005844 | Ga0068862_100262592 | Ga0068862_1002625922 | 268 |
| 17 | 3300025926 | Ga0207659_10084008 | Ga0207659_100840082 | 268 |
| 18 | 3300025935 | Ga0207709_10103501 | Ga0207709_101035013 | 268 |
| 19 | 3300026116 | Ga0207674_10163839 | Ga0207674_101638392 | 268 |
| 20 | 3300005329 | Ga0070683_100040474 | Ga0070683_1000404742 | 269 |
| 21 | 3300005439 | Ga0070711_100120473 | Ga0070711_1001204732 | 269 |
| 22 | 3300009098 | Ga0105245_10699073 | Ga0105245_106990732 | 269 |
| 23 | 3300013306 | Ga0163162_10051704 | Ga0163162_100517044 | 269 |
| 24 | 3300025916 | Ga0207663_10192285 | Ga0207663_101922852 | 269 |
| 25 | 3300025927 | Ga0207687_10010769 | Ga0207687_100107694 | 269 |
| 26 | 3300025938 | Ga0207704_10151064 | Ga0207704_101510642 | 269 |
| 27 | 3300025944 | Ga0207661_10014810 | Ga0207661_100148103 | 269 |
| 28 | 3300009098 | Ga0105245_10017657 | Ga0105245_100176575 | 271 |
| 29 | 3300005329 | Ga0070683_100006352 | Ga0070683_1000063527 | 273 |
| 30 | 3300005341 | Ga0070691_10000971 | Ga0070691_100009717 | 273 |
| 31 | 3300005344 | Ga0070661_100023881 | Ga0070661_1000238814 | 273 |
| 32 | 3300005458 | Ga0070681_10012206 | Ga0070681_100122064 | 273 |
| 33 | 3300005530 | Ga0070679_100007679 | Ga0070679_1000076798 | 273 |
| 34 | 3300005535 | Ga0070684_100007521 | Ga0070684_1000075215 | 273 |
| 35 | 3300005539 | Ga0068853_100053631 | Ga0068853_1000536314 | 273 |
| 36 | 3300005564 | Ga0070664_100141467 | Ga0070664_1001414672 | 273 |
| 37 | 3300005577 | Ga0068857_100017792 | Ga0068857_1000177928 | 273 |
| 38 | 3300025911 | Ga0207654_10037639 | Ga0207654_100376393 | 273 |
| 39 | 3300025912 | Ga0207707_10000793 | Ga0207707_1000079328 | 273 |
| 40 | 3300025917 | Ga0207660_10008265 | Ga0207660_100082653 | 273 |
| 41 | 3300047319 | Ga0495674_0302662 | Ga0495674_0302662_26_862 | 276 |
| 42 | 3300047471 | Ga0495684_0080082 | Ga0495684_0080082_347_1183 | 276 |
| 43 | 3300005617 | Ga0068859_100375021 | Ga0068859_1003750213 | 277 |
| 44 | 3300006931 | Ga0097620_100375038 | Ga0097620_1003750382 | 277 |
| 45 | 3300014325 | Ga0163163_10321241 | Ga0163163_103212413 | 277 |
| 46 | 3300036401 | Ga0373937_0566230 | Ga0373937_0566230_204_1043 | 277 |
| 47 | 3300009093 | Ga0105240_10000519 | Ga0105240_1000051916 | 278 |
| 48 | 3300025913 | Ga0207695_10005742 | Ga0207695_1000574216 | 278 |
| 49 | 3300046475 | Ga0495639_0121658 | Ga0495639_0121658_103_945 | 278 |
| 50 | 3300046499 | Ga0495594_0106577 | Ga0495594_0106577_351_1193 | 278 |
| 51 | 3300046531 | Ga0495665_0019045 | Ga0495665_0019045_2428_3270 | 278 |
| 52 | 3300046535 | Ga0495586_0041978 | Ga0495586_0041978_283_1125 | 278 |
| 53 | 3300046683 | Ga0495658_0079146 | Ga0495658_0079146_951_1793 | 278 |
| 54 | 3300005339 | Ga0070660_100110976 | Ga0070660_1001109762 | 279 |
| 55 | 3300005457 | Ga0070662_100221121 | Ga0070662_1002211212 | 279 |
| 56 | 3300005577 | Ga0068857_100064000 | Ga0068857_1000640002 | 279 |
| 57 | 3300005842 | Ga0068858_100227608 | Ga0068858_1002276082 | 279 |
| 58 | 3300009176 | Ga0105242_10471312 | Ga0105242_104713122 | 279 |
| 59 | 3300010375 | Ga0105239_10026797 | Ga0105239_100267978 | 279 |
| 60 | 3300013296 | Ga0157374_10166172 | Ga0157374_101661722 | 279 |
| 61 | 3300013296 | Ga0157374_10480051 | Ga0157374_104800512 | 279 |
| 62 | 3300013297 | Ga0157378_10015855 | Ga0157378_100158557 | 279 |
| 63 | 3300013307 | Ga0157372_10027373 | Ga0157372_100273738 | 279 |
| 64 | 3300013307 | Ga0157372_10130109 | Ga0157372_101301094 | 279 |
| 65 | 3300025919 | Ga0207657_10097575 | Ga0207657_100975752 | 279 |
| 66 | 3300025934 | Ga0207686_10017621 | Ga0207686_100176213 | 279 |
| 67 | 3300025944 | Ga0207661_10015364 | Ga0207661_100153641 | 279 |
| 68 | 3300025949 | Ga0207667_10025979 | Ga0207667_100259791 | 279 |
| 69 | 3300026035 | Ga0207703_10334412 | Ga0207703_103344122 | 279 |
| 70 | 3300026089 | Ga0207648_10315293 | Ga0207648_103152932 | 279 |
| 71 | 3300026116 | Ga0207674_10018287 | Ga0207674_100182872 | 279 |
| 72 | 3300005364 | Ga0070673_100194461 | Ga0070673_1001944612 | 280 |
| 73 | 3300005544 | Ga0070686_100375270 | Ga0070686_1003752701 | 280 |
| 74 | 3300009177 | Ga0105248_10325155 | Ga0105248_103251552 | 280 |
| 75 | 3300049823 | Ga0501044_0001575 | Ga0501044_0001575_24567_25418 | 280 |
| 76 | 3300005334 | Ga0068869_100048678 | Ga0068869_1000486785 | 281 |
| 77 | 3300005336 | Ga0070680_100021987 | Ga0070680_1000219873 | 281 |
| 78 | 3300005614 | Ga0068856_100005958 | Ga0068856_1000059588 | 281 |
| 79 | 3300005617 | Ga0068859_100559386 | Ga0068859_1005593862 | 281 |
| 80 | 3300006844 | Ga0075428_100000786 | Ga0075428_10000078611 | 281 |
| 81 | 3300006846 | Ga0075430_100001331 | Ga0075430_10000133111 | 281 |
| 82 | 3300006847 | Ga0075431_100001181 | Ga0075431_10000118111 | 281 |
| 83 | 3300006880 | Ga0075429_100005213 | Ga0075429_1000052132 | 281 |
| 84 | 3300006931 | Ga0097620_100559262 | Ga0097620_1005592622 | 281 |
| 85 | 3300009098 | Ga0105245_10165706 | Ga0105245_101657061 | 281 |
| 86 | 3300009174 | Ga0105241_10009414 | Ga0105241_100094144 | 281 |
| 87 | 3300009545 | Ga0105237_10024200 | Ga0105237_100242008 | 281 |
| 88 | 3300009551 | Ga0105238_10023408 | Ga0105238_100234082 | 281 |
| 89 | 3300010375 | Ga0105239_10012504 | Ga0105239_100125046 | 281 |
| 90 | 3300013104 | Ga0157370_10035916 | Ga0157370_100359161 | 281 |
| 91 | 3300013105 | Ga0157369_10012234 | Ga0157369_100122348 | 281 |
| 92 | 3300013307 | Ga0157372_10014421 | Ga0157372_1001442111 | 281 |
| 93 | 3300025913 | Ga0207695_10000964 | Ga0207695_1000096438 | 281 |
| 94 | 3300025914 | Ga0207671_10025191 | Ga0207671_100251912 | 281 |
| 95 | 3300025921 | Ga0207652_10009744 | Ga0207652_100097444 | 281 |
| 96 | 3300025924 | Ga0207694_10005266 | Ga0207694_100052666 | 281 |
| 97 | 3300025927 | Ga0207687_10105450 | Ga0207687_101054501 | 281 |
| 98 | 3300025942 | Ga0207689_10011380 | Ga0207689_100113806 | 281 |
| 99 | 3300025944 | Ga0207661_10010741 | Ga0207661_100107413 | 281 |
| 100 | 3300025949 | Ga0207667_10007231 | Ga0207667_1000723111 | 281 |
| 101 | 3300026088 | Ga0207641_10379922 | Ga0207641_103799222 | 281 |
| 102 | 3300026116 | Ga0207674_10000320 | Ga0207674_1000032044 | 281 |
| 103 | 3300031235 | Ga0265330_10064779 | Ga0265330_100647791 | 281 |
| 104 | 3300031344 | Ga0265316_10006992 | Ga0265316_1000699215 | 281 |
| 105 | 3300031344 | Ga0265316_10040312 | Ga0265316_100403125 | 281 |
| 106 | 3300035117 | Ga0373953_0033874 | Ga0373953_0033874_289_1143 | 281 |
| 107 | 3300035118 | Ga0373954_0006606 | Ga0373954_0006606_616_1470 | 281 |
| 108 | 3300035118 | Ga0373954_0014664 | Ga0373954_0014664_2464_3318 | 281 |
| 109 | 3300035120 | Ga0373957_0091083 | Ga0373957_0091083_253_1107 | 281 |
| 110 | 3300035172 | Ga0373955_0038866 | Ga0373955_0038866_933_1787 | 281 |
| 111 | 3300035724 | Ga0373933_0191645 | Ga0373933_0191645_83_937 | 281 |
| 112 | 3300036401 | Ga0373937_0004792 | Ga0373937_0004792_9087_9941 | 281 |
| 113 | 3300047444 | Ga0495675_0078791 | Ga0495675_0078791_730_1584 | 281 |
| 114 | 3300050508 | nmdc:mga09592_4540_c1 | nmdc:mga09592_4540_c1_404_1255 | 281 |
| 115 | 3300050509 | nmdc:mga0qj67_3237_c1 | nmdc:mga0qj67_3237_c1_9225_10076 | 281 |
| 116 | 3300050510 | nmdc:mga06r32_6086_c1 | nmdc:mga06r32_6086_c1_9428_10279 | 281 |
| 117 | 3300050511 | nmdc:mga08y16_57893_c1 | nmdc:mga08y16_57893_c1_2171_3022 | 281 |
| 118 | 3300005290 | Ga0065712_10068386 | Ga0065712_100683867 | 282 |
| 119 | 3300005331 | Ga0070670_100037240 | Ga0070670_1000372403 | 282 |
| 120 | 3300005335 | Ga0070666_10098663 | Ga0070666_100986632 | 282 |
| 121 | 3300005344 | Ga0070661_100169990 | Ga0070661_1001699902 | 282 |
| 122 | 3300005354 | Ga0070675_100012320 | Ga0070675_1000123203 | 282 |
| 123 | 3300005364 | Ga0070673_100012223 | Ga0070673_1000122232 | 282 |
| 124 | 3300005456 | Ga0070678_100437850 | Ga0070678_1004378502 | 282 |
| 125 | 3300005543 | Ga0070672_100074118 | Ga0070672_1000741183 | 282 |
| 126 | 3300005544 | Ga0070686_100159181 | Ga0070686_1001591812 | 282 |
| 127 | 3300005546 | Ga0070696_100047646 | Ga0070696_1000476463 | 282 |
| 128 | 3300005564 | Ga0070664_100105408 | Ga0070664_1001054083 | 282 |
| 129 | 3300005564 | Ga0070664_100570177 | Ga0070664_1005701771 | 282 |
| 130 | 3300005617 | Ga0068859_100024131 | Ga0068859_1000241316 | 282 |
| 131 | 3300005618 | Ga0068864_100072993 | Ga0068864_1000729932 | 282 |
| 132 | 3300005840 | Ga0068870_10062247 | Ga0068870_100622472 | 282 |
| 133 | 3300006844 | Ga0075428_100068878 | Ga0075428_1000688782 | 282 |
| 134 | 3300006844 | Ga0075428_100167812 | Ga0075428_1001678123 | 282 |
| 135 | 3300006846 | Ga0075430_100088848 | Ga0075430_1000888482 | 282 |
| 136 | 3300006846 | Ga0075430_100191866 | Ga0075430_1001918662 | 282 |
| 137 | 3300006847 | Ga0075431_100007844 | Ga0075431_1000078444 | 282 |
| 138 | 3300006880 | Ga0075429_100025940 | Ga0075429_1000259403 | 282 |
| 139 | 3300006931 | Ga0097620_100024131 | Ga0097620_1000241316 | 282 |
| 140 | 3300009093 | Ga0105240_10139665 | Ga0105240_101396653 | 282 |
| 141 | 3300009094 | Ga0111539_10008729 | Ga0111539_1000872912 | 282 |
| 142 | 3300009147 | Ga0114129_10007194 | Ga0114129_100071949 | 282 |
| 143 | 3300009147 | Ga0114129_10100757 | Ga0114129_101007574 | 282 |
| 144 | 3300009147 | Ga0114129_10331033 | Ga0114129_103310332 | 282 |
| 145 | 3300009147 | Ga0114129_10867227 | Ga0114129_108672271 | 282 |
| 146 | 3300010375 | Ga0105239_10541355 | Ga0105239_105413552 | 282 |
| 147 | 3300014325 | Ga0163163_10002201 | Ga0163163_1000220116 | 282 |
| 148 | 3300014326 | Ga0157380_10786091 | Ga0157380_107860911 | 282 |
| 149 | 3300025908 | Ga0207643_10038787 | Ga0207643_100387872 | 282 |
| 150 | 3300025908 | Ga0207643_10097949 | Ga0207643_100979492 | 282 |
| 151 | 3300025913 | Ga0207695_10291581 | Ga0207695_102915812 | 282 |
| 152 | 3300025913 | Ga0207695_10341353 | Ga0207695_103413532 | 282 |
| 153 | 3300025918 | Ga0207662_10011592 | Ga0207662_100115924 | 282 |
| 154 | 3300025926 | Ga0207659_10035749 | Ga0207659_100357492 | 282 |
| 155 | 3300025926 | Ga0207659_10141309 | Ga0207659_101413091 | 282 |
| 156 | 3300025936 | Ga0207670_10174390 | Ga0207670_101743902 | 282 |
| 157 | 3300026095 | Ga0207676_10017720 | Ga0207676_100177203 | 282 |
| 158 | 3300027682 | Ga0209971_1020725 | Ga0209971_10207252 | 282 |
| 159 | 3300027907 | Ga0207428_10090034 | Ga0207428_100900342 | 282 |
| 160 | 3300031247 | Ga0265340_10029510 | Ga0265340_100295102 | 282 |
| 161 | 3300031250 | Ga0265331_10036632 | Ga0265331_100366322 | 282 |
| 162 | 3300048907 | Ga0496104_0426138 | Ga0496104_0426138_257_1111 | 282 |
| 163 | 3300048916 | Ga0496113_0047209 | Ga0496113_0047209_195_1055 | 282 |
| 164 | 3300049577 | Ga0501041_0177673 | Ga0501041_0177673_195_1052 | 282 |
| 165 | 3300050507 | nmdc:mga05p37_14944_c1 | nmdc:mga05p37_14944_c1_4680_5582 | 282 |
| 166 | 3300050507 | nmdc:mga05p37_198849_c1 | nmdc:mga05p37_198849_c1_743_1654 | 282 |
| 167 | 3300050507 | nmdc:mga05p37_314848_c1 | nmdc:mga05p37_314848_c1_506_1387 | 282 |
| 168 | 3300050508 | nmdc:mga09592_15261_c1 | nmdc:mga09592_15261_c1_1724_2584 | 282 |
| 169 | 3300050508 | nmdc:mga09592_16629_c1 | nmdc:mga09592_16629_c1_2708_3619 | 282 |
| 170 | 3300050509 | nmdc:mga0qj67_2456_c1 | nmdc:mga0qj67_2456_c1_11530_12390 | 282 |
| 171 | 3300050510 | nmdc:mga06r32_27711_c1 | nmdc:mga06r32_27711_c1_3256_4116 | 282 |
| 172 | 3300050510 | nmdc:mga06r32_316409_c1 | nmdc:mga06r32_316409_c1_137_1003 | 282 |
| 173 | 3300050510 | nmdc:mga06r32_404687_c1 | nmdc:mga06r32_404687_c1_88_948 | 282 |
| 174 | 3300050511 | nmdc:mga08y16_597385_c1 | nmdc:mga08y16_597385_c1_49_909 | 282 |
| 175 | 3300050512 | nmdc:mga0n895_239759_c1 | nmdc:mga0n895_239759_c1_67_927 | 282 |
| 176 | 3300050515 | nmdc:mga0a205_28378_c1 | nmdc:mga0a205_28378_c1_1148_2008 | 282 |
| 177 | 3300002459 | JGI24751J29686_10029506 | JGI24751J29686_100295062 | 283 |
| 178 | 3300005288 | Ga0065714_10084618 | Ga0065714_100846182 | 283 |
| 179 | 3300005293 | Ga0065715_10010124 | Ga0065715_100101242 | 283 |
| 180 | 3300005293 | Ga0065715_10092008 | Ga0065715_100920085 | 283 |
| 181 | 3300005327 | Ga0070658_10096567 | Ga0070658_100965672 | 283 |
| 182 | 3300005330 | Ga0070690_100013406 | Ga0070690_1000134063 | 283 |
| 183 | 3300005333 | Ga0070677_10000496 | Ga0070677_1000049610 | 283 |
| 184 | 3300005334 | Ga0068869_100027596 | Ga0068869_1000275963 | 283 |
| 185 | 3300005335 | Ga0070666_10014675 | Ga0070666_100146754 | 283 |
| 186 | 3300005338 | Ga0068868_100023620 | Ga0068868_1000236203 | 283 |
| 187 | 3300005340 | Ga0070689_100048634 | Ga0070689_1000486343 | 283 |
| 188 | 3300005344 | Ga0070661_100046600 | Ga0070661_1000466002 | 283 |
| 189 | 3300005347 | Ga0070668_100060167 | Ga0070668_1000601673 | 283 |
| 190 | 3300005355 | Ga0070671_100029958 | Ga0070671_1000299583 | 283 |
| 191 | 3300005355 | Ga0070671_100044624 | Ga0070671_1000446243 | 283 |
| 192 | 3300005356 | Ga0070674_100001307 | Ga0070674_1000013077 | 283 |
| 193 | 3300005356 | Ga0070674_100028541 | Ga0070674_1000285413 | 283 |
| 194 | 3300005364 | Ga0070673_100057442 | Ga0070673_1000574422 | 283 |
| 195 | 3300005367 | Ga0070667_100010221 | Ga0070667_1000102214 | 283 |
| 196 | 3300005441 | Ga0070700_100046940 | Ga0070700_1000469403 | 283 |
| 197 | 3300005455 | Ga0070663_100149249 | Ga0070663_1001492492 | 283 |
| 198 | 3300005456 | Ga0070678_100039522 | Ga0070678_1000395222 | 283 |
| 199 | 3300005457 | Ga0070662_100053139 | Ga0070662_1000531393 | 283 |
| 200 | 3300005457 | Ga0070662_100196116 | Ga0070662_1001961162 | 283 |
| 201 | 3300005459 | Ga0068867_100023579 | Ga0068867_1000235792 | 283 |
| 202 | 3300005466 | Ga0070685_10189062 | Ga0070685_101890622 | 283 |
| 203 | 3300005536 | Ga0070697_100315630 | Ga0070697_1003156302 | 283 |
| 204 | 3300005543 | Ga0070672_100110282 | Ga0070672_1001102822 | 283 |
| 205 | 3300005543 | Ga0070672_100451639 | Ga0070672_1004516392 | 283 |
| 206 | 3300005544 | Ga0070686_100038123 | Ga0070686_1000381232 | 283 |
| 207 | 3300005549 | Ga0070704_100264109 | Ga0070704_1002641092 | 283 |
| 208 | 3300005577 | Ga0068857_100116408 | Ga0068857_1001164082 | 283 |
| 209 | 3300005578 | Ga0068854_100189873 | Ga0068854_1001898732 | 283 |
| 210 | 3300005616 | Ga0068852_100254090 | Ga0068852_1002540902 | 283 |
| 211 | 3300005617 | Ga0068859_100143377 | Ga0068859_1001433772 | 283 |
| 212 | 3300005617 | Ga0068859_100288534 | Ga0068859_1002885341 | 283 |
| 213 | 3300005618 | Ga0068864_100043788 | Ga0068864_1000437882 | 283 |
| 214 | 3300005719 | Ga0068861_100101018 | Ga0068861_1001010183 | 283 |
| 215 | 3300005840 | Ga0068870_10001387 | Ga0068870_100013872 | 283 |
| 216 | 3300005840 | Ga0068870_10008581 | Ga0068870_100085813 | 283 |
| 217 | 3300005841 | Ga0068863_100012661 | Ga0068863_1000126613 | 283 |
| 218 | 3300005842 | Ga0068858_100017000 | Ga0068858_1000170002 | 283 |
| 219 | 3300005843 | Ga0068860_100041624 | Ga0068860_1000416243 | 283 |
| 220 | 3300005843 | Ga0068860_100260511 | Ga0068860_1002605112 | 283 |
| 221 | 3300005843 | Ga0068860_100603858 | Ga0068860_1006038581 | 283 |
| 222 | 3300005844 | Ga0068862_100679671 | Ga0068862_1006796712 | 283 |
| 223 | 3300006058 | Ga0075432_10041019 | Ga0075432_100410192 | 283 |
| 224 | 3300006358 | Ga0068871_100034508 | Ga0068871_1000345084 | 283 |
| 225 | 3300006844 | Ga0075428_100022011 | Ga0075428_1000220114 | 283 |
| 226 | 3300006844 | Ga0075428_100177567 | Ga0075428_1001775673 | 283 |
| 227 | 3300006846 | Ga0075430_100065740 | Ga0075430_1000657403 | 283 |
| 228 | 3300006852 | Ga0075433_10009974 | Ga0075433_100099742 | 283 |
| 229 | 3300006871 | Ga0075434_100019701 | Ga0075434_1000197013 | 283 |
| 230 | 3300006871 | Ga0075434_100034089 | Ga0075434_1000340892 | 283 |
| 231 | 3300006871 | Ga0075434_100053004 | Ga0075434_1000530042 | 283 |
| 232 | 3300006880 | Ga0075429_100014552 | Ga0075429_1000145528 | 283 |
| 233 | 3300006880 | Ga0075429_100351608 | Ga0075429_1003516082 | 283 |
| 234 | 3300006914 | Ga0075436_100002834 | Ga0075436_10000283410 | 283 |
| 235 | 3300006931 | Ga0097620_100143383 | Ga0097620_1001433833 | 283 |
| 236 | 3300006931 | Ga0097620_100288548 | Ga0097620_1002885481 | 283 |
| 237 | 3300007076 | Ga0075435_100377438 | Ga0075435_1003774382 | 283 |
| 238 | 3300009094 | Ga0111539_10536728 | Ga0111539_105367281 | 283 |
| 239 | 3300009101 | Ga0105247_10179869 | Ga0105247_101798691 | 283 |
| 240 | 3300009177 | Ga0105248_10210940 | Ga0105248_102109402 | 283 |
| 241 | 3300009553 | Ga0105249_10004857 | Ga0105249_100048574 | 283 |
| 242 | 3300009553 | Ga0105249_10774503 | Ga0105249_107745031 | 283 |
| 243 | 3300011119 | Ga0105246_10012907 | Ga0105246_100129072 | 283 |
| 244 | 3300013306 | Ga0163162_10006226 | Ga0163162_100062263 | 283 |
| 245 | 3300013308 | Ga0157375_10063475 | Ga0157375_100634753 | 283 |
| 246 | 3300013308 | Ga0157375_10193611 | Ga0157375_101936113 | 283 |
| 247 | 3300014326 | Ga0157380_10000640 | Ga0157380_100006403 | 283 |
| 248 | 3300014326 | Ga0157380_10069422 | Ga0157380_100694222 | 283 |
| 249 | 3300014326 | Ga0157380_10232707 | Ga0157380_102327072 | 283 |
| 250 | 3300014745 | Ga0157377_10004677 | Ga0157377_100046774 | 283 |
| 251 | 3300014745 | Ga0157377_10029120 | Ga0157377_100291202 | 283 |
| 252 | 3300014968 | Ga0157379_10050880 | Ga0157379_100508803 | 283 |
| 253 | 3300014969 | Ga0157376_10073812 | Ga0157376_100738123 | 283 |
| 254 | 3300025315 | Ga0207697_10001265 | Ga0207697_1000126512 | 283 |
| 255 | 3300025893 | Ga0207682_10004962 | Ga0207682_100049625 | 283 |
| 256 | 3300025893 | Ga0207682_10007252 | Ga0207682_100072524 | 283 |
| 257 | 3300025901 | Ga0207688_10075139 | Ga0207688_100751392 | 283 |
| 258 | 3300025903 | Ga0207680_10026007 | Ga0207680_100260072 | 283 |
| 259 | 3300025907 | Ga0207645_10003058 | Ga0207645_1000305810 | 283 |
| 260 | 3300025907 | Ga0207645_10032326 | Ga0207645_100323263 | 283 |
| 261 | 3300025908 | Ga0207643_10001525 | Ga0207643_100015254 | 283 |
| 262 | 3300025910 | Ga0207684_10166164 | Ga0207684_101661643 | 283 |
| 263 | 3300025918 | Ga0207662_10001040 | Ga0207662_100010403 | 283 |
| 264 | 3300025919 | Ga0207657_10164468 | Ga0207657_101644682 | 283 |
| 265 | 3300025920 | Ga0207649_10121576 | Ga0207649_101215762 | 283 |
| 266 | 3300025923 | Ga0207681_10077155 | Ga0207681_100771552 | 283 |
| 267 | 3300025926 | Ga0207659_10012611 | Ga0207659_100126111 | 283 |
| 268 | 3300025926 | Ga0207659_10084432 | Ga0207659_100844321 | 283 |
| 269 | 3300025931 | Ga0207644_10029556 | Ga0207644_100295563 | 283 |
| 270 | 3300025932 | Ga0207690_10117303 | Ga0207690_101173032 | 283 |
| 271 | 3300025933 | Ga0207706_10010919 | Ga0207706_100109195 | 283 |
| 272 | 3300025933 | Ga0207706_10192619 | Ga0207706_101926192 | 283 |
| 273 | 3300025936 | Ga0207670_10034311 | Ga0207670_100343112 | 283 |
| 274 | 3300025937 | Ga0207669_10000672 | Ga0207669_1000067210 | 283 |
| 275 | 3300025937 | Ga0207669_10223554 | Ga0207669_102235542 | 283 |
| 276 | 3300025940 | Ga0207691_10004019 | Ga0207691_100040198 | 283 |
| 277 | 3300025940 | Ga0207691_10014137 | Ga0207691_100141377 | 283 |
| 278 | 3300025940 | Ga0207691_10122766 | Ga0207691_101227662 | 283 |
| 279 | 3300025941 | Ga0207711_10235022 | Ga0207711_102350222 | 283 |
| 280 | 3300025942 | Ga0207689_10009117 | Ga0207689_100091175 | 283 |
| 281 | 3300025945 | Ga0207679_10014360 | Ga0207679_100143604 | 283 |
| 282 | 3300025961 | Ga0207712_10019812 | Ga0207712_100198124 | 283 |
| 283 | 3300025961 | Ga0207712_10225262 | Ga0207712_102252622 | 283 |
| 284 | 3300025986 | Ga0207658_10327452 | Ga0207658_103274522 | 283 |
| 285 | 3300026075 | Ga0207708_10008617 | Ga0207708_100086173 | 283 |
| 286 | 3300026089 | Ga0207648_10016008 | Ga0207648_100160082 | 283 |
| 287 | 3300026095 | Ga0207676_10152278 | Ga0207676_101522782 | 283 |
| 288 | 3300026116 | Ga0207674_10092623 | Ga0207674_100926233 | 283 |
| 289 | 3300026116 | Ga0207674_10276451 | Ga0207674_102764512 | 283 |
| 290 | 3300026118 | Ga0207675_100007903 | Ga0207675_1000079037 | 283 |
| 291 | 3300026118 | Ga0207675_100298845 | Ga0207675_1002988452 | 283 |
| 292 | 3300026121 | Ga0207683_10026394 | Ga0207683_100263945 | 283 |
| 293 | 3300026121 | Ga0207683_10031763 | Ga0207683_100317633 | 283 |
| 294 | 3300026121 | Ga0207683_10225059 | Ga0207683_102250592 | 283 |
| 295 | 3300027907 | Ga0207428_10009716 | Ga0207428_100097168 | 283 |
| 296 | 3300027907 | Ga0207428_10170656 | Ga0207428_101706562 | 283 |
| 297 | 3300028380 | Ga0268265_10002584 | Ga0268265_100025842 | 283 |
| 298 | 3300028381 | Ga0268264_10137629 | Ga0268264_101376292 | 283 |
| 299 | 3300028381 | Ga0268264_10317304 | Ga0268264_103173042 | 283 |
| 300 | 3300032002 | Ga0307416_100503671 | Ga0307416_1005036712 | 283 |
| 301 | 3300035112 | Ga0373932_0002999 | Ga0373932_0002999_2040_2897 | 283 |
| 302 | 3300035695 | Ga0373927_0003188 | Ga0373927_0003188_8502_9377 | 283 |
| 303 | 3300048905 | Ga0496102_0344726 | Ga0496102_0344726_515_1372 | 283 |
| 304 | 3300048911 | Ga0496108_0165353 | Ga0496108_0165353_697_1554 | 283 |
| 305 | 3300049679 | Ga0501249_024815 | Ga0501249_024815_328_1185 | 283 |
| 306 | 3300049779 | Ga0501283_016390 | Ga0501283_016390_187_1044 | 283 |
| 307 | 3300050508 | nmdc:mga09592_6049_c1 | nmdc:mga09592_6049_c1_6315_7172 | 283 |
| 308 | 3300050510 | nmdc:mga06r32_125051_c1 | nmdc:mga06r32_125051_c1_647_1519 | 283 |
| 309 | 3300050512 | nmdc:mga0n895_24503_c1 | nmdc:mga0n895_24503_c1_1215_2072 | 283 |
| 310 | 3300050512 | nmdc:mga0n895_403_c1 | nmdc:mga0n895_403_c1_22074_22949 | 283 |
| 311 | 3300050513 | nmdc:mga0rr50_6397_c1 | nmdc:mga0rr50_6397_c1_877_1752 | 283 |
| 312 | 3300050515 | nmdc:mga0a205_11163_c1 | nmdc:mga0a205_11163_c1_5451_6308 | 283 |
| 313 | 3300050515 | nmdc:mga0a205_5280_c1 | nmdc:mga0a205_5280_c1_302_1177 | 283 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ejc-assembly1.cif.gz_A-2 | crystal structure of pantoate--beta-alanine ligase (panc) from thermotoga maritima | 0.9751 | 3 | 278 |
| 3inn-assembly1.cif.gz_A | crystal structure of pantoate-beta-alanine-ligase in complex with atp at low occupancy at 2.1 a resolution | 0.9669 | 1 | 280 |
| 2x3f-assembly1.cif.gz_B | crystal structure of the methicillin-resistant staphylococcus aureus sar2676, a pantothenate synthetase. | 0.9644 | 1 | 280 |
| 5ucr-assembly1.cif.gz_B | crystal structure of a pantoate-beta-alanine ligase from neisseria gonorrhoeae with bound amppnp and alanine | 0.9616 | 1 | 278 |
| 5kwv-assembly1.cif.gz_B | crystal structure of a pantoate-beta-alanine ligase from neisseria gonorrhoeae with bound amppnp | 0.9611 | 1 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3innA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.98 | 3 | 177 | 3.40.50.620 |
| 3innA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9691 | 3 | 177 | 3.40.50.620 |
| 5hg0A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9688 | 3 | 177 | 3.40.50.620 |
| 5hg0A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9633 | 3 | 177 | 3.40.50.620 |
| af_Q9FKB3_2_205_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9479 | 1 | 177 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S2CTR7-F1-model_v4 | Pantoate--beta-alanine ligase (EC 6.3.2.1) (Pantoate-activating enzyme) (Pantothenate synthetase) | 0.9947 | 118 | 212 |
GO:0004592
GO:0005524 GO:0015940 |
| AF-A0A2J0QPU4-F1-model_v4 | deleted | 0.985 | 86 | 197 |
|
| AF-A0A658NLZ5-F1-model_v4 | pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) | 0.9846 | 128 | 211 |
GO:0004592
GO:0005524 GO:0005829 GO:0015940 |
| AF-A0A3A0HP66-F1-model_v4 | deleted | 0.9834 | 27 | 154 |
|
| AF-A0A3D1AU54-F1-model_v4 | Pantoate--beta-alanine ligase (EC 6.3.2.1) | 0.983 | 82 | 280 |
GO:0004592
GO:0005524 GO:0005829 GO:0015940 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar