F402121

General Info

Members Datasets Scaffolds Average Seq Length
313 189 626 255

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100200118|Ga0068871_1002001182
Length 283
Sequence MMLATPPRAPAVFLLATHYSLLTTFPNMSIRKKLIAGNWKMNKTSADAVALVQELVSEIGKQTDVEVVVAPPFTSIESVGKVLDGSVIKLGAQNVHPEASGAYTGEISVGMLRSIFTNYVILGHSERRTYFKETDAFINQKVLASLKGQLKPILCVGETLAEREGNQTLKVVQTQLEAGLEGVSKDLATSVVIAYEPVWAIGTGKVATTEQAQEVHAFIRSLLVKLFGDATAQKVRILYGGSMKPSNAPELLTQKDIDGGLIGGASLESRSFVDLIKAAAAAK

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
104 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
105 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
106 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
188 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
189 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0.64
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 0.64
Rhizosphere 93.29
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100200118 3300006358 Bacteria 1724
2 JGI24033J26618_1001440 3300002155 Bacteria 2359
3 rootH2_10014581 3300003320 Bacteria 7004
4 rootH2_10018539 3300003320 Bacteria 22550
5 rootL2_10038826 3300003322 Bacteria 2343
6 rootH1_10052629 3300003323 Bacteria 8510
7 Ga0070658_10012826 3300005327 Bacteria 6725
8 Ga0070676_10003308 3300005328 Bacteria 8378
9 Ga0070683_100000678 3300005329 Bacteria 24650
10 Ga0070683_100168274 3300005329 Bacteria 2080
11 Ga0070690_100000961 3300005330 Bacteria 14652
12 Ga0070670_100592285 3300005331 Bacteria 992
13 Ga0068869_100002769 3300005334 Bacteria 10617
14 Ga0070666_10024786 3300005335 Bacteria 3910
15 Ga0070680_100339016 3300005336 Bacteria 1277
16 Ga0068868_100012435 3300005338 Bacteria 6222
17 Ga0068868_100057754 3300005338 Bacteria 3066
18 Ga0068868_100188617 3300005338 Bacteria 1714
19 Ga0068868_100266815 3300005338 Bacteria 1445
20 Ga0070660_100047966 3300005339 Bacteria 3279
21 Ga0070689_100000034 3300005340 Bacteria 91533
22 Ga0070689_100036470 3300005340 Bacteria 3761
23 Ga0070687_100003383 3300005343 Bacteria 6189
24 Ga0070661_100003563 3300005344 Bacteria 10720
25 Ga0070668_100012036 3300005347 Bacteria 6443
26 Ga0070669_100010670 3300005353 Bacteria 6519
27 Ga0070669_100211952 3300005353 Bacteria 1529
28 Ga0070675_100025623 3300005354 Bacteria 4728
29 Ga0070675_100088524 3300005354 Bacteria 2591
30 Ga0070671_100001696 3300005355 Bacteria 16716
31 Ga0070671_100030423 3300005355 Bacteria 4455
32 Ga0070671_100589721 3300005355 Bacteria 960
33 Ga0070674_100021101 3300005356 Bacteria 4176
34 Ga0070674_100077671 3300005356 Bacteria 2364
35 Ga0070674_100172030 3300005356 Bacteria 1652
36 Ga0070673_100085101 3300005364 Bacteria 2573
37 Ga0070673_100384914 3300005364 Bacteria 1251
38 Ga0070688_100001523 3300005365 Bacteria 11571
39 Ga0070659_100060654 3300005366 Bacteria 2988
40 Ga0070667_100008641 3300005367 Bacteria 8441
41 Ga0070667_100019801 3300005367 Bacteria 5583
42 Ga0070667_100651278 3300005367 Bacteria 973
43 Ga0070710_10031738 3300005437 Bacteria 2855
44 Ga0070701_10000354 3300005438 Bacteria 15249
45 Ga0070700_100001338 3300005441 Bacteria 12254
46 Ga0070678_100027103 3300005456 Bacteria 3886
47 Ga0070678_100032667 3300005456 Bacteria 3604
48 Ga0070678_100155992 3300005456 Bacteria 1844
49 Ga0068867_100000837 3300005459 Bacteria 20701
50 Ga0068867_100001590 3300005459 Bacteria 15778
51 Ga0068867_100032706 3300005459 Bacteria 3763
52 Ga0070685_10000278 3300005466 Bacteria 32947
53 Ga0070699_100350983 3300005518 Bacteria 1329
54 Ga0070679_100117285 3300005530 Bacteria 2647
55 Ga0070672_100018454 3300005543 Bacteria 5044
56 Ga0070672_100042393 3300005543 Bacteria 3504
57 Ga0070686_100000053 3300005544 Bacteria 95565
58 Ga0070665_100018595 3300005548 Bacteria 6964
59 Ga0070665_100136672 3300005548 Bacteria 2454
60 Ga0070665_100206681 3300005548 Bacteria 1964
61 Ga0070664_100038634 3300005564 Bacteria 4019
62 Ga0068857_100037001 3300005577 Bacteria 4323
63 Ga0068856_100000326 3300005614 Bacteria 52440
64 Ga0068856_100006226 3300005614 Bacteria 11709
65 Ga0068856_100410002 3300005614 Bacteria 1375
66 Ga0068859_100001151 3300005617 Bacteria 26989
67 Ga0068861_100120476 3300005719 Bacteria 2116
68 Ga0068858_100390618 3300005842 Bacteria 1336
69 Ga0068860_100030343 3300005843 Bacteria 5200
70 Ga0081539_10005759 3300005985 Bacteria 12366
71 Ga0070717_10000016 3300006028 Bacteria 205932
72 Ga0097621_100188320 3300006237 Bacteria 1786
73 Ga0068871_100093115 3300006358 Bacteria 2513
74 Ga0068871_100538031 3300006358 Bacteria 1057
75 Ga0068865_100040221 3300006881 Bacteria 3175
76 Ga0068865_100158911 3300006881 Bacteria 1722
77 Ga0097620_100001151 3300006931 Bacteria 26989
78 Ga0105240_10466353 3300009093 Bacteria 1410
79 Ga0105240_11000263 3300009093 Bacteria 894
80 Ga0105245_10446331 3300009098 Bacteria 1301
81 Ga0114129_10237872 3300009147 Bacteria 2449
82 Ga0105242_10011055 3300009176 Bacteria 6935
83 Ga0105248_10000116 3300009177 Bacteria 90171
84 Ga0105239_10574394 3300010375 Bacteria 1285
85 Ga0157374_10013126 3300013296 Bacteria 7226
86 Ga0157374_10035317 3300013296 Bacteria 4573
87 Ga0157378_10002900 3300013297 Bacteria 15262
88 Ga0157378_10289076 3300013297 Bacteria 1583
89 Ga0157378_10299360 3300013297 Bacteria 1556
90 Ga0163162_10035394 3300013306 Bacteria 4974
91 Ga0163162_10304339 3300013306 Bacteria 1726
92 Ga0163162_10370465 3300013306 Bacteria 1565
93 Ga0157372_10296637 3300013307 Bacteria 1880
94 Ga0157375_10016995 3300013308 Bacteria 6554
95 Ga0157375_10226262 3300013308 Bacteria 2029
96 Ga0163163_10036535 3300014325 Bacteria 4773
97 Ga0163163_10158756 3300014325 Bacteria 2306
98 Ga0157376_10005528 3300014969 Bacteria 8832
99 Ga0157376_10054447 3300014969 Bacteria 3335
100 Ga0163161_10115401 3300017792 Bacteria 2012
101 Ga0213876_10010457 3300021384 Bacteria 4977
102 Ga0213876_10185478 3300021384 Bacteria 1106
103 Ga0207673_1006491 3300025290 Bacteria 1449
104 Ga0209050_1000236 3300025298 Bacteria 120719
105 Ga0207697_10000163 3300025315 Bacteria 33514
106 Ga0207697_10002689 3300025315 Bacteria 9085
107 Ga0207682_10195565 3300025893 Bacteria 928
108 Ga0207688_10010661 3300025901 Bacteria 4999
109 Ga0207688_10083416 3300025901 Bacteria 1828
110 Ga0207680_10011058 3300025903 Bacteria 4545
111 Ga0207645_10005348 3300025907 Bacteria 9333
112 Ga0207645_10005672 3300025907 Bacteria 9016
113 Ga0207705_10002538 3300025909 Bacteria 14060
114 Ga0207705_10035323 3300025909 Bacteria 3576
115 Ga0207695_10411804 3300025913 Bacteria 1236
116 Ga0207663_10194891 3300025916 Bacteria 1457
117 Ga0207657_10374248 3300025919 Bacteria 1122
118 Ga0207657_10437710 3300025919 Bacteria 1026
119 Ga0207649_10000291 3300025920 Bacteria 38912
120 Ga0207681_10014723 3300025923 Bacteria 4869
121 Ga0207681_10086233 3300025923 Bacteria 2230
122 Ga0207650_10407931 3300025925 Bacteria 1126
123 Ga0207659_10023276 3300025926 Bacteria 4132
124 Ga0207659_10104309 3300025926 Bacteria 2144
125 Ga0207644_10018760 3300025931 Bacteria 4684
126 Ga0207644_10028154 3300025931 Bacteria 3887
127 Ga0207690_10040681 3300025932 Bacteria 3041
128 Ga0207670_10000024 3300025936 Bacteria 143058
129 Ga0207669_10053266 3300025937 Bacteria 2436
130 Ga0207669_10180151 3300025937 Bacteria 1514
131 Ga0207691_10001207 3300025940 Bacteria 25737
132 Ga0207689_10006104 3300025942 Bacteria 10657
133 Ga0207661_10006991 3300025944 Bacteria 8003
134 Ga0207679_10046292 3300025945 Bacteria 3152
135 Ga0207651_10028421 3300025960 Bacteria 3527
136 Ga0207668_10016671 3300025972 Bacteria 4589
137 Ga0207658_10010967 3300025986 Bacteria 6170
138 Ga0207677_10004942 3300026023 Bacteria 7201
139 Ga0207677_10052253 3300026023 Bacteria 2775
140 Ga0207703_10006408 3300026035 Bacteria 9405
141 Ga0207703_10329059 3300026035 Bacteria 1401
142 Ga0207708_10001757 3300026075 Bacteria 16003
143 Ga0207702_10000672 3300026078 Bacteria 37239
144 Ga0207702_10001609 3300026078 Bacteria 22347
145 Ga0207648_10000502 3300026089 Bacteria 43633
146 Ga0207648_10006026 3300026089 Bacteria 12089
147 Ga0207648_10041697 3300026089 Bacteria 4031
148 Ga0207674_10037711 3300026116 Bacteria 5023
149 Ga0207683_10012877 3300026121 Bacteria 7139
150 Ga0207683_10016886 3300026121 Bacteria 6211
151 Ga0268266_10281669 3300028379 Bacteria 1546
152 Ga0268264_10387295 3300028381 Bacteria 1340
153 Ga0265319_1000130 3300028563 Bacteria 55833
154 Ga0265319_1002742 3300028563 Bacteria 9455
155 Ga0265319_1006336 3300028563 Bacteria 5495
156 Ga0265319_1008936 3300028563 Bacteria 4330
157 Ga0265319_1018051 3300028563 Bacteria 2669
158 Ga0265319_1034134 3300028563 Bacteria 1753
159 Ga0265334_10016148 3300028573 Bacteria 3089
160 Ga0265318_10000190 3300028577 Bacteria 54275
161 Ga0265318_10000434 3300028577 Bacteria 31774
162 Ga0265318_10001069 3300028577 Bacteria 17274
163 Ga0265318_10003913 3300028577 Bacteria 7338
164 Ga0265318_10124037 3300028577 Bacteria 950
165 Ga0265323_10000080 3300028653 Bacteria 54790
166 Ga0265323_10008972 3300028653 Bacteria 4105
167 Ga0265323_10019478 3300028653 Bacteria 2616
168 Ga0265323_10030610 3300028653 Bacteria 2004
169 Ga0265322_10000087 3300028654 Bacteria 43593
170 Ga0265322_10026957 3300028654 Bacteria 1642
171 Ga0265322_10031861 3300028654 Bacteria 1504
172 Ga0265330_10129043 3300031235 Bacteria 1076
173 Ga0265320_10000205 3300031240 Bacteria 47959
174 Ga0265320_10000412 3300031240 Bacteria 34014
175 Ga0265320_10008391 3300031240 Bacteria 6325
176 Ga0265320_10076817 3300031240 Bacteria 1564
177 Ga0265320_10167028 3300031240 Bacteria 989
178 Ga0265325_10109344 3300031241 Bacteria 1345
179 Ga0265339_10127749 3300031249 Bacteria 1302
180 Ga0265327_10015094 3300031251 Bacteria 5009
181 Ga0265327_10032181 3300031251 Bacteria 2937
182 Ga0265327_10110433 3300031251 Bacteria 1315
183 Ga0265327_10218343 3300031251 Bacteria 858
184 Ga0265316_10002448 3300031344 Bacteria 19259
185 Ga0265316_10016479 3300031344 Bacteria 6407
186 Ga0265316_10077020 3300031344 Bacteria 2561
187 Ga0265316_10081196 3300031344 Bacteria 2486
188 Ga0265316_10095417 3300031344 Bacteria 2265
189 Ga0265316_10195405 3300031344 Bacteria 1502
190 Ga0307509_10376601 3300031507 Bacteria 1134
191 Ga0307408_100000003 3300031548 Bacteria 618438
192 Ga0265313_10003592 3300031595 Bacteria 12461
193 Ga0265313_10005982 3300031595 Bacteria 8790
194 Ga0265313_10019740 3300031595 Bacteria 3740
195 Ga0265314_10008930 3300031711 Bacteria 8537
196 Ga0265314_10011865 3300031711 Bacteria 7158
197 Ga0265314_10038674 3300031711 Bacteria 3444
198 Ga0265314_10148265 3300031711 Bacteria 1442
199 Ga0265342_10014564 3300031712 Bacteria 5216
200 Ga0265342_10019832 3300031712 Bacteria 4325
201 Ga0265342_10040906 3300031712 Bacteria 2809
202 Ga0265342_10120158 3300031712 Bacteria 1480
203 Ga0307405_10069898 3300031731 Bacteria 2253
204 Ga0307410_10000002 3300031852 Bacteria 145309
205 Ga0307407_10032914 3300031903 Bacteria 2823
206 Ga0307412_10116173 3300031911 Bacteria 1919
207 Ga0307409_100006527 3300031995 Bacteria 6867
208 Ga0307416_100000057 3300032002 Bacteria 105624
209 Ga0307414_10020785 3300032004 Bacteria 4100
210 Ga0307414_10743171 3300032004 Bacteria 891
211 Ga0373953_0099625 3300035117 Bacteria 1222
212 Ga0373956_0067614 3300035119 Bacteria 1627
213 Ga0373924_0011635 3300035410 Bacteria 3272
214 Ga0373937_0037149 3300036401 Bacteria 4439
215 Ga0373937_0053673 3300036401 Bacteria 3697
216 Ga0395899_0000349 3300037312 Bacteria 56957
217 Ga0395898_0000026 3300037466 Bacteria 374440
218 Ga0395905_0000119 3300037471 Bacteria 131498
219 Ga0436365_0395979 3300039437 Bacteria 10769
220 Ga0436365_0809833 3300039437 Bacteria 4967
221 Ga0436363_1651109 3300039450 Unclassified 2128
222 Ga0451853_0171139 3300041512 Bacteria 1291
223 Ga0451577_0053670 3300042876 Bacteria 3598
224 Ga0453683_0000264 3300044673 Bacteria 68669
225 Ga0453683_0285282 3300044673 Bacteria 1055
226 Ga0466965_0059428 3300044683 Bacteria 1908
227 Ga0466964_0030857 3300044706 Bacteria 2123
228 Ga0453684_0000045 3300044712 Bacteria 582917
229 Ga0453684_0145170 3300044712 Unclassified 2828
230 Ga0466971_0000020 3300044719 Bacteria 78865
231 Ga0466971_0215970 3300044719 Bacteria 908
232 Ga0466957_0010671 3300044842 Bacteria 5280
233 Ga0451576_0002620 3300045051 Bacteria 26319
234 Ga0451576_0038620 3300045051 Bacteria 5053
235 Ga0451576_0177137 3300045051 Bacteria 2226
236 Ga0451576_0557467 3300045051 Bacteria 1204
237 Ga0466967_0033254 3300045976 Bacteria 4363
238 Ga0466967_0158652 3300045976 Bacteria 2122
239 Ga0495627_009609 3300046453 Bacteria 3551
240 Ga0495580_0129200 3300046472 Bacteria 1753
241 Ga0495594_0240296 3300046499 Bacteria 1032
242 Ga0495607_0010818 3300046501 Bacteria 6105
243 Ga0495606_0366092 3300046507 Bacteria 760
244 Ga0495616_0030534 3300046513 Bacteria 2831
245 Ga0495643_0001055 3300046522 Bacteria 27762
246 Ga0495625_0010644 3300046660 Bacteria 7581
247 Ga0495588_0027351 3300046674 Bacteria 2851
248 Ga0495658_0007689 3300046683 Bacteria 5341
249 Ga0495581_0019021 3300047315 Bacteria 3986
250 Ga0495676_0115055 3300047321 Bacteria 1967
251 Ga0496109_0191362 3300048912 Bacteria 1923
252 Ga0496115_0017679 3300048918 Bacteria 5458
253 Ga0496125_0001048 3300048928 Bacteria 42722
254 Ga0496126_0009112 3300048929 Bacteria 10596
255 Ga0501305_002501 3300049161 Bacteria 1993
256 Ga0501312_006646 3300049528 Bacteria 1451
257 Ga0501031_0000288 3300049568 Bacteria 28555
258 Ga0501031_0305684 3300049568 Bacteria 1030
259 Ga0501032_0001389 3300049569 Bacteria 19217
260 Ga0501032_0001412 3300049569 Bacteria 19072
261 Ga0501032_0008221 3300049569 Bacteria 7603
262 Ga0501032_0042438 3300049569 Bacteria 3085
263 Ga0501033_0000021 3300049570 Bacteria 192208
264 Ga0501033_0000074 3300049570 Bacteria 94345
265 Ga0501033_0000882 3300049570 Bacteria 27415
266 Ga0501033_0001315 3300049570 Bacteria 22076
267 Ga0501034_0147822 3300049571 Bacteria 2326
268 Ga0501036_0075486 3300049572 Bacteria 2850
269 Ga0501036_0097728 3300049572 Bacteria 2482
270 Ga0501036_0110916 3300049572 Bacteria 2318
271 Ga0501037_0000145 3300049573 Bacteria 66010
272 Ga0501037_0014516 3300049573 Bacteria 5794
273 Ga0501037_0019969 3300049573 Bacteria 4945
274 Ga0501038_0000559 3300049574 Bacteria 32919
275 Ga0501038_0046028 3300049574 Bacteria 3784
276 Ga0501038_0107487 3300049574 Bacteria 2314
277 Ga0501039_0010884 3300049575 Bacteria 6933
278 Ga0501043_0002411 3300049579 Bacteria 15826
279 Ga0501043_0020306 3300049579 Bacteria 5211
280 Ga0501046_0001090 3300049580 Bacteria 26582
281 Ga0501046_0160611 3300049580 Bacteria 1690
282 Ga0501047_0005079 3300049581 Bacteria 12352
283 Ga0501047_0263862 3300049581 Bacteria 1569
284 Ga0501048_0119226 3300049582 Bacteria 1864
285 Ga0501048_0127026 3300049582 Bacteria 1803
286 Ga0501070_0007074 3300049586 Bacteria 9544
287 Ga0501070_0037843 3300049586 Bacteria 4027
288 Ga0501070_0192680 3300049586 Bacteria 1675
289 Ga0501070_0242281 3300049586 Bacteria 1476
290 Ga0501070_0480011 3300049586 Bacteria 1000
291 Ga0501243_030354 3300049675 Bacteria 920
292 Ga0501080_0075037 3300049742 Bacteria 3146
293 Ga0501080_0104419 3300049742 Bacteria 2628
294 Ga0501080_0344787 3300049742 Bacteria 1346
295 Ga0501083_0001769 3300049744 Bacteria 14763
296 Ga0501035_0000002 3300049822 Bacteria 585447
297 Ga0501035_0009323 3300049822 Bacteria 9121
298 Ga0501035_0010122 3300049822 Bacteria 8752
299 Ga0501044_0009583 3300049823 Bacteria 10541
300 Ga0501044_0011740 3300049823 Bacteria 9488
301 Ga0501044_0062551 3300049823 Bacteria 3804
302 Ga0501044_0133610 3300049823 Bacteria 2474
303 Ga0501045_0428436 3300049824 Bacteria 984
304 nmdc:mga05p37_242539_c1 3300050507 Bacteria 2166
305 nmdc:mga08y16_221484_c1 3300050511 Bacteria 1958
306 Ga0500646_0028422 3300053090 Bacteria 1526
307 Ga0500641_0000092 3300053096 Bacteria 34933
308 Ga0500642_0028868 3300053130 Bacteria 2293
309 Ga0501082_0240301 3300060353 Bacteria 1576
310 Ga0466962_0000046 3300061719 Bacteria 52219
311 2787509096 2786546548 Bacteria 4745694
312 2788435644 2786546940 Bacteria 6396474
313 2881248429 2881247448 Bacteria 3717788
314 Ga0068871_100200118
315 JGI24033J26618_1001440
316 rootH2_10014581
317 rootH2_10018539
318 rootL2_10038826
319 rootH1_10052629
320 Ga0070658_10012826
321 Ga0070676_10003308
322 Ga0070683_100000678
323 Ga0070683_100168274
324 Ga0070690_100000961
325 Ga0070670_100592285
326 Ga0068869_100002769
327 Ga0070666_10024786
328 Ga0070680_100339016
329 Ga0068868_100012435
330 Ga0068868_100057754
331 Ga0068868_100188617
332 Ga0068868_100266815
333 Ga0070660_100047966
334 Ga0070689_100000034
335 Ga0070689_100036470
336 Ga0070687_100003383
337 Ga0070661_100003563
338 Ga0070668_100012036
339 Ga0070669_100010670
340 Ga0070669_100211952
341 Ga0070675_100025623
342 Ga0070675_100088524
343 Ga0070671_100001696
344 Ga0070671_100030423
345 Ga0070671_100589721
346 Ga0070674_100021101
347 Ga0070674_100077671
348 Ga0070674_100172030
349 Ga0070673_100085101
350 Ga0070673_100384914
351 Ga0070688_100001523
352 Ga0070659_100060654
353 Ga0070667_100008641
354 Ga0070667_100019801
355 Ga0070667_100651278
356 Ga0070710_10031738
357 Ga0070701_10000354
358 Ga0070700_100001338
359 Ga0070678_100027103
360 Ga0070678_100032667
361 Ga0070678_100155992
362 Ga0068867_100000837
363 Ga0068867_100001590
364 Ga0068867_100032706
365 Ga0070685_10000278
366 Ga0070699_100350983
367 Ga0070679_100117285
368 Ga0070672_100018454
369 Ga0070672_100042393
370 Ga0070686_100000053
371 Ga0070665_100018595
372 Ga0070665_100136672
373 Ga0070665_100206681
374 Ga0070664_100038634
375 Ga0068857_100037001
376 Ga0068856_100000326
377 Ga0068856_100006226
378 Ga0068856_100410002
379 Ga0068859_100001151
380 Ga0068861_100120476
381 Ga0068858_100390618
382 Ga0068860_100030343
383 Ga0081539_10005759
384 Ga0070717_10000016
385 Ga0097621_100188320
386 Ga0068871_100093115
387 Ga0068871_100538031
388 Ga0068865_100040221
389 Ga0068865_100158911
390 Ga0097620_100001151
391 Ga0105240_10466353
392 Ga0105240_11000263
393 Ga0105245_10446331
394 Ga0114129_10237872
395 Ga0105242_10011055
396 Ga0105248_10000116
397 Ga0105239_10574394
398 Ga0157374_10013126
399 Ga0157374_10035317
400 Ga0157378_10002900
401 Ga0157378_10289076
402 Ga0157378_10299360
403 Ga0163162_10035394
404 Ga0163162_10304339
405 Ga0163162_10370465
406 Ga0157372_10296637
407 Ga0157375_10016995
408 Ga0157375_10226262
409 Ga0163163_10036535
410 Ga0163163_10158756
411 Ga0157376_10005528
412 Ga0157376_10054447
413 Ga0163161_10115401
414 Ga0213876_10010457
415 Ga0213876_10185478
416 Ga0207673_1006491
417 Ga0209050_1000236
418 Ga0207697_10000163
419 Ga0207697_10002689
420 Ga0207682_10195565
421 Ga0207688_10010661
422 Ga0207688_10083416
423 Ga0207680_10011058
424 Ga0207645_10005348
425 Ga0207645_10005672
426 Ga0207705_10002538
427 Ga0207705_10035323
428 Ga0207695_10411804
429 Ga0207663_10194891
430 Ga0207657_10374248
431 Ga0207657_10437710
432 Ga0207649_10000291
433 Ga0207681_10014723
434 Ga0207681_10086233
435 Ga0207650_10407931
436 Ga0207659_10023276
437 Ga0207659_10104309
438 Ga0207644_10018760
439 Ga0207644_10028154
440 Ga0207690_10040681
441 Ga0207670_10000024
442 Ga0207669_10053266
443 Ga0207669_10180151
444 Ga0207691_10001207
445 Ga0207689_10006104
446 Ga0207661_10006991
447 Ga0207679_10046292
448 Ga0207651_10028421
449 Ga0207668_10016671
450 Ga0207658_10010967
451 Ga0207677_10004942
452 Ga0207677_10052253
453 Ga0207703_10006408
454 Ga0207703_10329059
455 Ga0207708_10001757
456 Ga0207702_10000672
457 Ga0207702_10001609
458 Ga0207648_10000502
459 Ga0207648_10006026
460 Ga0207648_10041697
461 Ga0207674_10037711
462 Ga0207683_10012877
463 Ga0207683_10016886
464 Ga0268266_10281669
465 Ga0268264_10387295
466 Ga0265319_1000130
467 Ga0265319_1002742
468 Ga0265319_1006336
469 Ga0265319_1008936
470 Ga0265319_1018051
471 Ga0265319_1034134
472 Ga0265334_10016148
473 Ga0265318_10000190
474 Ga0265318_10000434
475 Ga0265318_10001069
476 Ga0265318_10003913
477 Ga0265318_10124037
478 Ga0265323_10000080
479 Ga0265323_10008972
480 Ga0265323_10019478
481 Ga0265323_10030610
482 Ga0265322_10000087
483 Ga0265322_10026957
484 Ga0265322_10031861
485 Ga0265330_10129043
486 Ga0265320_10000205
487 Ga0265320_10000412
488 Ga0265320_10008391
489 Ga0265320_10076817
490 Ga0265320_10167028
491 Ga0265325_10109344
492 Ga0265339_10127749
493 Ga0265327_10015094
494 Ga0265327_10032181
495 Ga0265327_10110433
496 Ga0265327_10218343
497 Ga0265316_10002448
498 Ga0265316_10016479
499 Ga0265316_10077020
500 Ga0265316_10081196
501 Ga0265316_10095417
502 Ga0265316_10195405
503 Ga0307509_10376601
504 Ga0307408_100000003
505 Ga0265313_10003592
506 Ga0265313_10005982
507 Ga0265313_10019740
508 Ga0265314_10008930
509 Ga0265314_10011865
510 Ga0265314_10038674
511 Ga0265314_10148265
512 Ga0265342_10014564
513 Ga0265342_10019832
514 Ga0265342_10040906
515 Ga0265342_10120158
516 Ga0307405_10069898
517 Ga0307410_10000002
518 Ga0307407_10032914
519 Ga0307412_10116173
520 Ga0307409_100006527
521 Ga0307416_100000057
522 Ga0307414_10020785
523 Ga0307414_10743171
524 Ga0373953_0099625
525 Ga0373956_0067614
526 Ga0373924_0011635
527 Ga0373937_0037149
528 Ga0373937_0053673
529 Ga0395899_0000349
530 Ga0395898_0000026
531 Ga0395905_0000119
532 Ga0436365_0395979
533 Ga0436365_0809833
534 Ga0436363_1651109
535 Ga0451853_0171139
536 Ga0451577_0053670
537 Ga0453683_0000264
538 Ga0453683_0285282
539 Ga0466965_0059428
540 Ga0466964_0030857
541 Ga0453684_0000045
542 Ga0453684_0145170
543 Ga0466971_0000020
544 Ga0466971_0215970
545 Ga0466957_0010671
546 Ga0451576_0002620
547 Ga0451576_0038620
548 Ga0451576_0177137
549 Ga0451576_0557467
550 Ga0466967_0033254
551 Ga0466967_0158652
552 Ga0495627_009609
553 Ga0495580_0129200
554 Ga0495594_0240296
555 Ga0495607_0010818
556 Ga0495606_0366092
557 Ga0495616_0030534
558 Ga0495643_0001055
559 Ga0495625_0010644
560 Ga0495588_0027351
561 Ga0495658_0007689
562 Ga0495581_0019021
563 Ga0495676_0115055
564 Ga0496109_0191362
565 Ga0496115_0017679
566 Ga0496125_0001048
567 Ga0496126_0009112
568 Ga0501305_002501
569 Ga0501312_006646
570 Ga0501031_0000288
571 Ga0501031_0305684
572 Ga0501032_0001389
573 Ga0501032_0001412
574 Ga0501032_0008221
575 Ga0501032_0042438
576 Ga0501033_0000021
577 Ga0501033_0000074
578 Ga0501033_0000882
579 Ga0501033_0001315
580 Ga0501034_0147822
581 Ga0501036_0075486
582 Ga0501036_0097728
583 Ga0501036_0110916
584 Ga0501037_0000145
585 Ga0501037_0014516
586 Ga0501037_0019969
587 Ga0501038_0000559
588 Ga0501038_0046028
589 Ga0501038_0107487
590 Ga0501039_0010884
591 Ga0501043_0002411
592 Ga0501043_0020306
593 Ga0501046_0001090
594 Ga0501046_0160611
595 Ga0501047_0005079
596 Ga0501047_0263862
597 Ga0501048_0119226
598 Ga0501048_0127026
599 Ga0501070_0007074
600 Ga0501070_0037843
601 Ga0501070_0192680
602 Ga0501070_0242281
603 Ga0501070_0480011
604 Ga0501243_030354
605 Ga0501080_0075037
606 Ga0501080_0104419
607 Ga0501080_0344787
608 Ga0501083_0001769
609 Ga0501035_0000002
610 Ga0501035_0009323
611 Ga0501035_0010122
612 Ga0501044_0009583
613 Ga0501044_0011740
614 Ga0501044_0062551
615 Ga0501044_0133610
616 Ga0501045_0428436
617 nmdc:mga05p37_242539_c1
618 nmdc:mga08y16_221484_c1
619 Ga0500646_0028422
620 Ga0500641_0000092
621 Ga0500642_0028868
622 Ga0501082_0240301
623 Ga0466962_0000046
624 2787509096
625 2788435644
626 2881248429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

33

279

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y8f-assembly1.cif.gz_A-2 crystal structure of triosephosphate isomerase from clostridium perfringens 0.9747 4 251
1b9b-assembly1.cif.gz_B triosephosphate isomerase of thermotoga maritima 0.9738 3 253
7rmn-assembly1.cif.gz_B crystal structure of triosephosphate isomerase from verrucomicrobium spinosum 0.9708 4 255
6bve-assembly1.cif.gz_B triosephosphate isomerase of synechocystis in complex with 2-phosphoglycolic acid 0.9697 4 252
4y96-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from gemmata obscuriglobus 0.9676 4 254
ID Description Score Start End Superfamily
af_P17751_41_299_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.972 44 253 3.20.20.70
6bveB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9697 4 252 3.20.20.70
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9676 4 254 3.20.20.70
af_A0A1D6KAX1_115_218_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.965 163 243 3.20.20.70
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9638 4 254 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V6GZS1-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9988 82 257 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7S4TA46-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9986 125 250 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A645DQY7-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9984 97 254 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-T2RDA1-F1-model_v4 deleted 0.9977 86 251
AF-K1SGB4-F1-model_v4 Triose-phosphate isomerase 0.9972 109 256 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Map