F402124

General Info

Members Datasets Scaffolds Average Seq Length
313 254 288 282

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100395509|Ga0075428_1003955092
Length 295
Sequence MAQVIGGIATSHIPSIGKAIARGWQNDPHWKPFFDGYKPVHEWLHEMQPDVAVVVYNDHGLNFFLDKMPTFAVGAAAQYCNADEGWGLPVVAPFPGDPEFSWHVIESLVADEFDITMCQEMLVDHAFTVPMALLWPRSGWRPVTTIPIAVNTVQFPLPSPTRCYKLGKAIGRAIESFNDDLRVVVIATGGLSHQLDGERAGFINKKFDLMCLEKIVSDPLTLARYSAHDLVRDAGAQGVELLMWFVMRGAMTGLVTEKHHSYHVPISNTAAAVMVLENKSDWSEQWHDRSLLNQV

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
3 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
4 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
5 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
6 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
7 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
8 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
9 2643221580 Devosia sp. Root635 Isolate Unclassified
10 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
11 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
12 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
13 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
14 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
15 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
16 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
17 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
18 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
19 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
20 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
21 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
22 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
23 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
24 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
25 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
26 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
27 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
28 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
34 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
170 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
177 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
248 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
249 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
250 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
253 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
254 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.69
Metatranscriptomes 0.32
Isolates 7.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.25
Nodule 0.96
Rhizoplane 0.96
Rhizosphere 67.73
Stem 0
Stem Tuber 0
Unclassified 13.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000010 3300002739 Bacteria 53338
2 JGI25152J39213_1003154 3300002773 Bacteria 5752
3 JGI25159J45721_1000233 3300002987 Bacteria 26229
4 JGI25153J46596_10005260 3300003215 Bacteria 6805
5 rootH2_10174347 3300003320 Unclassified 3990
6 rootL2_10225079 3300003322 Unclassified 2714
7 rootH1_10025044 3300003323 Bacteria 1789
8 rootH1_10088174 3300003323 Bacteria 2499
9 JGI25160J50197_1013670 3300003354 Bacteria 2754
10 JGI25161J50226_1000079 3300003374 Bacteria 83375
11 Ga0055526_1003587 3300003771 Bacteria 9752
12 Ga0055536_1012446 3300003781 Bacteria 3156
13 Ga0055528_1017800 3300003790 Bacteria 2443
14 Ga0055540_1002812 3300003792 Bacteria 8899
15 Ga0055540_1003555 3300003792 Bacteria 7457
16 Ga0055531_10009397 3300003794 Bacteria 4997
17 Ga0055543_1000031 3300004625 Bacteria 130583
18 Ga0065165_1001624 3300005262 Bacteria 22886
19 Ga0065715_10184012 3300005293 Bacteria 1457
20 Ga0065707_10109280 3300005295 Bacteria 2475
21 Ga0070690_100002105 3300005330 Bacteria 10633
22 Ga0070670_100001178 3300005331 Bacteria 20763
23 Ga0070670_100102855 3300005331 Bacteria 2460
24 Ga0070666_10000743 3300005335 Bacteria 19736
25 Ga0068868_100001994 3300005338 Bacteria 14038
26 Ga0070687_100095991 3300005343 Unclassified 1649
27 Ga0070661_100018210 3300005344 Unclassified 4991
28 Ga0070669_100160455 3300005353 Bacteria 1747
29 Ga0070675_100046013 3300005354 Bacteria 3573
30 Ga0070675_100369968 3300005354 Bacteria 1274
31 Ga0070671_100001002 3300005355 Bacteria 20791
32 Ga0070673_100017728 3300005364 Bacteria 5072
33 Ga0070688_100027440 3300005365 Bacteria 3393
34 Ga0070667_100005381 3300005367 Bacteria 10694
35 Ga0070714_100254932 3300005435 Bacteria 1623
36 Ga0070713_100153213 3300005436 Bacteria 2052
37 Ga0070711_100050839 3300005439 Bacteria 2844
38 Ga0070663_100013898 3300005455 Bacteria 5150
39 Ga0070685_10048960 3300005466 Unclassified 2436
40 Ga0070706_100286260 3300005467 Bacteria 1538
41 Ga0070684_100035865 3300005535 Unclassified 4247
42 Ga0070672_100003580 3300005543 Bacteria 10064
43 Ga0070686_100033582 3300005544 Unclassified 3154
44 Ga0070665_100036030 3300005548 Bacteria 4978
45 Ga0070665_100341710 3300005548 Bacteria 1502
46 Ga0068855_100042247 3300005563 Bacteria 5402
47 Ga0070664_100001788 3300005564 Bacteria 17252
48 Ga0068852_100495581 3300005616 Bacteria 1216
49 Ga0068859_100078122 3300005617 Unclassified 3350
50 Ga0068859_100168521 3300005617 Bacteria 2270
51 Ga0068864_100001588 3300005618 Bacteria 18709
52 Ga0068851_10012793 3300005834 Bacteria 3964
53 Ga0068870_10052486 3300005840 Bacteria 2162
54 Ga0068863_100049870 3300005841 Bacteria 3969
55 Ga0068863_100243865 3300005841 Unclassified 1734
56 Ga0068858_100039855 3300005842 Unclassified 4355
57 Ga0068862_100069010 3300005844 Bacteria 3050
58 Ga0081455_10102950 3300005937 Bacteria 2288
59 Ga0070717_10107189 3300006028 Bacteria 2379
60 Ga0075365_10377191 3300006038 Bacteria 1000
61 Ga0075368_10021165 3300006042 Bacteria 2468
62 Ga0070716_100008080 3300006173 Bacteria 5210
63 Ga0075369_10046798 3300006186 Bacteria 1864
64 Ga0075369_10050273 3300006186 Bacteria 1803
65 Ga0097621_100026286 3300006237 Unclassified 4564
66 Ga0075428_100395509 3300006844 Bacteria 1481
67 Ga0075428_100425825 3300006844 Bacteria 1422
68 Ga0075430_100146638 3300006846 Bacteria 1966
69 Ga0075430_100439530 3300006846 Bacteria 1077
70 Ga0075433_10023694 3300006852 Bacteria 5170
71 Ga0075433_10031283 3300006852 Bacteria 4549
72 Ga0075434_100471192 3300006871 Bacteria 1277
73 Ga0075434_100655926 3300006871 Bacteria 1068
74 Ga0075429_100085105 3300006880 Bacteria 2756
75 Ga0097620_100078122 3300006931 Unclassified 3350
76 Ga0097620_100168518 3300006931 Bacteria 2270
77 Ga0105240_10009329 3300009093 Bacteria 13908
78 Ga0105240_10139634 3300009093 Unclassified 2898
79 Ga0105240_10457576 3300009093 Bacteria 1427
80 Ga0111539_10007019 3300009094 Bacteria 14450
81 Ga0111539_10007182 3300009094 Bacteria 14276
82 Ga0114129_10021455 3300009147 Bacteria 9167
83 Ga0114129_10089183 3300009147 Bacteria 4275
84 Ga0114129_10292178 3300009147 Bacteria 2175
85 Ga0105242_10007883 3300009176 Bacteria 8196
86 Ga0105248_10775932 3300009177 Bacteria 1082
87 Ga0105248_10829275 3300009177 Bacteria 1044
88 Ga0105237_10032599 3300009545 Bacteria 5274
89 Ga0105237_10063022 3300009545 Unclassified 3706
90 Ga0105238_10140823 3300009551 Unclassified 2389
91 Ga0105246_10037548 3300011119 Unclassified 3251
92 Ga0157370_10059979 3300013104 Bacteria 3614
93 Ga0157369_10030747 3300013105 Bacteria 5920
94 Ga0157378_10007697 3300013297 Bacteria 9398
95 Ga0163162_10003245 3300013306 Bacteria 15555
96 Ga0157375_10001802 3300013308 Bacteria 18361
97 Ga0157375_10057884 3300013308 Bacteria 3832
98 Ga0163163_10019889 3300014325 Bacteria 6314
99 Ga0163163_10045409 3300014325 Bacteria 4311
100 Ga0163163_10074630 3300014325 Bacteria 3384
101 Ga0163163_10111535 3300014325 Bacteria 2764
102 Ga0163163_10125906 3300014325 Bacteria 2600
103 Ga0157380_10004245 3300014326 Bacteria 9914
104 Ga0157377_10094519 3300014745 Unclassified 1771
105 Ga0209436_100043 3300025208 Bacteria 71870
106 Ga0207425_1012819 3300025245 Bacteria 1954
107 Ga0209129_1004113 3300025258 Bacteria 5908
108 Ga0209129_1005579 3300025258 Bacteria 4389
109 Ga0209673_1015163 3300025273 Bacteria 2943
110 Ga0209130_1000023 3300025284 Bacteria 359355
111 Ga0209676_1013642 3300025292 Bacteria 3111
112 Ga0209025_1005593 3300025294 Bacteria 10156
113 Ga0209564_1004387 3300025295 Bacteria 8654
114 Ga0209758_1000170 3300025297 Bacteria 149476
115 Ga0209758_1007018 3300025297 Bacteria 7827
116 Ga0209758_1007020 3300025297 Bacteria 7826
117 Ga0209050_1007449 3300025298 Bacteria 6132
118 Ga0209256_1003046 3300025299 Bacteria 12354
119 Ga0207426_1000087 3300025302 Bacteria 288870
120 Ga0207426_1064703 3300025302 Bacteria 1039
121 Ga0209051_1001025 3300025303 Bacteria 26597
122 Ga0209051_1008514 3300025303 Bacteria 5418
123 Ga0209257_1007708 3300025304 Bacteria 6419
124 Ga0207680_10002403 3300025903 Bacteria 8727
125 Ga0207699_10004259 3300025906 Bacteria 6841
126 Ga0207643_10084673 3300025908 Bacteria 1841
127 Ga0207695_10127801 3300025913 Unclassified 2502
128 Ga0207695_10262670 3300025913 Bacteria 1624
129 Ga0207695_10423425 3300025913 Bacteria 1215
130 Ga0207693_10017070 3300025915 Bacteria 5794
131 Ga0207660_10144242 3300025917 Bacteria 1823
132 Ga0207649_10072019 3300025920 Unclassified 2210
133 Ga0207652_10051668 3300025921 Bacteria 3525
134 Ga0207681_10158287 3300025923 Bacteria 1704
135 Ga0207694_10038665 3300025924 Bacteria 3669
136 Ga0207650_10005468 3300025925 Bacteria 8670
137 Ga0207650_10068504 3300025925 Bacteria 2665
138 Ga0207659_10086018 3300025926 Bacteria 2337
139 Ga0207700_10115766 3300025928 Bacteria 2165
140 Ga0207664_10006896 3300025929 Bacteria 7853
141 Ga0207686_10010381 3300025934 Bacteria 5071
142 Ga0207670_10068154 3300025936 Bacteria 2451
143 Ga0207665_10014022 3300025939 Bacteria 5272
144 Ga0207691_10063406 3300025940 Unclassified 3352
145 Ga0207711_10004161 3300025941 Bacteria 12392
146 Ga0207679_10007418 3300025945 Bacteria 6954
147 Ga0207667_10120232 3300025949 Bacteria 2707
148 Ga0207651_10010548 3300025960 Bacteria 5127
149 Ga0207658_10002595 3300025986 Bacteria 13122
150 Ga0207703_10020741 3300026035 Bacteria 5141
151 Ga0207703_10068771 3300026035 Unclassified 2918
152 Ga0207703_10233681 3300026035 Bacteria 1649
153 Ga0207678_10025281 3300026067 Bacteria 5185
154 Ga0207641_10022717 3300026088 Bacteria 5164
155 Ga0207641_10097773 3300026088 Bacteria 2581
156 Ga0207641_10226119 3300026088 Unclassified 1737
157 Ga0207676_10001856 3300026095 Bacteria 15471
158 Ga0209981_1000182 3300027378 Bacteria 7715
159 Ga0210000_1006764 3300027462 Bacteria 1670
160 Ga0209999_1001350 3300027543 Bacteria 4209
161 Ga0209983_1002194 3300027665 Bacteria 4296
162 Ga0207428_10043572 3300027907 Bacteria 3623
163 Ga0268266_10004949 3300028379 Bacteria 12607
164 Ga0268264_10739193 3300028381 Bacteria 979
165 Ga0307515_10014761 3300028794 Bacteria 14451
166 Ga0307515_10048694 3300028794 Bacteria 6401
167 Ga0316576_10072346 3300031727 Bacteria 2545
168 Ga0307410_10544258 3300031852 Bacteria 961
169 Ga0307409_100752570 3300031995 Bacteria 978
170 Ga0307416_100148420 3300032002 Bacteria 2146
171 Ga0316593_10027084 3300032168 Bacteria 1837
172 Ga0373934_0004374 3300035086 Bacteria 5219
173 Ga0373941_0119911 3300035115 Bacteria 937
174 Ga0373956_0004265 3300035119 Bacteria 5746
175 Ga0373955_0146013 3300035172 Bacteria 1390
176 Ga0373931_0136455 3300035691 Bacteria 1417
177 Ga0373933_0000116 3300035724 Bacteria 51474
178 Ga0373937_0000001 3300036401 Bacteria 478903
179 Ga0373937_0007709 3300036401 Bacteria 9333
180 Ga0373937_0097955 3300036401 Unclassified 2720
181 Ga0373937_0099648 3300036401 Bacteria 2695
182 Ga0373937_0119163 3300036401 Bacteria 2459
183 Ga0316582_0171706 3300036647 Bacteria 1472
184 Ga0316584_0022553 3300036712 Bacteria 4594
185 Ga0436364_0284407 3300037853 Bacteria 16880
186 Ga0436364_0288300 3300037853 Bacteria 1647
187 Ga0436364_0802634 3300037853 Bacteria 2193
188 Ga0400485_10823 3300038735 Bacteria 11344
189 Ga0400485_18093 3300038735 Bacteria 2797
190 Ga0400489_26464 3300039093 Bacteria 2976
191 Ga0436365_0277313 3300039437 Bacteria 2242
192 Ga0436360_0786729 3300039438 Bacteria 1102
193 Ga0436361_0178809 3300039447 Bacteria 8427
194 Ga0439465_0007004 3300041413 Bacteria 3583
195 Ga0439441_007547 3300042001 Bacteria 1755
196 Ga0439451_012320 3300042009 Unclassified 1726
197 Ga0439446_0051830 3300042156 Bacteria 1227
198 Ga0451576_0110680 3300045051 Bacteria 2858
199 Ga0495651_0006872 3300046462 Bacteria 8696
200 Ga0495653_0429277 3300046463 Bacteria 835
201 Ga0495580_0130170 3300046472 Unclassified 1746
202 Ga0495583_0040940 3300046506 Bacteria 2173
203 Ga0495608_0008523 3300046511 Bacteria 7182
204 Ga0495628_0363708 3300046516 Unclassified 1062
205 Ga0495630_0126483 3300046517 Bacteria 1940
206 Ga0495630_0267954 3300046517 Unclassified 1305
207 Ga0495643_0050110 3300046522 Bacteria 2249
208 Ga0495652_0079910 3300046529 Bacteria 2702
209 Ga0495587_0000087 3300046536 Bacteria 71152
210 Ga0495667_0000257 3300046559 Bacteria 34351
211 Ga0495635_0129460 3300046663 Unclassified 1721
212 Ga0495657_0001529 3300046675 Bacteria 19900
213 Ga0495658_0040995 3300046683 Bacteria 2576
214 Ga0495658_0215474 3300046683 Unclassified 1201
215 Ga0495613_0030556 3300046689 Bacteria 4001
216 Ga0495649_0016580 3300046694 Bacteria 4174
217 Ga0495600_0080329 3300046809 Bacteria 2129
218 Ga0495604_0121332 3300047317 Bacteria 1892
219 Ga0495674_0103969 3300047319 Bacteria 2414
220 Ga0495675_0000227 3300047444 Bacteria 40596
221 Ga0495684_0133711 3300047471 Bacteria 1861
222 Ga0495602_0000086 3300048088 Bacteria 90226
223 Ga0496100_0408703 3300048903 Bacteria 1035
224 Ga0496102_0016782 3300048905 Bacteria 6404
225 Ga0496106_0000028 3300048909 Bacteria 143296
226 Ga0496116_0006622 3300048919 Bacteria 10471
227 Ga0496116_0071511 3300048919 Bacteria 2196
228 Ga0496117_0000117 3300048920 Bacteria 177596
229 Ga0496117_0033633 3300048920 Bacteria 3874
230 Ga0496118_0000025 3300048921 Bacteria 379363
231 Ga0496118_0005218 3300048921 Bacteria 14858
232 Ga0496119_0005675 3300048922 Bacteria 11842
233 Ga0496120_0014112 3300048923 Bacteria 5337
234 Ga0496121_0045863 3300048924 Bacteria 3749
235 Ga0496121_0101576 3300048924 Bacteria 2217
236 Ga0496122_0088317 3300048925 Bacteria 2125
237 Ga0496123_0019238 3300048926 Bacteria 5388
238 Ga0496124_0010525 3300048927 Bacteria 9356
239 Ga0496124_0142986 3300048927 Unclassified 1885
240 Ga0496126_0001715 3300048929 Bacteria 32548
241 Ga0501032_0026351 3300049569 Bacteria 4000
242 Ga0501034_0171196 3300049571 Bacteria 2139
243 Ga0501037_0348558 3300049573 Bacteria 1022
244 Ga0501038_0274722 3300049574 Bacteria 1328
245 Ga0501041_0050349 3300049577 Bacteria 2539
246 Ga0501042_0001360 3300049578 Bacteria 14337
247 Ga0501043_0096703 3300049579 Bacteria 2321
248 Ga0501046_0124783 3300049580 Bacteria 1957
249 Ga0501047_0160431 3300049581 Bacteria 2120
250 Ga0501048_0357850 3300049582 Bacteria 1041
251 Ga0501068_0188252 3300049584 Bacteria 1307
252 Ga0501070_0119097 3300049586 Bacteria 2182
253 Ga0501072_0138439 3300049588 Bacteria 1941
254 Ga0501073_0155317 3300049589 Bacteria 1586
255 Ga0501074_0451061 3300049590 Bacteria 912
256 Ga0501076_0009457 3300049592 Bacteria 7200
257 Ga0501077_0138901 3300049593 Bacteria 1541
258 Ga0501079_0020175 3300049741 Bacteria 5094
259 Ga0501081_0031474 3300049743 Bacteria 3595
260 Ga0501035_0510181 3300049822 Bacteria 989
261 nmdc:mga03n38_57018_c1 3300050490 Bacteria 1765
262 nmdc:mga00v17_81646_c1 3300050491 Bacteria 2020
263 nmdc:mga0yw44_351229_c1 3300050492 Bacteria 993
264 nmdc:mga06z11_23297_c1 3300050494 Bacteria 2907
265 nmdc:mga07m45_33987_c1 3300050496 Bacteria 2833
266 nmdc:mga0qj67_254657_c1 3300050509 Bacteria 1124
267 nmdc:mga06r32_441698_c1 3300050510 Bacteria 1281
268 nmdc:mga06r32_79341_c1 3300050510 Bacteria 3193
269 nmdc:mga08y16_116523_c1 3300050511 Bacteria 2781
270 nmdc:mga08y16_15924_c1 3300050511 Bacteria 7903
271 nmdc:mga08y16_9335_c1 3300050511 Bacteria 10287
272 nmdc:mga0n895_347457_c1 3300050512 Bacteria 1502
273 nmdc:mga0n895_454500_c1 3300050512 Bacteria 1293
274 nmdc:mga0a205_113153_c1 3300050515 Bacteria 2613
275 nmdc:mga0a205_115445_c2 3300050515 Bacteria 1103
276 nmdc:mga0a205_18386_c1 3300050515 Bacteria 6570
277 nmdc:mga0sz30_52060_c1 3300050516 Bacteria 1738
278 Ga0500635_0139526 3300053080 Bacteria 919
279 Ga0500641_0079021 3300053096 Bacteria 1394
280 Ga0500594_0004980 3300053118 Bacteria 2937
281 Ga0500655_021096 3300053133 Bacteria 1220
282 Ga0500568_0006597 3300053139 Bacteria 5804
283 Ga0500604_0005688 3300053151 Bacteria 3290
284 Ga0500616_0000016 3300053153 Bacteria 627087
285 Ga0500616_0001606 3300053153 Bacteria 21050
286 Ga0500622_0000206 3300053156 Bacteria 62842
287 Ga0500633_0057521 3300053160 Bacteria 1359
288 Ga0500637_0038745 3300053178 Unclassified 2687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0429277 Ga0495653_0429277_122_820 228
2 3300042156 Ga0439446_0051830 Ga0439446_0051830_475_1194 236
3 3300049590 Ga0501074_0451061 Ga0501074_0451061_177_899 239
4 3300037853 Ga0436364_0284407 Ga0436364_0284407_3791_4591 265
5 3300039437 Ga0436365_0277313 Ga0436365_0277313_350_1156 267
6 3300009147 Ga0114129_10021455 Ga0114129_100214556 268
7 3300042001 Ga0439441_007547 Ga0439441_007547_890_1705 268
8 3300005467 Ga0070706_100286260 Ga0070706_1002862602 270
9 3300049822 Ga0501035_0510181 Ga0501035_0510181_38_856 270
10 3300048903 Ga0496100_0408703 Ga0496100_0408703_198_1022 272
11 iso_pu_bacteria 2897803580 2897806444 273
12 iso_pu_bacteria 2522572158 2523107189 274
13 iso_pu_bacteria 2597490356 2599100934 274
14 iso_pu_bacteria 2738541275 2738709659 274
15 iso_pu_bacteria 2738541301 2738848084 274
16 iso_pu_bacteria 2738541304 2738863813 274
17 iso_pu_bacteria 2738543022 2739296331 274
18 iso_pu_bacteria 2738543033 2739358009 274
19 iso_pu_bacteria 2848858292 2848863974 274
20 iso_pu_bacteria 2928100450 2928101215 274
21 iso_pu_bacteria 2928959182 2928960375 274
22 3300042009 Ga0439451_012320 Ga0439451_012320_182_1021 275
23 iso_pu_bacteria 2891048133 2891048671 275
24 iso_pu_bacteria 2932801729 2932801865 275
25 3300005262 Ga0065165_1001624 Ga0065165_10016249 276
26 3300009093 Ga0105240_10457576 Ga0105240_104575762 276
27 3300025302 Ga0207426_1064703 Ga0207426_10647032 276
28 3300025913 Ga0207695_10423425 Ga0207695_104234252 276
29 3300036712 Ga0316584_0022553 Ga0316584_0022553_1368_2204 276
30 iso_pu_bacteria 2510917026 2511169701 276
31 iso_pu_bacteria 2510917030 2511197493 276
32 iso_pu_bacteria 2582581298 2585225092 276
33 iso_pu_bacteria 2585427529 2585547648 276
34 iso_pu_bacteria 2585427633 2585994204 276
35 iso_pu_bacteria 2585427634 2585998722 276
36 iso_pu_bacteria 2643221580 2643911086 276
37 iso_pu_bacteria 2889790730 2889795737 276
38 iso_pu_bacteria 2919100787 2919105755 276
39 iso_pu_bacteria 2919171160 2919172231 276
40 iso_pu_bacteria 3000405567 3000405854 276
41 iso_pu_bacteria 3005445848 3005448986 276
42 3300006846 Ga0075430_100146638 Ga0075430_1001466383 277
43 3300009094 Ga0111539_10007182 Ga0111539_100071829 277
44 3300036401 Ga0373937_0119163 Ga0373937_0119163_1151_2035 277
45 3300038735 Ga0400485_18093 Ga0400485_18093_171_1013 277
46 3300045051 Ga0451576_0110680 Ga0451576_0110680_1455_2294 277
47 3300050509 nmdc:mga0qj67_254657_c1 nmdc:mga0qj67_254657_c1_179_1021 277
48 3300050511 nmdc:mga08y16_15924_c1 nmdc:mga08y16_15924_c1_6452_7324 277
49 3300003320 rootH2_10174347 rootH2_101743471 278
50 3300003322 rootL2_10225079 rootL2_102250793 278
51 3300003323 rootH1_10025044 rootH1_100250442 278
52 3300005293 Ga0065715_10184012 Ga0065715_101840122 278
53 3300005295 Ga0065707_10109280 Ga0065707_101092804 278
54 3300005330 Ga0070690_100002105 Ga0070690_1000021055 278
55 3300005331 Ga0070670_100001178 Ga0070670_10000117811 278
56 3300005331 Ga0070670_100102855 Ga0070670_1001028552 278
57 3300005335 Ga0070666_10000743 Ga0070666_1000074311 278
58 3300005338 Ga0068868_100001994 Ga0068868_1000019944 278
59 3300005343 Ga0070687_100095991 Ga0070687_1000959912 278
60 3300005344 Ga0070661_100018210 Ga0070661_1000182103 278
61 3300005354 Ga0070675_100046013 Ga0070675_1000460133 278
62 3300005354 Ga0070675_100369968 Ga0070675_1003699682 278
63 3300005355 Ga0070671_100001002 Ga0070671_1000010024 278
64 3300005364 Ga0070673_100017728 Ga0070673_1000177284 278
65 3300005365 Ga0070688_100027440 Ga0070688_1000274403 278
66 3300005367 Ga0070667_100005381 Ga0070667_1000053816 278
67 3300005435 Ga0070714_100254932 Ga0070714_1002549322 278
68 3300005436 Ga0070713_100153213 Ga0070713_1001532132 278
69 3300005439 Ga0070711_100050839 Ga0070711_1000508392 278
70 3300005455 Ga0070663_100013898 Ga0070663_1000138985 278
71 3300005466 Ga0070685_10048960 Ga0070685_100489602 278
72 3300005535 Ga0070684_100035865 Ga0070684_1000358653 278
73 3300005543 Ga0070672_100003580 Ga0070672_1000035803 278
74 3300005544 Ga0070686_100033582 Ga0070686_1000335824 278
75 3300005548 Ga0070665_100036030 Ga0070665_1000360306 278
76 3300005563 Ga0068855_100042247 Ga0068855_1000422474 278
77 3300005564 Ga0070664_100001788 Ga0070664_10000178818 278
78 3300005616 Ga0068852_100495581 Ga0068852_1004955812 278
79 3300005617 Ga0068859_100078122 Ga0068859_1000781223 278
80 3300005617 Ga0068859_100168521 Ga0068859_1001685211 278
81 3300005618 Ga0068864_100001588 Ga0068864_10000158814 278
82 3300005834 Ga0068851_10012793 Ga0068851_100127931 278
83 3300005840 Ga0068870_10052486 Ga0068870_100524863 278
84 3300005841 Ga0068863_100049870 Ga0068863_1000498702 278
85 3300005841 Ga0068863_100243865 Ga0068863_1002438653 278
86 3300005842 Ga0068858_100039855 Ga0068858_1000398556 278
87 3300005844 Ga0068862_100069010 Ga0068862_1000690102 278
88 3300005937 Ga0081455_10102950 Ga0081455_101029504 278
89 3300006028 Ga0070717_10107189 Ga0070717_101071892 278
90 3300006173 Ga0070716_100008080 Ga0070716_1000080803 278
91 3300006237 Ga0097621_100026286 Ga0097621_1000262865 278
92 3300006844 Ga0075428_100395509 Ga0075428_1003955092 278
93 3300006844 Ga0075428_100425825 Ga0075428_1004258252 278
94 3300006846 Ga0075430_100439530 Ga0075430_1004395301 278
95 3300006852 Ga0075433_10023694 Ga0075433_100236944 278
96 3300006852 Ga0075433_10031283 Ga0075433_100312835 278
97 3300006871 Ga0075434_100471192 Ga0075434_1004711921 278
98 3300006871 Ga0075434_100655926 Ga0075434_1006559262 278
99 3300006880 Ga0075429_100085105 Ga0075429_1000851053 278
100 3300006931 Ga0097620_100078122 Ga0097620_1000781224 278
101 3300006931 Ga0097620_100168518 Ga0097620_1001685183 278
102 3300009093 Ga0105240_10009329 Ga0105240_1000932911 278
103 3300009093 Ga0105240_10139634 Ga0105240_101396343 278
104 3300009094 Ga0111539_10007019 Ga0111539_1000701911 278
105 3300009147 Ga0114129_10089183 Ga0114129_100891834 278
106 3300009147 Ga0114129_10292178 Ga0114129_102921782 278
107 3300009176 Ga0105242_10007883 Ga0105242_100078832 278
108 3300009177 Ga0105248_10775932 Ga0105248_107759322 278
109 3300009177 Ga0105248_10829275 Ga0105248_108292752 278
110 3300009545 Ga0105237_10032599 Ga0105237_100325994 278
111 3300009545 Ga0105237_10063022 Ga0105237_100630225 278
112 3300009551 Ga0105238_10140823 Ga0105238_101408234 278
113 3300011119 Ga0105246_10037548 Ga0105246_100375484 278
114 3300013104 Ga0157370_10059979 Ga0157370_100599793 278
115 3300013105 Ga0157369_10030747 Ga0157369_100307473 278
116 3300013297 Ga0157378_10007697 Ga0157378_100076975 278
117 3300013306 Ga0163162_10003245 Ga0163162_1000324513 278
118 3300013308 Ga0157375_10001802 Ga0157375_100018029 278
119 3300013308 Ga0157375_10057884 Ga0157375_100578843 278
120 3300014325 Ga0163163_10019889 Ga0163163_100198898 278
121 3300014325 Ga0163163_10045409 Ga0163163_100454094 278
122 3300014325 Ga0163163_10074630 Ga0163163_100746302 278
123 3300014325 Ga0163163_10111535 Ga0163163_101115352 278
124 3300014325 Ga0163163_10125906 Ga0163163_101259062 278
125 3300014326 Ga0157380_10004245 Ga0157380_100042454 278
126 3300014745 Ga0157377_10094519 Ga0157377_100945192 278
127 3300025903 Ga0207680_10002403 Ga0207680_100024034 278
128 3300025906 Ga0207699_10004259 Ga0207699_100042597 278
129 3300025908 Ga0207643_10084673 Ga0207643_100846733 278
130 3300025913 Ga0207695_10127801 Ga0207695_101278014 278
131 3300025913 Ga0207695_10262670 Ga0207695_102626701 278
132 3300025915 Ga0207693_10017070 Ga0207693_100170701 278
133 3300025917 Ga0207660_10144242 Ga0207660_101442422 278
134 3300025920 Ga0207649_10072019 Ga0207649_100720192 278
135 3300025921 Ga0207652_10051668 Ga0207652_100516684 278
136 3300025924 Ga0207694_10038665 Ga0207694_100386654 278
137 3300025925 Ga0207650_10005468 Ga0207650_100054688 278
138 3300025925 Ga0207650_10068504 Ga0207650_100685043 278
139 3300025926 Ga0207659_10086018 Ga0207659_100860183 278
140 3300025928 Ga0207700_10115766 Ga0207700_101157663 278
141 3300025929 Ga0207664_10006896 Ga0207664_100068962 278
142 3300025934 Ga0207686_10010381 Ga0207686_100103812 278
143 3300025936 Ga0207670_10068154 Ga0207670_100681541 278
144 3300025939 Ga0207665_10014022 Ga0207665_100140223 278
145 3300025940 Ga0207691_10063406 Ga0207691_100634064 278
146 3300025941 Ga0207711_10004161 Ga0207711_100041614 278
147 3300025945 Ga0207679_10007418 Ga0207679_100074186 278
148 3300025949 Ga0207667_10120232 Ga0207667_101202323 278
149 3300025960 Ga0207651_10010548 Ga0207651_100105484 278
150 3300025986 Ga0207658_10002595 Ga0207658_1000259512 278
151 3300026035 Ga0207703_10020741 Ga0207703_100207415 278
152 3300026035 Ga0207703_10068771 Ga0207703_100687712 278
153 3300026035 Ga0207703_10233681 Ga0207703_102336812 278
154 3300026067 Ga0207678_10025281 Ga0207678_100252815 278
155 3300026088 Ga0207641_10022717 Ga0207641_100227171 278
156 3300026088 Ga0207641_10097773 Ga0207641_100977732 278
157 3300026088 Ga0207641_10226119 Ga0207641_102261192 278
158 3300026095 Ga0207676_10001856 Ga0207676_1000185611 278
159 3300027378 Ga0209981_1000182 Ga0209981_10001824 278
160 3300027462 Ga0210000_1006764 Ga0210000_10067642 278
161 3300027543 Ga0209999_1001350 Ga0209999_10013503 278
162 3300027665 Ga0209983_1002194 Ga0209983_10021944 278
163 3300027907 Ga0207428_10043572 Ga0207428_100435723 278
164 3300028379 Ga0268266_10004949 Ga0268266_100049493 278
165 3300028381 Ga0268264_10739193 Ga0268264_107391931 278
166 3300031727 Ga0316576_10072346 Ga0316576_100723463 278
167 3300031852 Ga0307410_10544258 Ga0307410_105442582 278
168 3300031995 Ga0307409_100752570 Ga0307409_1007525701 278
169 3300032002 Ga0307416_100148420 Ga0307416_1001484202 278
170 3300035086 Ga0373934_0004374 Ga0373934_0004374_2888_3736 278
171 3300035115 Ga0373941_0119911 Ga0373941_0119911_38_922 278
172 3300035119 Ga0373956_0004265 Ga0373956_0004265_2333_3181 278
173 3300035172 Ga0373955_0146013 Ga0373955_0146013_185_1033 278
174 3300035691 Ga0373931_0136455 Ga0373931_0136455_187_1029 278
175 3300035724 Ga0373933_0000116 Ga0373933_0000116_8127_8975 278
176 3300036401 Ga0373937_0000001 Ga0373937_0000001_476521_477369 278
177 3300036401 Ga0373937_0007709 Ga0373937_0007709_4833_5681 278
178 3300036401 Ga0373937_0097955 Ga0373937_0097955_485_1339 278
179 3300036401 Ga0373937_0099648 Ga0373937_0099648_1147_1995 278
180 3300038735 Ga0400485_10823 Ga0400485_10823_8394_9239 278
181 3300039093 Ga0400489_26464 Ga0400489_26464_1538_2380 278
182 3300039438 Ga0436360_0786729 Ga0436360_0786729_81_941 278
183 3300039447 Ga0436361_0178809 Ga0436361_0178809_4722_5564 278
184 3300046462 Ga0495651_0006872 Ga0495651_0006872_4565_5413 278
185 3300046472 Ga0495580_0130170 Ga0495580_0130170_556_1404 278
186 3300046511 Ga0495608_0008523 Ga0495608_0008523_870_1718 278
187 3300046516 Ga0495628_0363708 Ga0495628_0363708_149_997 278
188 3300046517 Ga0495630_0126483 Ga0495630_0126483_348_1196 278
189 3300046517 Ga0495630_0267954 Ga0495630_0267954_30_878 278
190 3300046529 Ga0495652_0079910 Ga0495652_0079910_1480_2328 278
191 3300046536 Ga0495587_0000087 Ga0495587_0000087_26409_27257 278
192 3300046559 Ga0495667_0000257 Ga0495667_0000257_27661_28509 278
193 3300046663 Ga0495635_0129460 Ga0495635_0129460_520_1368 278
194 3300046675 Ga0495657_0001529 Ga0495657_0001529_10417_11265 278
195 3300046683 Ga0495658_0040995 Ga0495658_0040995_1521_2405 278
196 3300046683 Ga0495658_0215474 Ga0495658_0215474_332_1180 278
197 3300046689 Ga0495613_0030556 Ga0495613_0030556_41_907 278
198 3300046809 Ga0495600_0080329 Ga0495600_0080329_215_1063 278
199 3300047317 Ga0495604_0121332 Ga0495604_0121332_775_1623 278
200 3300047319 Ga0495674_0103969 Ga0495674_0103969_1025_1891 278
201 3300047444 Ga0495675_0000227 Ga0495675_0000227_5043_5891 278
202 3300047471 Ga0495684_0133711 Ga0495684_0133711_802_1644 278
203 3300048088 Ga0495602_0000086 Ga0495602_0000086_52136_52984 278
204 3300048905 Ga0496102_0016782 Ga0496102_0016782_3008_3850 278
205 3300048919 Ga0496116_0006622 Ga0496116_0006622_9337_10179 278
206 3300048920 Ga0496117_0000117 Ga0496117_0000117_116710_117552 278
207 3300048921 Ga0496118_0000025 Ga0496118_0000025_318715_319557 278
208 3300048922 Ga0496119_0005675 Ga0496119_0005675_2945_3787 278
209 3300048923 Ga0496120_0014112 Ga0496120_0014112_1219_2061 278
210 3300048924 Ga0496121_0101576 Ga0496121_0101576_718_1560 278
211 3300048927 Ga0496124_0142986 Ga0496124_0142986_721_1563 278
212 3300048929 Ga0496126_0001715 Ga0496126_0001715_22056_22898 278
213 3300049573 Ga0501037_0348558 Ga0501037_0348558_84_944 278
214 3300049577 Ga0501041_0050349 Ga0501041_0050349_1094_1954 278
215 3300049578 Ga0501042_0001360 Ga0501042_0001360_10183_11043 278
216 3300049582 Ga0501048_0357850 Ga0501048_0357850_171_1031 278
217 3300049584 Ga0501068_0188252 Ga0501068_0188252_82_942 278
218 3300049586 Ga0501070_0119097 Ga0501070_0119097_1086_1961 278
219 3300049588 Ga0501072_0138439 Ga0501072_0138439_112_972 278
220 3300049592 Ga0501076_0009457 Ga0501076_0009457_1976_2836 278
221 3300049593 Ga0501077_0138901 Ga0501077_0138901_381_1241 278
222 3300049741 Ga0501079_0020175 Ga0501079_0020175_3508_4368 278
223 3300049743 Ga0501081_0031474 Ga0501081_0031474_288_1148 278
224 3300050510 nmdc:mga06r32_441698_c1 nmdc:mga06r32_441698_c1_110_997 278
225 3300050510 nmdc:mga06r32_79341_c1 nmdc:mga06r32_79341_c1_1411_2298 278
226 3300050511 nmdc:mga08y16_116523_c1 nmdc:mga08y16_116523_c1_1836_2675 278
227 3300050511 nmdc:mga08y16_9335_c1 nmdc:mga08y16_9335_c1_9045_9905 278
228 3300050512 nmdc:mga0n895_347457_c1 nmdc:mga0n895_347457_c1_524_1411 278
229 3300050512 nmdc:mga0n895_454500_c1 nmdc:mga0n895_454500_c1_69_929 278
230 3300050515 nmdc:mga0a205_113153_c1 nmdc:mga0a205_113153_c1_1329_2189 278
231 3300050515 nmdc:mga0a205_115445_c2 nmdc:mga0a205_115445_c2_158_997 278
232 3300050515 nmdc:mga0a205_18386_c1 nmdc:mga0a205_18386_c1_4447_5286 278
233 3300053096 Ga0500641_0079021 Ga0500641_0079021_393_1235 278
234 3300053153 Ga0500616_0000016 Ga0500616_0000016_405685_406527 278
235 3300053178 Ga0500637_0038745 Ga0500637_0038745_420_1262 278
236 3300006042 Ga0075368_10021165 Ga0075368_100211653 279
237 3300006186 Ga0075369_10050273 Ga0075369_100502732 279
238 3300028794 Ga0307515_10014761 Ga0307515_100147617 279
239 3300028794 Ga0307515_10048694 Ga0307515_100486942 279
240 3300032168 Ga0316593_10027084 Ga0316593_100270842 279
241 3300050490 nmdc:mga03n38_57018_c1 nmdc:mga03n38_57018_c1_823_1677 279
242 3300050491 nmdc:mga00v17_81646_c1 nmdc:mga00v17_81646_c1_1040_1894 279
243 3300050494 nmdc:mga06z11_23297_c1 nmdc:mga06z11_23297_c1_765_1619 279
244 3300050496 nmdc:mga07m45_33987_c1 nmdc:mga07m45_33987_c1_346_1197 279
245 3300050516 nmdc:mga0sz30_52060_c1 nmdc:mga0sz30_52060_c1_444_1307 279
246 3300053080 Ga0500635_0139526 Ga0500635_0139526_44_895 279
247 3300053118 Ga0500594_0004980 Ga0500594_0004980_2041_2895 279
248 3300053133 Ga0500655_021096 Ga0500655_021096_321_1172 279
249 3300053151 Ga0500604_0005688 Ga0500604_0005688_1404_2255 279
250 3300002739 JGI25158J39367_1000010 JGI25158J39367_10000109 280
251 3300002773 JGI25152J39213_1003154 JGI25152J39213_10031545 280
252 3300002987 JGI25159J45721_1000233 JGI25159J45721_100023317 280
253 3300003215 JGI25153J46596_10005260 JGI25153J46596_100052606 280
254 3300003323 rootH1_10088174 rootH1_100881743 280
255 3300003354 JGI25160J50197_1013670 JGI25160J50197_10136704 280
256 3300003374 JGI25161J50226_1000079 JGI25161J50226_100007976 280
257 3300003771 Ga0055526_1003587 Ga0055526_10035871 280
258 3300003781 Ga0055536_1012446 Ga0055536_10124464 280
259 3300003790 Ga0055528_1017800 Ga0055528_10178001 280
260 3300003792 Ga0055540_1002812 Ga0055540_10028124 280
261 3300003792 Ga0055540_1003555 Ga0055540_10035559 280
262 3300003794 Ga0055531_10009397 Ga0055531_100093972 280
263 3300004625 Ga0055543_1000031 Ga0055543_100003161 280
264 3300005353 Ga0070669_100160455 Ga0070669_1001604552 280
265 3300005548 Ga0070665_100341710 Ga0070665_1003417102 280
266 3300006038 Ga0075365_10377191 Ga0075365_103771911 280
267 3300006186 Ga0075369_10046798 Ga0075369_100467982 280
268 3300025208 Ga0209436_100043 Ga0209436_1000436 280
269 3300025245 Ga0207425_1012819 Ga0207425_10128193 280
270 3300025258 Ga0209129_1004113 Ga0209129_10041133 280
271 3300025258 Ga0209129_1005579 Ga0209129_10055793 280
272 3300025273 Ga0209673_1015163 Ga0209673_10151633 280
273 3300025284 Ga0209130_1000023 Ga0209130_1000023296 280
274 3300025292 Ga0209676_1013642 Ga0209676_10136422 280
275 3300025294 Ga0209025_1005593 Ga0209025_10055939 280
276 3300025295 Ga0209564_1004387 Ga0209564_10043879 280
277 3300025297 Ga0209758_1000170 Ga0209758_100017010 280
278 3300025297 Ga0209758_1007018 Ga0209758_10070183 280
279 3300025297 Ga0209758_1007020 Ga0209758_10070203 280
280 3300025298 Ga0209050_1007449 Ga0209050_10074496 280
281 3300025299 Ga0209256_1003046 Ga0209256_10030465 280
282 3300025302 Ga0207426_1000087 Ga0207426_100008766 280
283 3300025303 Ga0209051_1001025 Ga0209051_10010253 280
284 3300025303 Ga0209051_1008514 Ga0209051_10085146 280
285 3300025304 Ga0209257_1007708 Ga0209257_10077083 280
286 3300025923 Ga0207681_10158287 Ga0207681_101582872 280
287 3300036647 Ga0316582_0171706 Ga0316582_0171706_599_1441 280
288 3300037853 Ga0436364_0288300 Ga0436364_0288300_730_1581 280
289 3300037853 Ga0436364_0802634 Ga0436364_0802634_223_1071 280
290 3300041413 Ga0439465_0007004 Ga0439465_0007004_1947_2789 280
291 3300046506 Ga0495583_0040940 Ga0495583_0040940_837_1718 280
292 3300046522 Ga0495643_0050110 Ga0495643_0050110_721_1602 280
293 3300046694 Ga0495649_0016580 Ga0495649_0016580_1290_2132 280
294 3300048909 Ga0496106_0000028 Ga0496106_0000028_54897_55739 280
295 3300048919 Ga0496116_0071511 Ga0496116_0071511_1167_2009 280
296 3300048920 Ga0496117_0033633 Ga0496117_0033633_2227_3069 280
297 3300048921 Ga0496118_0005218 Ga0496118_0005218_500_1381 280
298 3300048924 Ga0496121_0045863 Ga0496121_0045863_2075_2917 280
299 3300048925 Ga0496122_0088317 Ga0496122_0088317_395_1237 280
300 3300048926 Ga0496123_0019238 Ga0496123_0019238_3274_4155 280
301 3300048927 Ga0496124_0010525 Ga0496124_0010525_3552_4394 280
302 3300049569 Ga0501032_0026351 Ga0501032_0026351_1623_2465 280
303 3300049571 Ga0501034_0171196 Ga0501034_0171196_1112_1954 280
304 3300049574 Ga0501038_0274722 Ga0501038_0274722_234_1076 280
305 3300049579 Ga0501043_0096703 Ga0501043_0096703_1313_2155 280
306 3300049580 Ga0501046_0124783 Ga0501046_0124783_1079_1921 280
307 3300049581 Ga0501047_0160431 Ga0501047_0160431_1130_1972 280
308 3300049589 Ga0501073_0155317 Ga0501073_0155317_180_1022 280
309 3300050492 nmdc:mga0yw44_351229_c1 nmdc:mga0yw44_351229_c1_91_945 280
310 3300053139 Ga0500568_0006597 Ga0500568_0006597_3582_4424 280
311 3300053153 Ga0500616_0001606 Ga0500616_0001606_3016_3858 280
312 3300053156 Ga0500622_0000206 Ga0500622_0000206_10563_11405 280
313 3300053160 Ga0500633_0057521 Ga0500633_0057521_64_906 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

6

274

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bou-assembly1.cif.gz_D three-dimensional structure of ligab 0.9651 2 278
3wpm-assembly1.cif.gz_A crystal structure of the anaerobic desb-gallate complex by co-crystallization 0.9615 2 280
3wku-assembly1.cif.gz_B crystal structure of the anaerobic desb-gallate complex 0.9606 2 280
3wrb-assembly1.cif.gz_A crystal structure of the anaerobic h124f desb-gallate complex 0.9591 2 280
3wrc-assembly1.cif.gz_A crystal structure of the anaerobic desb-protocatechuate (pca) complex 0.9538 2 280
ID Description Score Start End Superfamily
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9652 2 278 3.40.830.10
3wrcA01 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9536 3 280 3.40.830.10
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9517 2 278 3.40.830.10
3wrcA01 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.904 3 280 3.40.830.10
af_P0ABR9_4_309_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8202 7 274 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A2K9EPJ5-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9796 1 279 GO:0008198
GO:0051213
AF-A0A257F2K8-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9789 1 279 GO:0008198
GO:0051213
AF-A0A6L9S5K9-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9775 1 279 GO:0008198
GO:0051213
AF-A0A257F2K8-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9755 1 279 GO:0008198
GO:0051213
AF-A0A4V2UEE8-F1-model_v4 Protocatechuate 4,5-dioxygenase beta subunit 0.9753 44 280 GO:0008198
GO:0051213

Feature Viewer

pLDDT pTM Quality
92.98 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map