F402128
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 313 | 205 | 303 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_100772724|Ga0075431_1007727241 |
| Length | 184 |
| Sequence | MAVSSSKVKRAMVRVGLISDTHGLLRPEAKAFLRGSDYIVHGGDVGDPGILDELAALAPLTAVRGNNDRGPWAERLRETECLQVGEVFVYAIHDLAHLEIEPNAAGIHVVVSGHSHKPLVEKRRGVLYVNPGSSGPRRFKLPIAVGELLIEGRSVSARVVDLWDSARSGESHDFRPTIPVVLRW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 4 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 5 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 6 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 7 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 8 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 65 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 127 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 128 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 129 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 134 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 138 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 139 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 140 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 141 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 145 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 146 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 147 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 148 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 149 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 150 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 152 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 153 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 154 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 155 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 156 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 157 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 169 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 170 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 171 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 172 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 173 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 174 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 175 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 176 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 177 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 193 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 195 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 196 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 200 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 201 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 204 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 205 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.17 |
| Metatranscriptomes | 0.64 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.56 |
| Nodule | 0.96 |
| Rhizoplane | 0.64 |
| Rhizosphere | 91.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1001001 | 3300000546 | Bacteria | 4475 |
| 2 | rootL2_10010297 | 3300003322 | Bacteria | 8170 |
| 3 | Ga0065714_10184096 | 3300005288 | Bacteria | 952 |
| 4 | Ga0065704_10070513 | 3300005289 | Bacteria | 22024 |
| 5 | Ga0065707_10081844 | 3300005295 | Bacteria | 34337 |
| 6 | Ga0070690_100629315 | 3300005330 | Bacteria | 817 |
| 7 | Ga0070670_100003874 | 3300005331 | Bacteria | 12480 |
| 8 | Ga0068869_100070732 | 3300005334 | Bacteria | 2582 |
| 9 | Ga0068869_100141436 | 3300005334 | Bacteria | 1858 |
| 10 | Ga0070666_10322689 | 3300005335 | Bacteria | 1102 |
| 11 | Ga0070660_100116743 | 3300005339 | Bacteria | 2128 |
| 12 | Ga0070689_100272290 | 3300005340 | Bacteria | 1402 |
| 13 | Ga0070689_100642610 | 3300005340 | Bacteria | 922 |
| 14 | Ga0070691_10464454 | 3300005341 | Bacteria | 725 |
| 15 | Ga0070692_10220620 | 3300005345 | Unclassified | 1121 |
| 16 | Ga0070668_100971391 | 3300005347 | Unclassified | 762 |
| 17 | Ga0070669_100086624 | 3300005353 | Bacteria | 2341 |
| 18 | Ga0070669_100569432 | 3300005353 | Bacteria | 946 |
| 19 | Ga0070675_100178485 | 3300005354 | Unclassified | 1835 |
| 20 | Ga0070675_100243489 | 3300005354 | Bacteria | 1572 |
| 21 | Ga0070671_100280127 | 3300005355 | Bacteria | 1418 |
| 22 | Ga0070674_101397978 | 3300005356 | Unclassified | 626 |
| 23 | Ga0070673_100215079 | 3300005364 | Bacteria | 1661 |
| 24 | Ga0070673_100535754 | 3300005364 | Unclassified | 1062 |
| 25 | Ga0070667_100218750 | 3300005367 | Unclassified | 1695 |
| 26 | Ga0070667_100741158 | 3300005367 | Bacteria | 910 |
| 27 | Ga0070714_100035217 | 3300005435 | Bacteria | 4195 |
| 28 | Ga0070700_100283394 | 3300005441 | Bacteria | 1202 |
| 29 | Ga0070694_100021469 | 3300005444 | Bacteria | 4126 |
| 30 | Ga0070694_100114872 | 3300005444 | Bacteria | 1923 |
| 31 | Ga0070663_100104663 | 3300005455 | Bacteria | 2117 |
| 32 | Ga0070663_101752425 | 3300005455 | Unclassified | 556 |
| 33 | Ga0070678_100061855 | 3300005456 | Bacteria | 2761 |
| 34 | Ga0070678_100330853 | 3300005456 | Bacteria | 1304 |
| 35 | Ga0070678_100569241 | 3300005456 | Bacteria | 1008 |
| 36 | Ga0070678_100640479 | 3300005456 | Bacteria | 952 |
| 37 | Ga0070678_101545385 | 3300005456 | Bacteria | 622 |
| 38 | Ga0070662_100316960 | 3300005457 | Bacteria | 1271 |
| 39 | Ga0070681_10422512 | 3300005458 | Bacteria | 1245 |
| 40 | Ga0070681_10525402 | 3300005458 | Bacteria | 1097 |
| 41 | Ga0068867_100064090 | 3300005459 | Bacteria | 2732 |
| 42 | Ga0070706_100007038 | 3300005467 | Bacteria | 10606 |
| 43 | Ga0070707_100097490 | 3300005468 | Bacteria | 2847 |
| 44 | Ga0070707_100200579 | 3300005468 | Bacteria | 1945 |
| 45 | Ga0070698_100073257 | 3300005471 | Bacteria | 3432 |
| 46 | Ga0070698_100370026 | 3300005471 | Unclassified | 1365 |
| 47 | Ga0070699_100318345 | 3300005518 | Bacteria | 1398 |
| 48 | Ga0070679_100006165 | 3300005530 | Bacteria | 11159 |
| 49 | Ga0070679_100124722 | 3300005530 | Bacteria | 2558 |
| 50 | Ga0070679_100413011 | 3300005530 | Bacteria | 1295 |
| 51 | Ga0068853_100050320 | 3300005539 | Bacteria | 3584 |
| 52 | Ga0068853_100116517 | 3300005539 | Bacteria | 2379 |
| 53 | Ga0068853_100504972 | 3300005539 | Bacteria | 1142 |
| 54 | Ga0070672_100200737 | 3300005543 | Bacteria | 1668 |
| 55 | Ga0070695_100048554 | 3300005545 | Bacteria | 2715 |
| 56 | Ga0070695_100726870 | 3300005545 | Bacteria | 790 |
| 57 | Ga0070696_100002515 | 3300005546 | Bacteria | 12139 |
| 58 | Ga0070696_100009076 | 3300005546 | Bacteria | 6660 |
| 59 | Ga0070693_100017546 | 3300005547 | Bacteria | 3723 |
| 60 | Ga0070693_100367709 | 3300005547 | Bacteria | 988 |
| 61 | Ga0070665_100119099 | 3300005548 | Bacteria | 2642 |
| 62 | Ga0070665_100197584 | 3300005548 | Bacteria | 2012 |
| 63 | Ga0070665_101041698 | 3300005548 | Bacteria | 830 |
| 64 | Ga0068855_100006299 | 3300005563 | Bacteria | 14463 |
| 65 | Ga0068855_100090427 | 3300005563 | Bacteria | 3533 |
| 66 | Ga0068856_100032869 | 3300005614 | Bacteria | 5080 |
| 67 | Ga0068852_100261052 | 3300005616 | Bacteria | 1663 |
| 68 | Ga0068852_101635052 | 3300005616 | Bacteria | 667 |
| 69 | Ga0068864_100067500 | 3300005618 | Bacteria | 3106 |
| 70 | Ga0068864_100413603 | 3300005618 | Bacteria | 1284 |
| 71 | Ga0068864_101703646 | 3300005618 | Bacteria | 635 |
| 72 | Ga0068866_11112600 | 3300005718 | Unclassified | 566 |
| 73 | Ga0068863_100016599 | 3300005841 | Bacteria | 7065 |
| 74 | Ga0068863_100061915 | 3300005841 | Bacteria | 3538 |
| 75 | Ga0068863_100145970 | 3300005841 | Bacteria | 2263 |
| 76 | Ga0068858_100442303 | 3300005842 | Bacteria | 1252 |
| 77 | Ga0068860_100275643 | 3300005843 | Bacteria | 1643 |
| 78 | Ga0068860_100362007 | 3300005843 | Bacteria | 1429 |
| 79 | Ga0068860_101424822 | 3300005843 | Bacteria | 714 |
| 80 | Ga0075366_10009452 | 3300006195 | Bacteria | 5441 |
| 81 | Ga0097621_100039534 | 3300006237 | Bacteria | 3789 |
| 82 | Ga0097621_100096560 | 3300006237 | Bacteria | 2480 |
| 83 | Ga0097621_100947434 | 3300006237 | Bacteria | 803 |
| 84 | Ga0075370_10009337 | 3300006353 | Bacteria | 5089 |
| 85 | Ga0075370_10426938 | 3300006353 | Bacteria | 796 |
| 86 | Ga0068871_100022596 | 3300006358 | Bacteria | 4852 |
| 87 | Ga0068871_100113762 | 3300006358 | Bacteria | 2279 |
| 88 | Ga0075428_100135957 | 3300006844 | Bacteria | 2672 |
| 89 | Ga0075428_101037365 | 3300006844 | Unclassified | 867 |
| 90 | Ga0075430_100045520 | 3300006846 | Bacteria | 3707 |
| 91 | Ga0075430_100611013 | 3300006846 | Bacteria | 899 |
| 92 | Ga0075431_100011453 | 3300006847 | Bacteria | 8937 |
| 93 | Ga0075431_100772724 | 3300006847 | Unclassified | 935 |
| 94 | Ga0075431_101499889 | 3300006847 | Unclassified | 633 |
| 95 | Ga0075434_100287834 | 3300006871 | Bacteria | 1663 |
| 96 | Ga0068865_100058160 | 3300006881 | Unclassified | 2699 |
| 97 | Ga0079104_1000841 | 3300006946 | Bacteria | 25521 |
| 98 | Ga0105251_10000831 | 3300009011 | Bacteria | 27668 |
| 99 | Ga0105251_10012214 | 3300009011 | Bacteria | 4871 |
| 100 | Ga0105240_10002445 | 3300009093 | Bacteria | 29864 |
| 101 | Ga0105240_10017418 | 3300009093 | Bacteria | 9682 |
| 102 | Ga0105240_10898072 | 3300009093 | Bacteria | 953 |
| 103 | Ga0105240_11273867 | 3300009093 | Bacteria | 776 |
| 104 | Ga0105245_10338070 | 3300009098 | Bacteria | 1488 |
| 105 | Ga0105243_10294064 | 3300009148 | Bacteria | 1469 |
| 106 | Ga0105241_10240121 | 3300009174 | Bacteria | 1531 |
| 107 | Ga0105242_10593938 | 3300009176 | Bacteria | 1068 |
| 108 | Ga0105242_10906333 | 3300009176 | Bacteria | 882 |
| 109 | Ga0105248_10046399 | 3300009177 | Bacteria | 4869 |
| 110 | Ga0105237_10407032 | 3300009545 | Bacteria | 1365 |
| 111 | Ga0105238_10008285 | 3300009551 | Bacteria | 10396 |
| 112 | Ga0105238_10342069 | 3300009551 | Bacteria | 1484 |
| 113 | Ga0105238_11679279 | 3300009551 | Bacteria | 666 |
| 114 | Ga0105249_10768668 | 3300009553 | Bacteria | 1026 |
| 115 | Ga0157370_10038040 | 3300013104 | Bacteria | 4658 |
| 116 | Ga0157369_10407577 | 3300013105 | Bacteria | 1410 |
| 117 | Ga0157374_10142118 | 3300013296 | Bacteria | 2330 |
| 118 | Ga0157374_10236029 | 3300013296 | Bacteria | 1797 |
| 119 | Ga0157374_10332885 | 3300013296 | Bacteria | 1506 |
| 120 | Ga0157378_10091693 | 3300013297 | Bacteria | 2763 |
| 121 | Ga0157378_10310690 | 3300013297 | Bacteria | 1529 |
| 122 | Ga0163162_10019006 | 3300013306 | Bacteria | 6739 |
| 123 | Ga0163162_10019910 | 3300013306 | Bacteria | 6590 |
| 124 | Ga0163162_10117958 | 3300013306 | Bacteria | 2755 |
| 125 | Ga0163162_10680100 | 3300013306 | Bacteria | 1152 |
| 126 | Ga0163162_10825412 | 3300013306 | Bacteria | 1043 |
| 127 | Ga0157372_10009385 | 3300013307 | Bacteria | 10409 |
| 128 | Ga0157372_10026456 | 3300013307 | Bacteria | 6313 |
| 129 | Ga0157375_10527324 | 3300013308 | Bacteria | 1344 |
| 130 | Ga0157379_10030579 | 3300014968 | Bacteria | 4794 |
| 131 | Ga0157379_10243228 | 3300014968 | Bacteria | 1632 |
| 132 | Ga0157379_10312013 | 3300014968 | Bacteria | 1435 |
| 133 | Ga0157376_10156944 | 3300014969 | Bacteria | 2058 |
| 134 | Ga0163161_10023667 | 3300017792 | Bacteria | 4334 |
| 135 | Ga0207656_10218504 | 3300025321 | Bacteria | 926 |
| 136 | Ga0207713_1000848 | 3300025735 | Bacteria | 28075 |
| 137 | Ga0207713_1113984 | 3300025735 | Bacteria | 915 |
| 138 | Ga0207684_10007207 | 3300025910 | Bacteria | 10048 |
| 139 | Ga0207654_10222565 | 3300025911 | Bacteria | 1253 |
| 140 | Ga0207707_10995153 | 3300025912 | Bacteria | 688 |
| 141 | Ga0207695_10044064 | 3300025913 | Bacteria | 4749 |
| 142 | Ga0207695_10333619 | 3300025913 | Bacteria | 1405 |
| 143 | Ga0207671_10294925 | 3300025914 | Bacteria | 1281 |
| 144 | Ga0207657_10022371 | 3300025919 | Bacteria | 5917 |
| 145 | Ga0207657_10753310 | 3300025919 | Unclassified | 754 |
| 146 | Ga0207652_10088298 | 3300025921 | Bacteria | 2720 |
| 147 | Ga0207652_10137676 | 3300025921 | Bacteria | 2181 |
| 148 | Ga0207652_10138695 | 3300025921 | Bacteria | 2173 |
| 149 | Ga0207646_10173771 | 3300025922 | Bacteria | 1945 |
| 150 | Ga0207646_10352726 | 3300025922 | Bacteria | 1329 |
| 151 | Ga0207681_10326157 | 3300025923 | Bacteria | 1222 |
| 152 | Ga0207681_10460547 | 3300025923 | Bacteria | 1036 |
| 153 | Ga0207694_10151463 | 3300025924 | Bacteria | 1869 |
| 154 | Ga0207659_10084973 | 3300025926 | Bacteria | 2350 |
| 155 | Ga0207659_10123671 | 3300025926 | Bacteria | 1986 |
| 156 | Ga0207644_10110483 | 3300025931 | Bacteria | 2078 |
| 157 | Ga0207706_10303718 | 3300025933 | Bacteria | 1390 |
| 158 | Ga0207706_10425702 | 3300025933 | Unclassified | 1150 |
| 159 | Ga0207686_10034798 | 3300025934 | Bacteria | 3018 |
| 160 | Ga0207709_10398842 | 3300025935 | Bacteria | 1051 |
| 161 | Ga0207670_10426746 | 3300025936 | Bacteria | 1065 |
| 162 | Ga0207704_10045190 | 3300025938 | Bacteria | 2615 |
| 163 | Ga0207691_10020197 | 3300025940 | Bacteria | 6300 |
| 164 | Ga0207691_10175211 | 3300025940 | Bacteria | 1876 |
| 165 | Ga0207711_10098837 | 3300025941 | Bacteria | 2579 |
| 166 | Ga0207689_10002696 | 3300025942 | Bacteria | 16423 |
| 167 | Ga0207689_10232999 | 3300025942 | Unclassified | 1522 |
| 168 | Ga0207667_10049270 | 3300025949 | Bacteria | 4450 |
| 169 | Ga0207667_10156341 | 3300025949 | Bacteria | 2346 |
| 170 | Ga0207651_10284922 | 3300025960 | Bacteria | 1367 |
| 171 | Ga0207651_10303786 | 3300025960 | Unclassified | 1328 |
| 172 | Ga0207712_10807661 | 3300025961 | Bacteria | 825 |
| 173 | Ga0207668_10183568 | 3300025972 | Unclassified | 1652 |
| 174 | Ga0207658_10185118 | 3300025986 | Bacteria | 1727 |
| 175 | Ga0207658_10665864 | 3300025986 | Bacteria | 939 |
| 176 | Ga0207703_10005488 | 3300026035 | Bacteria | 10194 |
| 177 | Ga0207639_10282524 | 3300026041 | Bacteria | 1460 |
| 178 | Ga0207639_10962044 | 3300026041 | Bacteria | 799 |
| 179 | Ga0207678_10044174 | 3300026067 | Bacteria | 3855 |
| 180 | Ga0207708_10326366 | 3300026075 | Bacteria | 1254 |
| 181 | Ga0207702_10423332 | 3300026078 | Unclassified | 1288 |
| 182 | Ga0207641_10032290 | 3300026088 | Unclassified | 4346 |
| 183 | Ga0207641_10110005 | 3300026088 | Bacteria | 2441 |
| 184 | Ga0207641_10113411 | 3300026088 | Bacteria | 2407 |
| 185 | Ga0207648_10003591 | 3300026089 | Bacteria | 16220 |
| 186 | Ga0207648_10718808 | 3300026089 | Bacteria | 926 |
| 187 | Ga0207676_10041891 | 3300026095 | Bacteria | 3519 |
| 188 | Ga0207676_11107857 | 3300026095 | Bacteria | 783 |
| 189 | Ga0207683_10003507 | 3300026121 | Bacteria | 13682 |
| 190 | Ga0207683_10033867 | 3300026121 | Bacteria | 4438 |
| 191 | Ga0207683_10177024 | 3300026121 | Unclassified | 1933 |
| 192 | Ga0207683_10523342 | 3300026121 | Bacteria | 1096 |
| 193 | Ga0207698_10434032 | 3300026142 | Bacteria | 1264 |
| 194 | Ga0207698_10817870 | 3300026142 | Bacteria | 935 |
| 195 | Ga0209281_1000485 | 3300027111 | Bacteria | 55132 |
| 196 | Ga0268266_10188324 | 3300028379 | Bacteria | 1883 |
| 197 | Ga0268265_10033497 | 3300028380 | Bacteria | 3736 |
| 198 | Ga0268264_10140534 | 3300028381 | Bacteria | 2153 |
| 199 | Ga0268264_10263938 | 3300028381 | Bacteria | 1606 |
| 200 | Ga0307515_10007649 | 3300028794 | Bacteria | 21312 |
| 201 | Ga0316178_1081348 | 3300030735 | Bacteria | 13815 |
| 202 | Ga0316182_1197348 | 3300030745 | Unclassified | 1157 |
| 203 | Ga0265770_1001726 | 3300030878 | Bacteria | 2991 |
| 204 | Ga0265760_10001092 | 3300031090 | Bacteria | 7880 |
| 205 | Ga0265328_10263738 | 3300031239 | Bacteria | 661 |
| 206 | Ga0307408_100000247 | 3300031548 | Bacteria | 56153 |
| 207 | Ga0307408_100001096 | 3300031548 | Bacteria | 20679 |
| 208 | Ga0307408_100030675 | 3300031548 | Bacteria | 3736 |
| 209 | Ga0307516_10014785 | 3300031730 | Bacteria | 8242 |
| 210 | Ga0307405_10031427 | 3300031731 | Bacteria | 3126 |
| 211 | Ga0307405_10440511 | 3300031731 | Bacteria | 1030 |
| 212 | Ga0307405_10564786 | 3300031731 | Bacteria | 923 |
| 213 | Ga0307405_11262083 | 3300031731 | Bacteria | 641 |
| 214 | Ga0307410_10041771 | 3300031852 | Bacteria | 3026 |
| 215 | Ga0307406_10082856 | 3300031901 | Bacteria | 2138 |
| 216 | Ga0307412_10115971 | 3300031911 | Bacteria | 1920 |
| 217 | Ga0307412_10183017 | 3300031911 | Bacteria | 1578 |
| 218 | Ga0307412_10213845 | 3300031911 | Bacteria | 1473 |
| 219 | Ga0307412_10538968 | 3300031911 | Bacteria | 978 |
| 220 | Ga0307409_100020599 | 3300031995 | Bacteria | 4499 |
| 221 | Ga0307409_100474781 | 3300031995 | Bacteria | 1212 |
| 222 | Ga0307416_100054264 | 3300032002 | Bacteria | 3221 |
| 223 | Ga0307414_10003528 | 3300032004 | Bacteria | 8366 |
| 224 | Ga0307411_10017082 | 3300032005 | Bacteria | 4123 |
| 225 | Ga0307415_100035568 | 3300032126 | Bacteria | 3254 |
| 226 | Ga0373937_0229300 | 3300036401 | Bacteria | 1749 |
| 227 | Ga0316584_0133089 | 3300036712 | Bacteria | 1857 |
| 228 | Ga0395900_0071007 | 3300037418 | Bacteria | 3579 |
| 229 | Ga0395900_0672086 | 3300037418 | Bacteria | 971 |
| 230 | Ga0395898_0027351 | 3300037466 | Bacteria | 5727 |
| 231 | Ga0395905_0017634 | 3300037471 | Bacteria | 6776 |
| 232 | Ga0395901_0042768 | 3300038443 | Bacteria | 4699 |
| 233 | Ga0395901_0090821 | 3300038443 | Bacteria | 3197 |
| 234 | Ga0395901_0569285 | 3300038443 | Bacteria | 1146 |
| 235 | Ga0400483_071908 | 3300039062 | Bacteria | 11244 |
| 236 | Ga0451802_0707868 | 3300041460 | Unclassified | 633 |
| 237 | Ga0451849_1095774 | 3300041505 | Bacteria | 650 |
| 238 | Ga0451853_2047447 | 3300041512 | Bacteria | 1052 |
| 239 | Ga0439432_000435 | 3300042006 | Bacteria | 15539 |
| 240 | Ga0439432_001659 | 3300042006 | Bacteria | 8336 |
| 241 | Ga0439452_000024 | 3300042010 | Bacteria | 230396 |
| 242 | Ga0439452_000047 | 3300042010 | Bacteria | 127643 |
| 243 | Ga0466965_0149997 | 3300044683 | Bacteria | 1218 |
| 244 | Ga0451576_0833246 | 3300045051 | Bacteria | 968 |
| 245 | Ga0495590_0011044 | 3300046457 | Bacteria | 3384 |
| 246 | Ga0495629_0590837 | 3300046459 | Bacteria | 743 |
| 247 | Ga0495582_0008976 | 3300046473 | Bacteria | 5516 |
| 248 | Ga0495607_0003807 | 3300046501 | Bacteria | 11388 |
| 249 | Ga0495632_0008420 | 3300046519 | Bacteria | 6331 |
| 250 | Ga0495665_0177082 | 3300046531 | Bacteria | 1109 |
| 251 | Ga0495621_0419622 | 3300046539 | Bacteria | 569 |
| 252 | Ga0495657_0032701 | 3300046675 | Bacteria | 3628 |
| 253 | Ga0495658_0003662 | 3300046683 | Bacteria | 7604 |
| 254 | Ga0495581_0593978 | 3300047315 | Bacteria | 641 |
| 255 | Ga0495674_1034687 | 3300047319 | Bacteria | 628 |
| 256 | Ga0496114_0739567 | 3300048917 | Bacteria | 860 |
| 257 | Ga0496117_0000559 | 3300048920 | Bacteria | 61171 |
| 258 | Ga0496118_0480921 | 3300048921 | Bacteria | 622 |
| 259 | Ga0496119_0000695 | 3300048922 | Bacteria | 45051 |
| 260 | Ga0496120_0000105 | 3300048923 | Bacteria | 140297 |
| 261 | Ga0496122_0000081 | 3300048925 | Bacteria | 211119 |
| 262 | Ga0496123_0000101 | 3300048926 | Bacteria | 169939 |
| 263 | Ga0496124_0000277 | 3300048927 | Bacteria | 98300 |
| 264 | Ga0501298_071070 | 3300049521 | Bacteria | 751 |
| 265 | Ga0501033_0344969 | 3300049570 | Bacteria | 1044 |
| 266 | Ga0501039_0134887 | 3300049575 | Bacteria | 1938 |
| 267 | Ga0501040_0137054 | 3300049576 | Bacteria | 1723 |
| 268 | Ga0501040_0301799 | 3300049576 | Unclassified | 1145 |
| 269 | Ga0501041_0313830 | 3300049577 | Bacteria | 989 |
| 270 | Ga0501041_0373167 | 3300049577 | Bacteria | 902 |
| 271 | Ga0501042_0094203 | 3300049578 | Bacteria | 2151 |
| 272 | Ga0501046_0444521 | 3300049580 | Bacteria | 933 |
| 273 | Ga0501048_0058717 | 3300049582 | Bacteria | 2727 |
| 274 | Ga0501070_0969093 | 3300049586 | Bacteria | 661 |
| 275 | Ga0501072_0347326 | 3300049588 | Bacteria | 1178 |
| 276 | Ga0501074_0149498 | 3300049590 | Bacteria | 1670 |
| 277 | Ga0501074_0498042 | 3300049590 | Unclassified | 863 |
| 278 | Ga0501074_0691089 | 3300049590 | Unclassified | 720 |
| 279 | Ga0501075_0050779 | 3300049591 | Bacteria | 3118 |
| 280 | Ga0501076_0471273 | 3300049592 | Bacteria | 1034 |
| 281 | Ga0501077_0003165 | 3300049593 | Bacteria | 9906 |
| 282 | Ga0501079_0131640 | 3300049741 | Bacteria | 1946 |
| 283 | Ga0501079_1162723 | 3300049741 | Bacteria | 608 |
| 284 | Ga0501081_0132867 | 3300049743 | Bacteria | 1779 |
| 285 | Ga0501081_0233160 | 3300049743 | Bacteria | 1341 |
| 286 | Ga0501269_003264 | 3300049766 | Bacteria | 1964 |
| 287 | Ga0501045_0200906 | 3300049824 | Bacteria | 1485 |
| 288 | Ga0501045_0444683 | 3300049824 | Unclassified | 964 |
| 289 | nmdc:mga0k408_41990_c1 | 3300050493 | Bacteria | 2634 |
| 290 | nmdc:mga0k408_6301_c1 | 3300050493 | Bacteria | 6330 |
| 291 | nmdc:mga07m45_82064_c1 | 3300050496 | Bacteria | 1841 |
| 292 | nmdc:mga0qj67_441281_c1 | 3300050509 | Bacteria | 1049 |
| 293 | nmdc:mga0qj67_475656_c1 | 3300050509 | Bacteria | 1005 |
| 294 | nmdc:mga06r32_285687_c1 | 3300050510 | Bacteria | 1636 |
| 295 | nmdc:mga06r32_96797_c1 | 3300050510 | Bacteria | 2891 |
| 296 | nmdc:mga0n895_853503_c1 | 3300050512 | Bacteria | 898 |
| 297 | Ga0500651_0571967 | 3300053093 | Bacteria | 616 |
| 298 | Ga0500619_000132 | 3300053154 | Bacteria | 19303 |
| 299 | Ga0501084_0206434 | 3300054114 | Bacteria | 1658 |
| 300 | Ga0501082_0007859 | 3300060353 | Bacteria | 9202 |
| 301 | Ga0501082_0076756 | 3300060353 | Bacteria | 2880 |
| 302 | Ga0530510_0102839 | 3300061734 | Bacteria | 2089 |
| 303 | Ga0530510_0788589 | 3300061734 | Unclassified | 725 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8056166840 | 8056168271 | 135 |
| 2 | 3300009545 | Ga0105237_10407032 | Ga0105237_104070322 | 144 |
| 3 | 3300009551 | Ga0105238_11679279 | Ga0105238_116792791 | 144 |
| 4 | 3300005539 | Ga0068853_100116517 | Ga0068853_1001165173 | 145 |
| 5 | 3300009093 | Ga0105240_10017418 | Ga0105240_100174188 | 145 |
| 6 | 3300025913 | Ga0207695_10333619 | Ga0207695_103336192 | 145 |
| 7 | 3300025914 | Ga0207671_10294925 | Ga0207671_102949252 | 145 |
| 8 | 3300026041 | Ga0207639_10962044 | Ga0207639_109620442 | 145 |
| 9 | iso_pu_bacteria | 2511231024 | 2511375037 | 145 |
| 10 | iso_pu_bacteria | 2842832357 | 2842832884 | 145 |
| 11 | iso_pu_bacteria | 2929189879 | 2929193458 | 145 |
| 12 | iso_pu_bacteria | 2998139840 | 2998142654 | 145 |
| 13 | iso_pu_bacteria | 2998139840 | 2998142922 | 145 |
| 14 | iso_pu_bacteria | 3007861166 | 3007861740 | 145 |
| 15 | iso_pu_bacteria | 8056172158 | 8056173940 | 145 |
| 16 | 3300032002 | Ga0307416_100054264 | Ga0307416_1000542641 | 146 |
| 17 | 3300006846 | Ga0075430_100045520 | Ga0075430_1000455204 | 147 |
| 18 | 3300050509 | nmdc:mga0qj67_475656_c1 | nmdc:mga0qj67_475656_c1_351_824 | 147 |
| 19 | 3300005347 | Ga0070668_100971391 | Ga0070668_1009713912 | 148 |
| 20 | 3300005444 | Ga0070694_100114872 | Ga0070694_1001148725 | 148 |
| 21 | 3300005546 | Ga0070696_100002515 | Ga0070696_1000025157 | 148 |
| 22 | 3300005289 | Ga0065704_10070513 | Ga0065704_1007051311 | 149 |
| 23 | 3300005331 | Ga0070670_100003874 | Ga0070670_1000038747 | 149 |
| 24 | 3300005353 | Ga0070669_100086624 | Ga0070669_1000866243 | 149 |
| 25 | 3300005548 | Ga0070665_100197584 | Ga0070665_1001975842 | 149 |
| 26 | 3300006844 | Ga0075428_101037365 | Ga0075428_1010373651 | 149 |
| 27 | 3300006847 | Ga0075431_101499889 | Ga0075431_1014998891 | 149 |
| 28 | 3300006946 | Ga0079104_1000841 | Ga0079104_10008418 | 149 |
| 29 | 3300009011 | Ga0105251_10000831 | Ga0105251_1000083122 | 149 |
| 30 | 3300009011 | Ga0105251_10012214 | Ga0105251_100122145 | 149 |
| 31 | 3300025735 | Ga0207713_1000848 | Ga0207713_100084811 | 149 |
| 32 | 3300025735 | Ga0207713_1113984 | Ga0207713_11139842 | 149 |
| 33 | 3300025923 | Ga0207681_10326157 | Ga0207681_103261572 | 149 |
| 34 | 3300027111 | Ga0209281_1000485 | Ga0209281_100048546 | 149 |
| 35 | 3300030735 | Ga0316178_1081348 | Ga0316178_10813488 | 149 |
| 36 | 3300031548 | Ga0307408_100000247 | Ga0307408_10000024752 | 149 |
| 37 | 3300031548 | Ga0307408_100001096 | Ga0307408_1000010962 | 149 |
| 38 | 3300031731 | Ga0307405_10564786 | Ga0307405_105647861 | 149 |
| 39 | 3300031911 | Ga0307412_10115971 | Ga0307412_101159712 | 149 |
| 40 | 3300031911 | Ga0307412_10213845 | Ga0307412_102138452 | 149 |
| 41 | 3300032004 | Ga0307414_10003528 | Ga0307414_1000352811 | 149 |
| 42 | 3300042006 | Ga0439432_000435 | Ga0439432_000435_9220_9687 | 149 |
| 43 | 3300042006 | Ga0439432_001659 | Ga0439432_001659_531_998 | 149 |
| 44 | 3300042010 | Ga0439452_000024 | Ga0439452_000024_167412_167879 | 149 |
| 45 | 3300042010 | Ga0439452_000047 | Ga0439452_000047_49651_50118 | 149 |
| 46 | 3300046457 | Ga0495590_0011044 | Ga0495590_0011044_2611_3078 | 149 |
| 47 | 3300046501 | Ga0495607_0003807 | Ga0495607_0003807_4774_5241 | 149 |
| 48 | 3300046519 | Ga0495632_0008420 | Ga0495632_0008420_5635_6102 | 149 |
| 49 | 3300048917 | Ga0496114_0739567 | Ga0496114_0739567_43_501 | 149 |
| 50 | 3300048920 | Ga0496117_0000559 | Ga0496117_0000559_35862_36329 | 149 |
| 51 | 3300048921 | Ga0496118_0480921 | Ga0496118_0480921_10_477 | 149 |
| 52 | 3300048922 | Ga0496119_0000695 | Ga0496119_0000695_12022_12489 | 149 |
| 53 | 3300048923 | Ga0496120_0000105 | Ga0496120_0000105_4599_5066 | 149 |
| 54 | 3300048925 | Ga0496122_0000081 | Ga0496122_0000081_71526_71993 | 149 |
| 55 | 3300048926 | Ga0496123_0000101 | Ga0496123_0000101_146603_147070 | 149 |
| 56 | 3300048927 | Ga0496124_0000277 | Ga0496124_0000277_96553_97020 | 149 |
| 57 | 3300049766 | Ga0501269_003264 | Ga0501269_003264_1232_1699 | 149 |
| 58 | iso_pu_bacteria | 2585428057 | 2587729967 | 149 |
| 59 | 3300037418 | Ga0395900_0071007 | Ga0395900_0071007_2121_2573 | 150 |
| 60 | 3300037471 | Ga0395905_0017634 | Ga0395905_0017634_3297_3749 | 150 |
| 61 | 3300038443 | Ga0395901_0042768 | Ga0395901_0042768_1390_1842 | 150 |
| 62 | iso_pu_bacteria | 2904434214 | 2904434702 | 150 |
| 63 | 3300005545 | Ga0070695_100726870 | Ga0070695_1007268701 | 151 |
| 64 | 3300006844 | Ga0075428_100135957 | Ga0075428_1001359572 | 151 |
| 65 | 3300006846 | Ga0075430_100611013 | Ga0075430_1006110132 | 151 |
| 66 | 3300006847 | Ga0075431_100011453 | Ga0075431_1000114538 | 151 |
| 67 | 3300037466 | Ga0395898_0027351 | Ga0395898_0027351_229_696 | 151 |
| 68 | 3300038443 | Ga0395901_0569285 | Ga0395901_0569285_444_911 | 151 |
| 69 | 3300049570 | Ga0501033_0344969 | Ga0501033_0344969_461_916 | 151 |
| 70 | 3300049575 | Ga0501039_0134887 | Ga0501039_0134887_1272_1727 | 151 |
| 71 | 3300049576 | Ga0501040_0137054 | Ga0501040_0137054_234_689 | 151 |
| 72 | 3300049576 | Ga0501040_0301799 | Ga0501040_0301799_206_661 | 151 |
| 73 | 3300049577 | Ga0501041_0313830 | Ga0501041_0313830_111_566 | 151 |
| 74 | 3300049577 | Ga0501041_0373167 | Ga0501041_0373167_379_834 | 151 |
| 75 | 3300049578 | Ga0501042_0094203 | Ga0501042_0094203_930_1385 | 151 |
| 76 | 3300049580 | Ga0501046_0444521 | Ga0501046_0444521_70_525 | 151 |
| 77 | 3300049582 | Ga0501048_0058717 | Ga0501048_0058717_511_966 | 151 |
| 78 | 3300049586 | Ga0501070_0969093 | Ga0501070_0969093_110_565 | 151 |
| 79 | 3300049588 | Ga0501072_0347326 | Ga0501072_0347326_662_1117 | 151 |
| 80 | 3300049590 | Ga0501074_0149498 | Ga0501074_0149498_191_646 | 151 |
| 81 | 3300049590 | Ga0501074_0498042 | Ga0501074_0498042_92_547 | 151 |
| 82 | 3300049590 | Ga0501074_0691089 | Ga0501074_0691089_227_682 | 151 |
| 83 | 3300049591 | Ga0501075_0050779 | Ga0501075_0050779_682_1137 | 151 |
| 84 | 3300049592 | Ga0501076_0471273 | Ga0501076_0471273_60_515 | 151 |
| 85 | 3300049593 | Ga0501077_0003165 | Ga0501077_0003165_1900_2355 | 151 |
| 86 | 3300049741 | Ga0501079_0131640 | Ga0501079_0131640_679_1134 | 151 |
| 87 | 3300049743 | Ga0501081_0132867 | Ga0501081_0132867_996_1451 | 151 |
| 88 | 3300049824 | Ga0501045_0200906 | Ga0501045_0200906_902_1357 | 151 |
| 89 | 3300049824 | Ga0501045_0444683 | Ga0501045_0444683_206_661 | 151 |
| 90 | 3300050509 | nmdc:mga0qj67_441281_c1 | nmdc:mga0qj67_441281_c1_275_730 | 151 |
| 91 | 3300050510 | nmdc:mga06r32_96797_c1 | nmdc:mga06r32_96797_c1_13_468 | 151 |
| 92 | 3300054114 | Ga0501084_0206434 | Ga0501084_0206434_41_496 | 151 |
| 93 | 3300060353 | Ga0501082_0007859 | Ga0501082_0007859_1632_2087 | 151 |
| 94 | 3300060353 | Ga0501082_0076756 | Ga0501082_0076756_1222_1677 | 151 |
| 95 | 3300061734 | Ga0530510_0102839 | Ga0530510_0102839_535_990 | 151 |
| 96 | 3300061734 | Ga0530510_0788589 | Ga0530510_0788589_120_575 | 151 |
| 97 | 3300000546 | LJNas_1001001 | LJNas_10010014 | 152 |
| 98 | 3300003322 | rootL2_10010297 | rootL2_100102972 | 152 |
| 99 | 3300005288 | Ga0065714_10184096 | Ga0065714_101840962 | 152 |
| 100 | 3300005295 | Ga0065707_10081844 | Ga0065707_1008184423 | 152 |
| 101 | 3300005330 | Ga0070690_100629315 | Ga0070690_1006293151 | 152 |
| 102 | 3300005334 | Ga0068869_100070732 | Ga0068869_1000707325 | 152 |
| 103 | 3300005334 | Ga0068869_100141436 | Ga0068869_1001414362 | 152 |
| 104 | 3300005335 | Ga0070666_10322689 | Ga0070666_103226892 | 152 |
| 105 | 3300005339 | Ga0070660_100116743 | Ga0070660_1001167433 | 152 |
| 106 | 3300005340 | Ga0070689_100272290 | Ga0070689_1002722902 | 152 |
| 107 | 3300005340 | Ga0070689_100642610 | Ga0070689_1006426101 | 152 |
| 108 | 3300005341 | Ga0070691_10464454 | Ga0070691_104644542 | 152 |
| 109 | 3300005345 | Ga0070692_10220620 | Ga0070692_102206202 | 152 |
| 110 | 3300005353 | Ga0070669_100569432 | Ga0070669_1005694322 | 152 |
| 111 | 3300005354 | Ga0070675_100178485 | Ga0070675_1001784852 | 152 |
| 112 | 3300005354 | Ga0070675_100243489 | Ga0070675_1002434892 | 152 |
| 113 | 3300005355 | Ga0070671_100280127 | Ga0070671_1002801272 | 152 |
| 114 | 3300005356 | Ga0070674_101397978 | Ga0070674_1013979781 | 152 |
| 115 | 3300005364 | Ga0070673_100215079 | Ga0070673_1002150792 | 152 |
| 116 | 3300005364 | Ga0070673_100535754 | Ga0070673_1005357542 | 152 |
| 117 | 3300005367 | Ga0070667_100218750 | Ga0070667_1002187502 | 152 |
| 118 | 3300005367 | Ga0070667_100741158 | Ga0070667_1007411582 | 152 |
| 119 | 3300005435 | Ga0070714_100035217 | Ga0070714_1000352172 | 152 |
| 120 | 3300005441 | Ga0070700_100283394 | Ga0070700_1002833942 | 152 |
| 121 | 3300005444 | Ga0070694_100021469 | Ga0070694_1000214695 | 152 |
| 122 | 3300005455 | Ga0070663_100104663 | Ga0070663_1001046634 | 152 |
| 123 | 3300005455 | Ga0070663_101752425 | Ga0070663_1017524251 | 152 |
| 124 | 3300005456 | Ga0070678_100061855 | Ga0070678_1000618553 | 152 |
| 125 | 3300005456 | Ga0070678_100330853 | Ga0070678_1003308532 | 152 |
| 126 | 3300005456 | Ga0070678_100569241 | Ga0070678_1005692411 | 152 |
| 127 | 3300005456 | Ga0070678_100640479 | Ga0070678_1006404792 | 152 |
| 128 | 3300005456 | Ga0070678_101545385 | Ga0070678_1015453851 | 152 |
| 129 | 3300005457 | Ga0070662_100316960 | Ga0070662_1003169602 | 152 |
| 130 | 3300005458 | Ga0070681_10422512 | Ga0070681_104225121 | 152 |
| 131 | 3300005458 | Ga0070681_10525402 | Ga0070681_105254022 | 152 |
| 132 | 3300005459 | Ga0068867_100064090 | Ga0068867_1000640905 | 152 |
| 133 | 3300005467 | Ga0070706_100007038 | Ga0070706_1000070386 | 152 |
| 134 | 3300005468 | Ga0070707_100097490 | Ga0070707_1000974904 | 152 |
| 135 | 3300005468 | Ga0070707_100200579 | Ga0070707_1002005792 | 152 |
| 136 | 3300005471 | Ga0070698_100073257 | Ga0070698_1000732575 | 152 |
| 137 | 3300005471 | Ga0070698_100370026 | Ga0070698_1003700263 | 152 |
| 138 | 3300005518 | Ga0070699_100318345 | Ga0070699_1003183453 | 152 |
| 139 | 3300005530 | Ga0070679_100006165 | Ga0070679_1000061655 | 152 |
| 140 | 3300005530 | Ga0070679_100124722 | Ga0070679_1001247222 | 152 |
| 141 | 3300005530 | Ga0070679_100413011 | Ga0070679_1004130111 | 152 |
| 142 | 3300005539 | Ga0068853_100050320 | Ga0068853_1000503202 | 152 |
| 143 | 3300005539 | Ga0068853_100504972 | Ga0068853_1005049722 | 152 |
| 144 | 3300005543 | Ga0070672_100200737 | Ga0070672_1002007373 | 152 |
| 145 | 3300005545 | Ga0070695_100048554 | Ga0070695_1000485542 | 152 |
| 146 | 3300005546 | Ga0070696_100009076 | Ga0070696_1000090767 | 152 |
| 147 | 3300005547 | Ga0070693_100017546 | Ga0070693_1000175466 | 152 |
| 148 | 3300005547 | Ga0070693_100367709 | Ga0070693_1003677092 | 152 |
| 149 | 3300005548 | Ga0070665_100119099 | Ga0070665_1001190995 | 152 |
| 150 | 3300005548 | Ga0070665_101041698 | Ga0070665_1010416982 | 152 |
| 151 | 3300005563 | Ga0068855_100006299 | Ga0068855_10000629913 | 152 |
| 152 | 3300005563 | Ga0068855_100090427 | Ga0068855_1000904272 | 152 |
| 153 | 3300005614 | Ga0068856_100032869 | Ga0068856_1000328694 | 152 |
| 154 | 3300005616 | Ga0068852_100261052 | Ga0068852_1002610522 | 152 |
| 155 | 3300005616 | Ga0068852_101635052 | Ga0068852_1016350522 | 152 |
| 156 | 3300005618 | Ga0068864_100067500 | Ga0068864_1000675004 | 152 |
| 157 | 3300005618 | Ga0068864_100413603 | Ga0068864_1004136032 | 152 |
| 158 | 3300005618 | Ga0068864_101703646 | Ga0068864_1017036462 | 152 |
| 159 | 3300005718 | Ga0068866_11112600 | Ga0068866_111126001 | 152 |
| 160 | 3300005841 | Ga0068863_100016599 | Ga0068863_1000165992 | 152 |
| 161 | 3300005841 | Ga0068863_100061915 | Ga0068863_1000619155 | 152 |
| 162 | 3300005841 | Ga0068863_100145970 | Ga0068863_1001459702 | 152 |
| 163 | 3300005842 | Ga0068858_100442303 | Ga0068858_1004423032 | 152 |
| 164 | 3300005843 | Ga0068860_100275643 | Ga0068860_1002756433 | 152 |
| 165 | 3300005843 | Ga0068860_100362007 | Ga0068860_1003620072 | 152 |
| 166 | 3300005843 | Ga0068860_101424822 | Ga0068860_1014248221 | 152 |
| 167 | 3300006195 | Ga0075366_10009452 | Ga0075366_100094525 | 152 |
| 168 | 3300006237 | Ga0097621_100039534 | Ga0097621_1000395346 | 152 |
| 169 | 3300006237 | Ga0097621_100096560 | Ga0097621_1000965605 | 152 |
| 170 | 3300006237 | Ga0097621_100947434 | Ga0097621_1009474342 | 152 |
| 171 | 3300006353 | Ga0075370_10009337 | Ga0075370_100093375 | 152 |
| 172 | 3300006353 | Ga0075370_10426938 | Ga0075370_104269382 | 152 |
| 173 | 3300006358 | Ga0068871_100022596 | Ga0068871_1000225968 | 152 |
| 174 | 3300006358 | Ga0068871_100113762 | Ga0068871_1001137622 | 152 |
| 175 | 3300006847 | Ga0075431_100772724 | Ga0075431_1007727241 | 152 |
| 176 | 3300006871 | Ga0075434_100287834 | Ga0075434_1002878342 | 152 |
| 177 | 3300006881 | Ga0068865_100058160 | Ga0068865_1000581602 | 152 |
| 178 | 3300009093 | Ga0105240_10002445 | Ga0105240_1000244524 | 152 |
| 179 | 3300009093 | Ga0105240_10898072 | Ga0105240_108980722 | 152 |
| 180 | 3300009093 | Ga0105240_11273867 | Ga0105240_112738671 | 152 |
| 181 | 3300009098 | Ga0105245_10338070 | Ga0105245_103380702 | 152 |
| 182 | 3300009148 | Ga0105243_10294064 | Ga0105243_102940643 | 152 |
| 183 | 3300009174 | Ga0105241_10240121 | Ga0105241_102401212 | 152 |
| 184 | 3300009176 | Ga0105242_10593938 | Ga0105242_105939381 | 152 |
| 185 | 3300009176 | Ga0105242_10906333 | Ga0105242_109063332 | 152 |
| 186 | 3300009177 | Ga0105248_10046399 | Ga0105248_100463994 | 152 |
| 187 | 3300009551 | Ga0105238_10008285 | Ga0105238_100082855 | 152 |
| 188 | 3300009551 | Ga0105238_10342069 | Ga0105238_103420692 | 152 |
| 189 | 3300009553 | Ga0105249_10768668 | Ga0105249_107686682 | 152 |
| 190 | 3300013104 | Ga0157370_10038040 | Ga0157370_100380402 | 152 |
| 191 | 3300013105 | Ga0157369_10407577 | Ga0157369_104075772 | 152 |
| 192 | 3300013296 | Ga0157374_10142118 | Ga0157374_101421182 | 152 |
| 193 | 3300013296 | Ga0157374_10236029 | Ga0157374_102360292 | 152 |
| 194 | 3300013296 | Ga0157374_10332885 | Ga0157374_103328852 | 152 |
| 195 | 3300013297 | Ga0157378_10091693 | Ga0157378_100916933 | 152 |
| 196 | 3300013297 | Ga0157378_10310690 | Ga0157378_103106904 | 152 |
| 197 | 3300013306 | Ga0163162_10019006 | Ga0163162_100190069 | 152 |
| 198 | 3300013306 | Ga0163162_10019910 | Ga0163162_100199105 | 152 |
| 199 | 3300013306 | Ga0163162_10117958 | Ga0163162_101179584 | 152 |
| 200 | 3300013306 | Ga0163162_10680100 | Ga0163162_106801002 | 152 |
| 201 | 3300013306 | Ga0163162_10825412 | Ga0163162_108254122 | 152 |
| 202 | 3300013307 | Ga0157372_10009385 | Ga0157372_100093855 | 152 |
| 203 | 3300013307 | Ga0157372_10026456 | Ga0157372_100264566 | 152 |
| 204 | 3300013308 | Ga0157375_10527324 | Ga0157375_105273243 | 152 |
| 205 | 3300014968 | Ga0157379_10030579 | Ga0157379_100305799 | 152 |
| 206 | 3300014968 | Ga0157379_10243228 | Ga0157379_102432282 | 152 |
| 207 | 3300014968 | Ga0157379_10312013 | Ga0157379_103120132 | 152 |
| 208 | 3300014969 | Ga0157376_10156944 | Ga0157376_101569444 | 152 |
| 209 | 3300017792 | Ga0163161_10023667 | Ga0163161_100236675 | 152 |
| 210 | 3300025321 | Ga0207656_10218504 | Ga0207656_102185041 | 152 |
| 211 | 3300025910 | Ga0207684_10007207 | Ga0207684_1000720711 | 152 |
| 212 | 3300025911 | Ga0207654_10222565 | Ga0207654_102225651 | 152 |
| 213 | 3300025912 | Ga0207707_10995153 | Ga0207707_109951531 | 152 |
| 214 | 3300025913 | Ga0207695_10044064 | Ga0207695_100440644 | 152 |
| 215 | 3300025919 | Ga0207657_10022371 | Ga0207657_100223718 | 152 |
| 216 | 3300025919 | Ga0207657_10753310 | Ga0207657_107533102 | 152 |
| 217 | 3300025921 | Ga0207652_10088298 | Ga0207652_100882982 | 152 |
| 218 | 3300025921 | Ga0207652_10137676 | Ga0207652_101376763 | 152 |
| 219 | 3300025921 | Ga0207652_10138695 | Ga0207652_101386954 | 152 |
| 220 | 3300025922 | Ga0207646_10173771 | Ga0207646_101737713 | 152 |
| 221 | 3300025922 | Ga0207646_10352726 | Ga0207646_103527262 | 152 |
| 222 | 3300025923 | Ga0207681_10460547 | Ga0207681_104605472 | 152 |
| 223 | 3300025924 | Ga0207694_10151463 | Ga0207694_101514632 | 152 |
| 224 | 3300025926 | Ga0207659_10084973 | Ga0207659_100849732 | 152 |
| 225 | 3300025926 | Ga0207659_10123671 | Ga0207659_101236712 | 152 |
| 226 | 3300025931 | Ga0207644_10110483 | Ga0207644_101104833 | 152 |
| 227 | 3300025933 | Ga0207706_10303718 | Ga0207706_103037182 | 152 |
| 228 | 3300025933 | Ga0207706_10425702 | Ga0207706_104257022 | 152 |
| 229 | 3300025934 | Ga0207686_10034798 | Ga0207686_100347982 | 152 |
| 230 | 3300025935 | Ga0207709_10398842 | Ga0207709_103988422 | 152 |
| 231 | 3300025936 | Ga0207670_10426746 | Ga0207670_104267461 | 152 |
| 232 | 3300025938 | Ga0207704_10045190 | Ga0207704_100451902 | 152 |
| 233 | 3300025940 | Ga0207691_10020197 | Ga0207691_100201978 | 152 |
| 234 | 3300025940 | Ga0207691_10175211 | Ga0207691_101752113 | 152 |
| 235 | 3300025941 | Ga0207711_10098837 | Ga0207711_100988374 | 152 |
| 236 | 3300025942 | Ga0207689_10002696 | Ga0207689_1000269620 | 152 |
| 237 | 3300025942 | Ga0207689_10232999 | Ga0207689_102329992 | 152 |
| 238 | 3300025949 | Ga0207667_10049270 | Ga0207667_100492704 | 152 |
| 239 | 3300025949 | Ga0207667_10156341 | Ga0207667_101563412 | 152 |
| 240 | 3300025960 | Ga0207651_10284922 | Ga0207651_102849223 | 152 |
| 241 | 3300025960 | Ga0207651_10303786 | Ga0207651_103037862 | 152 |
| 242 | 3300025961 | Ga0207712_10807661 | Ga0207712_108076612 | 152 |
| 243 | 3300025972 | Ga0207668_10183568 | Ga0207668_101835681 | 152 |
| 244 | 3300025986 | Ga0207658_10185118 | Ga0207658_101851183 | 152 |
| 245 | 3300025986 | Ga0207658_10665864 | Ga0207658_106658642 | 152 |
| 246 | 3300026035 | Ga0207703_10005488 | Ga0207703_1000548813 | 152 |
| 247 | 3300026041 | Ga0207639_10282524 | Ga0207639_102825242 | 152 |
| 248 | 3300026067 | Ga0207678_10044174 | Ga0207678_100441742 | 152 |
| 249 | 3300026075 | Ga0207708_10326366 | Ga0207708_103263662 | 152 |
| 250 | 3300026078 | Ga0207702_10423332 | Ga0207702_104233322 | 152 |
| 251 | 3300026088 | Ga0207641_10032290 | Ga0207641_100322902 | 152 |
| 252 | 3300026088 | Ga0207641_10110005 | Ga0207641_101100053 | 152 |
| 253 | 3300026088 | Ga0207641_10113411 | Ga0207641_101134114 | 152 |
| 254 | 3300026089 | Ga0207648_10003591 | Ga0207648_100035916 | 152 |
| 255 | 3300026089 | Ga0207648_10718808 | Ga0207648_107188082 | 152 |
| 256 | 3300026095 | Ga0207676_10041891 | Ga0207676_100418916 | 152 |
| 257 | 3300026095 | Ga0207676_11107857 | Ga0207676_111078572 | 152 |
| 258 | 3300026121 | Ga0207683_10003507 | Ga0207683_100035076 | 152 |
| 259 | 3300026121 | Ga0207683_10033867 | Ga0207683_100338673 | 152 |
| 260 | 3300026121 | Ga0207683_10177024 | Ga0207683_101770243 | 152 |
| 261 | 3300026121 | Ga0207683_10523342 | Ga0207683_105233422 | 152 |
| 262 | 3300026142 | Ga0207698_10434032 | Ga0207698_104340321 | 152 |
| 263 | 3300026142 | Ga0207698_10817870 | Ga0207698_108178702 | 152 |
| 264 | 3300028379 | Ga0268266_10188324 | Ga0268266_101883243 | 152 |
| 265 | 3300028380 | Ga0268265_10033497 | Ga0268265_100334973 | 152 |
| 266 | 3300028381 | Ga0268264_10140534 | Ga0268264_101405343 | 152 |
| 267 | 3300028381 | Ga0268264_10263938 | Ga0268264_102639383 | 152 |
| 268 | 3300028794 | Ga0307515_10007649 | Ga0307515_1000764913 | 152 |
| 269 | 3300030745 | Ga0316182_1197348 | Ga0316182_11973482 | 152 |
| 270 | 3300030878 | Ga0265770_1001726 | Ga0265770_10017264 | 152 |
| 271 | 3300031090 | Ga0265760_10001092 | Ga0265760_100010924 | 152 |
| 272 | 3300031239 | Ga0265328_10263738 | Ga0265328_102637382 | 152 |
| 273 | 3300031548 | Ga0307408_100030675 | Ga0307408_1000306754 | 152 |
| 274 | 3300031730 | Ga0307516_10014785 | Ga0307516_100147856 | 152 |
| 275 | 3300031731 | Ga0307405_10031427 | Ga0307405_100314276 | 152 |
| 276 | 3300031731 | Ga0307405_10440511 | Ga0307405_104405113 | 152 |
| 277 | 3300031731 | Ga0307405_11262083 | Ga0307405_112620831 | 152 |
| 278 | 3300031852 | Ga0307410_10041771 | Ga0307410_100417714 | 152 |
| 279 | 3300031901 | Ga0307406_10082856 | Ga0307406_100828562 | 152 |
| 280 | 3300031911 | Ga0307412_10183017 | Ga0307412_101830172 | 152 |
| 281 | 3300031911 | Ga0307412_10538968 | Ga0307412_105389683 | 152 |
| 282 | 3300031995 | Ga0307409_100020599 | Ga0307409_1000205994 | 152 |
| 283 | 3300031995 | Ga0307409_100474781 | Ga0307409_1004747812 | 152 |
| 284 | 3300032005 | Ga0307411_10017082 | Ga0307411_100170824 | 152 |
| 285 | 3300032126 | Ga0307415_100035568 | Ga0307415_1000355686 | 152 |
| 286 | 3300036401 | Ga0373937_0229300 | Ga0373937_0229300_754_1239 | 152 |
| 287 | 3300036712 | Ga0316584_0133089 | Ga0316584_0133089_55_519 | 152 |
| 288 | 3300037418 | Ga0395900_0672086 | Ga0395900_0672086_62_532 | 152 |
| 289 | 3300038443 | Ga0395901_0090821 | Ga0395901_0090821_1246_1716 | 152 |
| 290 | 3300039062 | Ga0400483_071908 | Ga0400483_071908_4798_5256 | 152 |
| 291 | 3300041460 | Ga0451802_0707868 | Ga0451802_0707868_135_596 | 152 |
| 292 | 3300041505 | Ga0451849_1095774 | Ga0451849_1095774_128_604 | 152 |
| 293 | 3300041512 | Ga0451853_2047447 | Ga0451853_2047447_547_1023 | 152 |
| 294 | 3300044683 | Ga0466965_0149997 | Ga0466965_0149997_268_729 | 152 |
| 295 | 3300045051 | Ga0451576_0833246 | Ga0451576_0833246_208_696 | 152 |
| 296 | 3300046459 | Ga0495629_0590837 | Ga0495629_0590837_177_698 | 152 |
| 297 | 3300046473 | Ga0495582_0008976 | Ga0495582_0008976_2208_2684 | 152 |
| 298 | 3300046531 | Ga0495665_0177082 | Ga0495665_0177082_132_599 | 152 |
| 299 | 3300046539 | Ga0495621_0419622 | Ga0495621_0419622_66_536 | 152 |
| 300 | 3300046675 | Ga0495657_0032701 | Ga0495657_0032701_2472_2957 | 152 |
| 301 | 3300046683 | Ga0495658_0003662 | Ga0495658_0003662_4218_4694 | 152 |
| 302 | 3300047315 | Ga0495581_0593978 | Ga0495581_0593978_37_513 | 152 |
| 303 | 3300047319 | Ga0495674_1034687 | Ga0495674_1034687_41_508 | 152 |
| 304 | 3300049521 | Ga0501298_071070 | Ga0501298_071070_125_598 | 152 |
| 305 | 3300049741 | Ga0501079_1162723 | Ga0501079_1162723_24_500 | 152 |
| 306 | 3300049743 | Ga0501081_0233160 | Ga0501081_0233160_151_627 | 152 |
| 307 | 3300050493 | nmdc:mga0k408_41990_c1 | nmdc:mga0k408_41990_c1_1642_2157 | 152 |
| 308 | 3300050493 | nmdc:mga0k408_6301_c1 | nmdc:mga0k408_6301_c1_4760_5224 | 152 |
| 309 | 3300050496 | nmdc:mga07m45_82064_c1 | nmdc:mga07m45_82064_c1_1315_1830 | 152 |
| 310 | 3300050510 | nmdc:mga06r32_285687_c1 | nmdc:mga06r32_285687_c1_1089_1610 | 152 |
| 311 | 3300050512 | nmdc:mga0n895_853503_c1 | nmdc:mga0n895_853503_c1_252_737 | 152 |
| 312 | 3300053093 | Ga0500651_0571967 | Ga0500651_0571967_107_580 | 152 |
| 313 | 3300053154 | Ga0500619_000132 | Ga0500619_000132_7344_7805 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s3l-assembly1.cif.gz_A | structural and functional characterization of a novel archaeal phosphodiesterase | 0.8281 | 1 | 148 |
| 1s3l-assembly1.cif.gz_A | structural and functional characterization of a novel archaeal phosphodiesterase | 0.8036 | 1 | 148 |
| 5osi-assembly3.cif.gz_G | structure of retromer vps29-vps35c subunits complexed with ridl harpin loop (163-176) | 0.7961 | 1 | 149 |
| 6tl0-assembly1.cif.gz_A | solution structure and 1h, 13c and 15n chemical shift assignments for the complex of vps29 with varp 687-747 | 0.7931 | 1 | 149 |
| 1w24-assembly1.cif.gz_A | crystal structure of human vps29 | 0.7865 | 1 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58040_34_189_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8648 | 1 | 148 | 3.60.21.10 |
| af_A4I7S2_2_176_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8396 | 1 | 149 | 3.60.21.10 |
| af_Q58040_34_189_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8381 | 1 | 148 | 3.60.21.10 |
| 1s3lA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8281 | 1 | 148 | 3.60.21.10 |
| af_A4I7S2_2_176_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8193 | 1 | 149 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-E8WZF2-F1-model_v4 | Phosphoesterase (EC 3.1.4.-) | 0.9873 | 1 | 152 |
GO:0016787
GO:0046872 |
| AF-A0A2V7E4R1-F1-model_v4 | Phosphoesterase (EC 3.1.4.-) | 0.9859 | 2 | 151 |
GO:0016787
GO:0046872 |
| AF-A0A831Y7A1-F1-model_v4 | Phosphoesterase (EC 3.1.4.-) | 0.9858 | 1 | 152 |
GO:0016787
GO:0046872 |
| AF-H0S9A3-F1-model_v4 | Phosphoesterase (EC 3.1.4.-) | 0.9853 | 1 | 152 |
GO:0016787
GO:0046872 |
| AF-A0A530HE49-F1-model_v4 | Phosphoesterase (EC 3.1.4.-) | 0.9845 | 1 | 118 |
GO:0016787
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar