F402128

General Info

Members Datasets Scaffolds Average Seq Length
313 205 303 157

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100772724|Ga0075431_1007727241
Length 184
Sequence MAVSSSKVKRAMVRVGLISDTHGLLRPEAKAFLRGSDYIVHGGDVGDPGILDELAALAPLTAVRGNNDRGPWAERLRETECLQVGEVFVYAIHDLAHLEIEPNAAGIHVVVSGHSHKPLVEKRRGVLYVNPGSSGPRRFKLPIAVGELLIEGRSVSARVVDLWDSARSGESHDFRPTIPVVLRW

Samples

Sample ID Description Type Environment
1 2511231024 Pseudomonas sp. GM84 Isolate Nodule
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
4 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
5 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
6 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
7 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
8 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
128 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
129 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
150 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
151 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
154 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
204 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
205 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.17
Metatranscriptomes 0.64
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0.96
Rhizoplane 0.64
Rhizosphere 91.05
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001001 3300000546 Bacteria 4475
2 rootL2_10010297 3300003322 Bacteria 8170
3 Ga0065714_10184096 3300005288 Bacteria 952
4 Ga0065704_10070513 3300005289 Bacteria 22024
5 Ga0065707_10081844 3300005295 Bacteria 34337
6 Ga0070690_100629315 3300005330 Bacteria 817
7 Ga0070670_100003874 3300005331 Bacteria 12480
8 Ga0068869_100070732 3300005334 Bacteria 2582
9 Ga0068869_100141436 3300005334 Bacteria 1858
10 Ga0070666_10322689 3300005335 Bacteria 1102
11 Ga0070660_100116743 3300005339 Bacteria 2128
12 Ga0070689_100272290 3300005340 Bacteria 1402
13 Ga0070689_100642610 3300005340 Bacteria 922
14 Ga0070691_10464454 3300005341 Bacteria 725
15 Ga0070692_10220620 3300005345 Unclassified 1121
16 Ga0070668_100971391 3300005347 Unclassified 762
17 Ga0070669_100086624 3300005353 Bacteria 2341
18 Ga0070669_100569432 3300005353 Bacteria 946
19 Ga0070675_100178485 3300005354 Unclassified 1835
20 Ga0070675_100243489 3300005354 Bacteria 1572
21 Ga0070671_100280127 3300005355 Bacteria 1418
22 Ga0070674_101397978 3300005356 Unclassified 626
23 Ga0070673_100215079 3300005364 Bacteria 1661
24 Ga0070673_100535754 3300005364 Unclassified 1062
25 Ga0070667_100218750 3300005367 Unclassified 1695
26 Ga0070667_100741158 3300005367 Bacteria 910
27 Ga0070714_100035217 3300005435 Bacteria 4195
28 Ga0070700_100283394 3300005441 Bacteria 1202
29 Ga0070694_100021469 3300005444 Bacteria 4126
30 Ga0070694_100114872 3300005444 Bacteria 1923
31 Ga0070663_100104663 3300005455 Bacteria 2117
32 Ga0070663_101752425 3300005455 Unclassified 556
33 Ga0070678_100061855 3300005456 Bacteria 2761
34 Ga0070678_100330853 3300005456 Bacteria 1304
35 Ga0070678_100569241 3300005456 Bacteria 1008
36 Ga0070678_100640479 3300005456 Bacteria 952
37 Ga0070678_101545385 3300005456 Bacteria 622
38 Ga0070662_100316960 3300005457 Bacteria 1271
39 Ga0070681_10422512 3300005458 Bacteria 1245
40 Ga0070681_10525402 3300005458 Bacteria 1097
41 Ga0068867_100064090 3300005459 Bacteria 2732
42 Ga0070706_100007038 3300005467 Bacteria 10606
43 Ga0070707_100097490 3300005468 Bacteria 2847
44 Ga0070707_100200579 3300005468 Bacteria 1945
45 Ga0070698_100073257 3300005471 Bacteria 3432
46 Ga0070698_100370026 3300005471 Unclassified 1365
47 Ga0070699_100318345 3300005518 Bacteria 1398
48 Ga0070679_100006165 3300005530 Bacteria 11159
49 Ga0070679_100124722 3300005530 Bacteria 2558
50 Ga0070679_100413011 3300005530 Bacteria 1295
51 Ga0068853_100050320 3300005539 Bacteria 3584
52 Ga0068853_100116517 3300005539 Bacteria 2379
53 Ga0068853_100504972 3300005539 Bacteria 1142
54 Ga0070672_100200737 3300005543 Bacteria 1668
55 Ga0070695_100048554 3300005545 Bacteria 2715
56 Ga0070695_100726870 3300005545 Bacteria 790
57 Ga0070696_100002515 3300005546 Bacteria 12139
58 Ga0070696_100009076 3300005546 Bacteria 6660
59 Ga0070693_100017546 3300005547 Bacteria 3723
60 Ga0070693_100367709 3300005547 Bacteria 988
61 Ga0070665_100119099 3300005548 Bacteria 2642
62 Ga0070665_100197584 3300005548 Bacteria 2012
63 Ga0070665_101041698 3300005548 Bacteria 830
64 Ga0068855_100006299 3300005563 Bacteria 14463
65 Ga0068855_100090427 3300005563 Bacteria 3533
66 Ga0068856_100032869 3300005614 Bacteria 5080
67 Ga0068852_100261052 3300005616 Bacteria 1663
68 Ga0068852_101635052 3300005616 Bacteria 667
69 Ga0068864_100067500 3300005618 Bacteria 3106
70 Ga0068864_100413603 3300005618 Bacteria 1284
71 Ga0068864_101703646 3300005618 Bacteria 635
72 Ga0068866_11112600 3300005718 Unclassified 566
73 Ga0068863_100016599 3300005841 Bacteria 7065
74 Ga0068863_100061915 3300005841 Bacteria 3538
75 Ga0068863_100145970 3300005841 Bacteria 2263
76 Ga0068858_100442303 3300005842 Bacteria 1252
77 Ga0068860_100275643 3300005843 Bacteria 1643
78 Ga0068860_100362007 3300005843 Bacteria 1429
79 Ga0068860_101424822 3300005843 Bacteria 714
80 Ga0075366_10009452 3300006195 Bacteria 5441
81 Ga0097621_100039534 3300006237 Bacteria 3789
82 Ga0097621_100096560 3300006237 Bacteria 2480
83 Ga0097621_100947434 3300006237 Bacteria 803
84 Ga0075370_10009337 3300006353 Bacteria 5089
85 Ga0075370_10426938 3300006353 Bacteria 796
86 Ga0068871_100022596 3300006358 Bacteria 4852
87 Ga0068871_100113762 3300006358 Bacteria 2279
88 Ga0075428_100135957 3300006844 Bacteria 2672
89 Ga0075428_101037365 3300006844 Unclassified 867
90 Ga0075430_100045520 3300006846 Bacteria 3707
91 Ga0075430_100611013 3300006846 Bacteria 899
92 Ga0075431_100011453 3300006847 Bacteria 8937
93 Ga0075431_100772724 3300006847 Unclassified 935
94 Ga0075431_101499889 3300006847 Unclassified 633
95 Ga0075434_100287834 3300006871 Bacteria 1663
96 Ga0068865_100058160 3300006881 Unclassified 2699
97 Ga0079104_1000841 3300006946 Bacteria 25521
98 Ga0105251_10000831 3300009011 Bacteria 27668
99 Ga0105251_10012214 3300009011 Bacteria 4871
100 Ga0105240_10002445 3300009093 Bacteria 29864
101 Ga0105240_10017418 3300009093 Bacteria 9682
102 Ga0105240_10898072 3300009093 Bacteria 953
103 Ga0105240_11273867 3300009093 Bacteria 776
104 Ga0105245_10338070 3300009098 Bacteria 1488
105 Ga0105243_10294064 3300009148 Bacteria 1469
106 Ga0105241_10240121 3300009174 Bacteria 1531
107 Ga0105242_10593938 3300009176 Bacteria 1068
108 Ga0105242_10906333 3300009176 Bacteria 882
109 Ga0105248_10046399 3300009177 Bacteria 4869
110 Ga0105237_10407032 3300009545 Bacteria 1365
111 Ga0105238_10008285 3300009551 Bacteria 10396
112 Ga0105238_10342069 3300009551 Bacteria 1484
113 Ga0105238_11679279 3300009551 Bacteria 666
114 Ga0105249_10768668 3300009553 Bacteria 1026
115 Ga0157370_10038040 3300013104 Bacteria 4658
116 Ga0157369_10407577 3300013105 Bacteria 1410
117 Ga0157374_10142118 3300013296 Bacteria 2330
118 Ga0157374_10236029 3300013296 Bacteria 1797
119 Ga0157374_10332885 3300013296 Bacteria 1506
120 Ga0157378_10091693 3300013297 Bacteria 2763
121 Ga0157378_10310690 3300013297 Bacteria 1529
122 Ga0163162_10019006 3300013306 Bacteria 6739
123 Ga0163162_10019910 3300013306 Bacteria 6590
124 Ga0163162_10117958 3300013306 Bacteria 2755
125 Ga0163162_10680100 3300013306 Bacteria 1152
126 Ga0163162_10825412 3300013306 Bacteria 1043
127 Ga0157372_10009385 3300013307 Bacteria 10409
128 Ga0157372_10026456 3300013307 Bacteria 6313
129 Ga0157375_10527324 3300013308 Bacteria 1344
130 Ga0157379_10030579 3300014968 Bacteria 4794
131 Ga0157379_10243228 3300014968 Bacteria 1632
132 Ga0157379_10312013 3300014968 Bacteria 1435
133 Ga0157376_10156944 3300014969 Bacteria 2058
134 Ga0163161_10023667 3300017792 Bacteria 4334
135 Ga0207656_10218504 3300025321 Bacteria 926
136 Ga0207713_1000848 3300025735 Bacteria 28075
137 Ga0207713_1113984 3300025735 Bacteria 915
138 Ga0207684_10007207 3300025910 Bacteria 10048
139 Ga0207654_10222565 3300025911 Bacteria 1253
140 Ga0207707_10995153 3300025912 Bacteria 688
141 Ga0207695_10044064 3300025913 Bacteria 4749
142 Ga0207695_10333619 3300025913 Bacteria 1405
143 Ga0207671_10294925 3300025914 Bacteria 1281
144 Ga0207657_10022371 3300025919 Bacteria 5917
145 Ga0207657_10753310 3300025919 Unclassified 754
146 Ga0207652_10088298 3300025921 Bacteria 2720
147 Ga0207652_10137676 3300025921 Bacteria 2181
148 Ga0207652_10138695 3300025921 Bacteria 2173
149 Ga0207646_10173771 3300025922 Bacteria 1945
150 Ga0207646_10352726 3300025922 Bacteria 1329
151 Ga0207681_10326157 3300025923 Bacteria 1222
152 Ga0207681_10460547 3300025923 Bacteria 1036
153 Ga0207694_10151463 3300025924 Bacteria 1869
154 Ga0207659_10084973 3300025926 Bacteria 2350
155 Ga0207659_10123671 3300025926 Bacteria 1986
156 Ga0207644_10110483 3300025931 Bacteria 2078
157 Ga0207706_10303718 3300025933 Bacteria 1390
158 Ga0207706_10425702 3300025933 Unclassified 1150
159 Ga0207686_10034798 3300025934 Bacteria 3018
160 Ga0207709_10398842 3300025935 Bacteria 1051
161 Ga0207670_10426746 3300025936 Bacteria 1065
162 Ga0207704_10045190 3300025938 Bacteria 2615
163 Ga0207691_10020197 3300025940 Bacteria 6300
164 Ga0207691_10175211 3300025940 Bacteria 1876
165 Ga0207711_10098837 3300025941 Bacteria 2579
166 Ga0207689_10002696 3300025942 Bacteria 16423
167 Ga0207689_10232999 3300025942 Unclassified 1522
168 Ga0207667_10049270 3300025949 Bacteria 4450
169 Ga0207667_10156341 3300025949 Bacteria 2346
170 Ga0207651_10284922 3300025960 Bacteria 1367
171 Ga0207651_10303786 3300025960 Unclassified 1328
172 Ga0207712_10807661 3300025961 Bacteria 825
173 Ga0207668_10183568 3300025972 Unclassified 1652
174 Ga0207658_10185118 3300025986 Bacteria 1727
175 Ga0207658_10665864 3300025986 Bacteria 939
176 Ga0207703_10005488 3300026035 Bacteria 10194
177 Ga0207639_10282524 3300026041 Bacteria 1460
178 Ga0207639_10962044 3300026041 Bacteria 799
179 Ga0207678_10044174 3300026067 Bacteria 3855
180 Ga0207708_10326366 3300026075 Bacteria 1254
181 Ga0207702_10423332 3300026078 Unclassified 1288
182 Ga0207641_10032290 3300026088 Unclassified 4346
183 Ga0207641_10110005 3300026088 Bacteria 2441
184 Ga0207641_10113411 3300026088 Bacteria 2407
185 Ga0207648_10003591 3300026089 Bacteria 16220
186 Ga0207648_10718808 3300026089 Bacteria 926
187 Ga0207676_10041891 3300026095 Bacteria 3519
188 Ga0207676_11107857 3300026095 Bacteria 783
189 Ga0207683_10003507 3300026121 Bacteria 13682
190 Ga0207683_10033867 3300026121 Bacteria 4438
191 Ga0207683_10177024 3300026121 Unclassified 1933
192 Ga0207683_10523342 3300026121 Bacteria 1096
193 Ga0207698_10434032 3300026142 Bacteria 1264
194 Ga0207698_10817870 3300026142 Bacteria 935
195 Ga0209281_1000485 3300027111 Bacteria 55132
196 Ga0268266_10188324 3300028379 Bacteria 1883
197 Ga0268265_10033497 3300028380 Bacteria 3736
198 Ga0268264_10140534 3300028381 Bacteria 2153
199 Ga0268264_10263938 3300028381 Bacteria 1606
200 Ga0307515_10007649 3300028794 Bacteria 21312
201 Ga0316178_1081348 3300030735 Bacteria 13815
202 Ga0316182_1197348 3300030745 Unclassified 1157
203 Ga0265770_1001726 3300030878 Bacteria 2991
204 Ga0265760_10001092 3300031090 Bacteria 7880
205 Ga0265328_10263738 3300031239 Bacteria 661
206 Ga0307408_100000247 3300031548 Bacteria 56153
207 Ga0307408_100001096 3300031548 Bacteria 20679
208 Ga0307408_100030675 3300031548 Bacteria 3736
209 Ga0307516_10014785 3300031730 Bacteria 8242
210 Ga0307405_10031427 3300031731 Bacteria 3126
211 Ga0307405_10440511 3300031731 Bacteria 1030
212 Ga0307405_10564786 3300031731 Bacteria 923
213 Ga0307405_11262083 3300031731 Bacteria 641
214 Ga0307410_10041771 3300031852 Bacteria 3026
215 Ga0307406_10082856 3300031901 Bacteria 2138
216 Ga0307412_10115971 3300031911 Bacteria 1920
217 Ga0307412_10183017 3300031911 Bacteria 1578
218 Ga0307412_10213845 3300031911 Bacteria 1473
219 Ga0307412_10538968 3300031911 Bacteria 978
220 Ga0307409_100020599 3300031995 Bacteria 4499
221 Ga0307409_100474781 3300031995 Bacteria 1212
222 Ga0307416_100054264 3300032002 Bacteria 3221
223 Ga0307414_10003528 3300032004 Bacteria 8366
224 Ga0307411_10017082 3300032005 Bacteria 4123
225 Ga0307415_100035568 3300032126 Bacteria 3254
226 Ga0373937_0229300 3300036401 Bacteria 1749
227 Ga0316584_0133089 3300036712 Bacteria 1857
228 Ga0395900_0071007 3300037418 Bacteria 3579
229 Ga0395900_0672086 3300037418 Bacteria 971
230 Ga0395898_0027351 3300037466 Bacteria 5727
231 Ga0395905_0017634 3300037471 Bacteria 6776
232 Ga0395901_0042768 3300038443 Bacteria 4699
233 Ga0395901_0090821 3300038443 Bacteria 3197
234 Ga0395901_0569285 3300038443 Bacteria 1146
235 Ga0400483_071908 3300039062 Bacteria 11244
236 Ga0451802_0707868 3300041460 Unclassified 633
237 Ga0451849_1095774 3300041505 Bacteria 650
238 Ga0451853_2047447 3300041512 Bacteria 1052
239 Ga0439432_000435 3300042006 Bacteria 15539
240 Ga0439432_001659 3300042006 Bacteria 8336
241 Ga0439452_000024 3300042010 Bacteria 230396
242 Ga0439452_000047 3300042010 Bacteria 127643
243 Ga0466965_0149997 3300044683 Bacteria 1218
244 Ga0451576_0833246 3300045051 Bacteria 968
245 Ga0495590_0011044 3300046457 Bacteria 3384
246 Ga0495629_0590837 3300046459 Bacteria 743
247 Ga0495582_0008976 3300046473 Bacteria 5516
248 Ga0495607_0003807 3300046501 Bacteria 11388
249 Ga0495632_0008420 3300046519 Bacteria 6331
250 Ga0495665_0177082 3300046531 Bacteria 1109
251 Ga0495621_0419622 3300046539 Bacteria 569
252 Ga0495657_0032701 3300046675 Bacteria 3628
253 Ga0495658_0003662 3300046683 Bacteria 7604
254 Ga0495581_0593978 3300047315 Bacteria 641
255 Ga0495674_1034687 3300047319 Bacteria 628
256 Ga0496114_0739567 3300048917 Bacteria 860
257 Ga0496117_0000559 3300048920 Bacteria 61171
258 Ga0496118_0480921 3300048921 Bacteria 622
259 Ga0496119_0000695 3300048922 Bacteria 45051
260 Ga0496120_0000105 3300048923 Bacteria 140297
261 Ga0496122_0000081 3300048925 Bacteria 211119
262 Ga0496123_0000101 3300048926 Bacteria 169939
263 Ga0496124_0000277 3300048927 Bacteria 98300
264 Ga0501298_071070 3300049521 Bacteria 751
265 Ga0501033_0344969 3300049570 Bacteria 1044
266 Ga0501039_0134887 3300049575 Bacteria 1938
267 Ga0501040_0137054 3300049576 Bacteria 1723
268 Ga0501040_0301799 3300049576 Unclassified 1145
269 Ga0501041_0313830 3300049577 Bacteria 989
270 Ga0501041_0373167 3300049577 Bacteria 902
271 Ga0501042_0094203 3300049578 Bacteria 2151
272 Ga0501046_0444521 3300049580 Bacteria 933
273 Ga0501048_0058717 3300049582 Bacteria 2727
274 Ga0501070_0969093 3300049586 Bacteria 661
275 Ga0501072_0347326 3300049588 Bacteria 1178
276 Ga0501074_0149498 3300049590 Bacteria 1670
277 Ga0501074_0498042 3300049590 Unclassified 863
278 Ga0501074_0691089 3300049590 Unclassified 720
279 Ga0501075_0050779 3300049591 Bacteria 3118
280 Ga0501076_0471273 3300049592 Bacteria 1034
281 Ga0501077_0003165 3300049593 Bacteria 9906
282 Ga0501079_0131640 3300049741 Bacteria 1946
283 Ga0501079_1162723 3300049741 Bacteria 608
284 Ga0501081_0132867 3300049743 Bacteria 1779
285 Ga0501081_0233160 3300049743 Bacteria 1341
286 Ga0501269_003264 3300049766 Bacteria 1964
287 Ga0501045_0200906 3300049824 Bacteria 1485
288 Ga0501045_0444683 3300049824 Unclassified 964
289 nmdc:mga0k408_41990_c1 3300050493 Bacteria 2634
290 nmdc:mga0k408_6301_c1 3300050493 Bacteria 6330
291 nmdc:mga07m45_82064_c1 3300050496 Bacteria 1841
292 nmdc:mga0qj67_441281_c1 3300050509 Bacteria 1049
293 nmdc:mga0qj67_475656_c1 3300050509 Bacteria 1005
294 nmdc:mga06r32_285687_c1 3300050510 Bacteria 1636
295 nmdc:mga06r32_96797_c1 3300050510 Bacteria 2891
296 nmdc:mga0n895_853503_c1 3300050512 Bacteria 898
297 Ga0500651_0571967 3300053093 Bacteria 616
298 Ga0500619_000132 3300053154 Bacteria 19303
299 Ga0501084_0206434 3300054114 Bacteria 1658
300 Ga0501082_0007859 3300060353 Bacteria 9202
301 Ga0501082_0076756 3300060353 Bacteria 2880
302 Ga0530510_0102839 3300061734 Bacteria 2089
303 Ga0530510_0788589 3300061734 Unclassified 725

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8056166840 8056168271 135
2 3300009545 Ga0105237_10407032 Ga0105237_104070322 144
3 3300009551 Ga0105238_11679279 Ga0105238_116792791 144
4 3300005539 Ga0068853_100116517 Ga0068853_1001165173 145
5 3300009093 Ga0105240_10017418 Ga0105240_100174188 145
6 3300025913 Ga0207695_10333619 Ga0207695_103336192 145
7 3300025914 Ga0207671_10294925 Ga0207671_102949252 145
8 3300026041 Ga0207639_10962044 Ga0207639_109620442 145
9 iso_pu_bacteria 2511231024 2511375037 145
10 iso_pu_bacteria 2842832357 2842832884 145
11 iso_pu_bacteria 2929189879 2929193458 145
12 iso_pu_bacteria 2998139840 2998142654 145
13 iso_pu_bacteria 2998139840 2998142922 145
14 iso_pu_bacteria 3007861166 3007861740 145
15 iso_pu_bacteria 8056172158 8056173940 145
16 3300032002 Ga0307416_100054264 Ga0307416_1000542641 146
17 3300006846 Ga0075430_100045520 Ga0075430_1000455204 147
18 3300050509 nmdc:mga0qj67_475656_c1 nmdc:mga0qj67_475656_c1_351_824 147
19 3300005347 Ga0070668_100971391 Ga0070668_1009713912 148
20 3300005444 Ga0070694_100114872 Ga0070694_1001148725 148
21 3300005546 Ga0070696_100002515 Ga0070696_1000025157 148
22 3300005289 Ga0065704_10070513 Ga0065704_1007051311 149
23 3300005331 Ga0070670_100003874 Ga0070670_1000038747 149
24 3300005353 Ga0070669_100086624 Ga0070669_1000866243 149
25 3300005548 Ga0070665_100197584 Ga0070665_1001975842 149
26 3300006844 Ga0075428_101037365 Ga0075428_1010373651 149
27 3300006847 Ga0075431_101499889 Ga0075431_1014998891 149
28 3300006946 Ga0079104_1000841 Ga0079104_10008418 149
29 3300009011 Ga0105251_10000831 Ga0105251_1000083122 149
30 3300009011 Ga0105251_10012214 Ga0105251_100122145 149
31 3300025735 Ga0207713_1000848 Ga0207713_100084811 149
32 3300025735 Ga0207713_1113984 Ga0207713_11139842 149
33 3300025923 Ga0207681_10326157 Ga0207681_103261572 149
34 3300027111 Ga0209281_1000485 Ga0209281_100048546 149
35 3300030735 Ga0316178_1081348 Ga0316178_10813488 149
36 3300031548 Ga0307408_100000247 Ga0307408_10000024752 149
37 3300031548 Ga0307408_100001096 Ga0307408_1000010962 149
38 3300031731 Ga0307405_10564786 Ga0307405_105647861 149
39 3300031911 Ga0307412_10115971 Ga0307412_101159712 149
40 3300031911 Ga0307412_10213845 Ga0307412_102138452 149
41 3300032004 Ga0307414_10003528 Ga0307414_1000352811 149
42 3300042006 Ga0439432_000435 Ga0439432_000435_9220_9687 149
43 3300042006 Ga0439432_001659 Ga0439432_001659_531_998 149
44 3300042010 Ga0439452_000024 Ga0439452_000024_167412_167879 149
45 3300042010 Ga0439452_000047 Ga0439452_000047_49651_50118 149
46 3300046457 Ga0495590_0011044 Ga0495590_0011044_2611_3078 149
47 3300046501 Ga0495607_0003807 Ga0495607_0003807_4774_5241 149
48 3300046519 Ga0495632_0008420 Ga0495632_0008420_5635_6102 149
49 3300048917 Ga0496114_0739567 Ga0496114_0739567_43_501 149
50 3300048920 Ga0496117_0000559 Ga0496117_0000559_35862_36329 149
51 3300048921 Ga0496118_0480921 Ga0496118_0480921_10_477 149
52 3300048922 Ga0496119_0000695 Ga0496119_0000695_12022_12489 149
53 3300048923 Ga0496120_0000105 Ga0496120_0000105_4599_5066 149
54 3300048925 Ga0496122_0000081 Ga0496122_0000081_71526_71993 149
55 3300048926 Ga0496123_0000101 Ga0496123_0000101_146603_147070 149
56 3300048927 Ga0496124_0000277 Ga0496124_0000277_96553_97020 149
57 3300049766 Ga0501269_003264 Ga0501269_003264_1232_1699 149
58 iso_pu_bacteria 2585428057 2587729967 149
59 3300037418 Ga0395900_0071007 Ga0395900_0071007_2121_2573 150
60 3300037471 Ga0395905_0017634 Ga0395905_0017634_3297_3749 150
61 3300038443 Ga0395901_0042768 Ga0395901_0042768_1390_1842 150
62 iso_pu_bacteria 2904434214 2904434702 150
63 3300005545 Ga0070695_100726870 Ga0070695_1007268701 151
64 3300006844 Ga0075428_100135957 Ga0075428_1001359572 151
65 3300006846 Ga0075430_100611013 Ga0075430_1006110132 151
66 3300006847 Ga0075431_100011453 Ga0075431_1000114538 151
67 3300037466 Ga0395898_0027351 Ga0395898_0027351_229_696 151
68 3300038443 Ga0395901_0569285 Ga0395901_0569285_444_911 151
69 3300049570 Ga0501033_0344969 Ga0501033_0344969_461_916 151
70 3300049575 Ga0501039_0134887 Ga0501039_0134887_1272_1727 151
71 3300049576 Ga0501040_0137054 Ga0501040_0137054_234_689 151
72 3300049576 Ga0501040_0301799 Ga0501040_0301799_206_661 151
73 3300049577 Ga0501041_0313830 Ga0501041_0313830_111_566 151
74 3300049577 Ga0501041_0373167 Ga0501041_0373167_379_834 151
75 3300049578 Ga0501042_0094203 Ga0501042_0094203_930_1385 151
76 3300049580 Ga0501046_0444521 Ga0501046_0444521_70_525 151
77 3300049582 Ga0501048_0058717 Ga0501048_0058717_511_966 151
78 3300049586 Ga0501070_0969093 Ga0501070_0969093_110_565 151
79 3300049588 Ga0501072_0347326 Ga0501072_0347326_662_1117 151
80 3300049590 Ga0501074_0149498 Ga0501074_0149498_191_646 151
81 3300049590 Ga0501074_0498042 Ga0501074_0498042_92_547 151
82 3300049590 Ga0501074_0691089 Ga0501074_0691089_227_682 151
83 3300049591 Ga0501075_0050779 Ga0501075_0050779_682_1137 151
84 3300049592 Ga0501076_0471273 Ga0501076_0471273_60_515 151
85 3300049593 Ga0501077_0003165 Ga0501077_0003165_1900_2355 151
86 3300049741 Ga0501079_0131640 Ga0501079_0131640_679_1134 151
87 3300049743 Ga0501081_0132867 Ga0501081_0132867_996_1451 151
88 3300049824 Ga0501045_0200906 Ga0501045_0200906_902_1357 151
89 3300049824 Ga0501045_0444683 Ga0501045_0444683_206_661 151
90 3300050509 nmdc:mga0qj67_441281_c1 nmdc:mga0qj67_441281_c1_275_730 151
91 3300050510 nmdc:mga06r32_96797_c1 nmdc:mga06r32_96797_c1_13_468 151
92 3300054114 Ga0501084_0206434 Ga0501084_0206434_41_496 151
93 3300060353 Ga0501082_0007859 Ga0501082_0007859_1632_2087 151
94 3300060353 Ga0501082_0076756 Ga0501082_0076756_1222_1677 151
95 3300061734 Ga0530510_0102839 Ga0530510_0102839_535_990 151
96 3300061734 Ga0530510_0788589 Ga0530510_0788589_120_575 151
97 3300000546 LJNas_1001001 LJNas_10010014 152
98 3300003322 rootL2_10010297 rootL2_100102972 152
99 3300005288 Ga0065714_10184096 Ga0065714_101840962 152
100 3300005295 Ga0065707_10081844 Ga0065707_1008184423 152
101 3300005330 Ga0070690_100629315 Ga0070690_1006293151 152
102 3300005334 Ga0068869_100070732 Ga0068869_1000707325 152
103 3300005334 Ga0068869_100141436 Ga0068869_1001414362 152
104 3300005335 Ga0070666_10322689 Ga0070666_103226892 152
105 3300005339 Ga0070660_100116743 Ga0070660_1001167433 152
106 3300005340 Ga0070689_100272290 Ga0070689_1002722902 152
107 3300005340 Ga0070689_100642610 Ga0070689_1006426101 152
108 3300005341 Ga0070691_10464454 Ga0070691_104644542 152
109 3300005345 Ga0070692_10220620 Ga0070692_102206202 152
110 3300005353 Ga0070669_100569432 Ga0070669_1005694322 152
111 3300005354 Ga0070675_100178485 Ga0070675_1001784852 152
112 3300005354 Ga0070675_100243489 Ga0070675_1002434892 152
113 3300005355 Ga0070671_100280127 Ga0070671_1002801272 152
114 3300005356 Ga0070674_101397978 Ga0070674_1013979781 152
115 3300005364 Ga0070673_100215079 Ga0070673_1002150792 152
116 3300005364 Ga0070673_100535754 Ga0070673_1005357542 152
117 3300005367 Ga0070667_100218750 Ga0070667_1002187502 152
118 3300005367 Ga0070667_100741158 Ga0070667_1007411582 152
119 3300005435 Ga0070714_100035217 Ga0070714_1000352172 152
120 3300005441 Ga0070700_100283394 Ga0070700_1002833942 152
121 3300005444 Ga0070694_100021469 Ga0070694_1000214695 152
122 3300005455 Ga0070663_100104663 Ga0070663_1001046634 152
123 3300005455 Ga0070663_101752425 Ga0070663_1017524251 152
124 3300005456 Ga0070678_100061855 Ga0070678_1000618553 152
125 3300005456 Ga0070678_100330853 Ga0070678_1003308532 152
126 3300005456 Ga0070678_100569241 Ga0070678_1005692411 152
127 3300005456 Ga0070678_100640479 Ga0070678_1006404792 152
128 3300005456 Ga0070678_101545385 Ga0070678_1015453851 152
129 3300005457 Ga0070662_100316960 Ga0070662_1003169602 152
130 3300005458 Ga0070681_10422512 Ga0070681_104225121 152
131 3300005458 Ga0070681_10525402 Ga0070681_105254022 152
132 3300005459 Ga0068867_100064090 Ga0068867_1000640905 152
133 3300005467 Ga0070706_100007038 Ga0070706_1000070386 152
134 3300005468 Ga0070707_100097490 Ga0070707_1000974904 152
135 3300005468 Ga0070707_100200579 Ga0070707_1002005792 152
136 3300005471 Ga0070698_100073257 Ga0070698_1000732575 152
137 3300005471 Ga0070698_100370026 Ga0070698_1003700263 152
138 3300005518 Ga0070699_100318345 Ga0070699_1003183453 152
139 3300005530 Ga0070679_100006165 Ga0070679_1000061655 152
140 3300005530 Ga0070679_100124722 Ga0070679_1001247222 152
141 3300005530 Ga0070679_100413011 Ga0070679_1004130111 152
142 3300005539 Ga0068853_100050320 Ga0068853_1000503202 152
143 3300005539 Ga0068853_100504972 Ga0068853_1005049722 152
144 3300005543 Ga0070672_100200737 Ga0070672_1002007373 152
145 3300005545 Ga0070695_100048554 Ga0070695_1000485542 152
146 3300005546 Ga0070696_100009076 Ga0070696_1000090767 152
147 3300005547 Ga0070693_100017546 Ga0070693_1000175466 152
148 3300005547 Ga0070693_100367709 Ga0070693_1003677092 152
149 3300005548 Ga0070665_100119099 Ga0070665_1001190995 152
150 3300005548 Ga0070665_101041698 Ga0070665_1010416982 152
151 3300005563 Ga0068855_100006299 Ga0068855_10000629913 152
152 3300005563 Ga0068855_100090427 Ga0068855_1000904272 152
153 3300005614 Ga0068856_100032869 Ga0068856_1000328694 152
154 3300005616 Ga0068852_100261052 Ga0068852_1002610522 152
155 3300005616 Ga0068852_101635052 Ga0068852_1016350522 152
156 3300005618 Ga0068864_100067500 Ga0068864_1000675004 152
157 3300005618 Ga0068864_100413603 Ga0068864_1004136032 152
158 3300005618 Ga0068864_101703646 Ga0068864_1017036462 152
159 3300005718 Ga0068866_11112600 Ga0068866_111126001 152
160 3300005841 Ga0068863_100016599 Ga0068863_1000165992 152
161 3300005841 Ga0068863_100061915 Ga0068863_1000619155 152
162 3300005841 Ga0068863_100145970 Ga0068863_1001459702 152
163 3300005842 Ga0068858_100442303 Ga0068858_1004423032 152
164 3300005843 Ga0068860_100275643 Ga0068860_1002756433 152
165 3300005843 Ga0068860_100362007 Ga0068860_1003620072 152
166 3300005843 Ga0068860_101424822 Ga0068860_1014248221 152
167 3300006195 Ga0075366_10009452 Ga0075366_100094525 152
168 3300006237 Ga0097621_100039534 Ga0097621_1000395346 152
169 3300006237 Ga0097621_100096560 Ga0097621_1000965605 152
170 3300006237 Ga0097621_100947434 Ga0097621_1009474342 152
171 3300006353 Ga0075370_10009337 Ga0075370_100093375 152
172 3300006353 Ga0075370_10426938 Ga0075370_104269382 152
173 3300006358 Ga0068871_100022596 Ga0068871_1000225968 152
174 3300006358 Ga0068871_100113762 Ga0068871_1001137622 152
175 3300006847 Ga0075431_100772724 Ga0075431_1007727241 152
176 3300006871 Ga0075434_100287834 Ga0075434_1002878342 152
177 3300006881 Ga0068865_100058160 Ga0068865_1000581602 152
178 3300009093 Ga0105240_10002445 Ga0105240_1000244524 152
179 3300009093 Ga0105240_10898072 Ga0105240_108980722 152
180 3300009093 Ga0105240_11273867 Ga0105240_112738671 152
181 3300009098 Ga0105245_10338070 Ga0105245_103380702 152
182 3300009148 Ga0105243_10294064 Ga0105243_102940643 152
183 3300009174 Ga0105241_10240121 Ga0105241_102401212 152
184 3300009176 Ga0105242_10593938 Ga0105242_105939381 152
185 3300009176 Ga0105242_10906333 Ga0105242_109063332 152
186 3300009177 Ga0105248_10046399 Ga0105248_100463994 152
187 3300009551 Ga0105238_10008285 Ga0105238_100082855 152
188 3300009551 Ga0105238_10342069 Ga0105238_103420692 152
189 3300009553 Ga0105249_10768668 Ga0105249_107686682 152
190 3300013104 Ga0157370_10038040 Ga0157370_100380402 152
191 3300013105 Ga0157369_10407577 Ga0157369_104075772 152
192 3300013296 Ga0157374_10142118 Ga0157374_101421182 152
193 3300013296 Ga0157374_10236029 Ga0157374_102360292 152
194 3300013296 Ga0157374_10332885 Ga0157374_103328852 152
195 3300013297 Ga0157378_10091693 Ga0157378_100916933 152
196 3300013297 Ga0157378_10310690 Ga0157378_103106904 152
197 3300013306 Ga0163162_10019006 Ga0163162_100190069 152
198 3300013306 Ga0163162_10019910 Ga0163162_100199105 152
199 3300013306 Ga0163162_10117958 Ga0163162_101179584 152
200 3300013306 Ga0163162_10680100 Ga0163162_106801002 152
201 3300013306 Ga0163162_10825412 Ga0163162_108254122 152
202 3300013307 Ga0157372_10009385 Ga0157372_100093855 152
203 3300013307 Ga0157372_10026456 Ga0157372_100264566 152
204 3300013308 Ga0157375_10527324 Ga0157375_105273243 152
205 3300014968 Ga0157379_10030579 Ga0157379_100305799 152
206 3300014968 Ga0157379_10243228 Ga0157379_102432282 152
207 3300014968 Ga0157379_10312013 Ga0157379_103120132 152
208 3300014969 Ga0157376_10156944 Ga0157376_101569444 152
209 3300017792 Ga0163161_10023667 Ga0163161_100236675 152
210 3300025321 Ga0207656_10218504 Ga0207656_102185041 152
211 3300025910 Ga0207684_10007207 Ga0207684_1000720711 152
212 3300025911 Ga0207654_10222565 Ga0207654_102225651 152
213 3300025912 Ga0207707_10995153 Ga0207707_109951531 152
214 3300025913 Ga0207695_10044064 Ga0207695_100440644 152
215 3300025919 Ga0207657_10022371 Ga0207657_100223718 152
216 3300025919 Ga0207657_10753310 Ga0207657_107533102 152
217 3300025921 Ga0207652_10088298 Ga0207652_100882982 152
218 3300025921 Ga0207652_10137676 Ga0207652_101376763 152
219 3300025921 Ga0207652_10138695 Ga0207652_101386954 152
220 3300025922 Ga0207646_10173771 Ga0207646_101737713 152
221 3300025922 Ga0207646_10352726 Ga0207646_103527262 152
222 3300025923 Ga0207681_10460547 Ga0207681_104605472 152
223 3300025924 Ga0207694_10151463 Ga0207694_101514632 152
224 3300025926 Ga0207659_10084973 Ga0207659_100849732 152
225 3300025926 Ga0207659_10123671 Ga0207659_101236712 152
226 3300025931 Ga0207644_10110483 Ga0207644_101104833 152
227 3300025933 Ga0207706_10303718 Ga0207706_103037182 152
228 3300025933 Ga0207706_10425702 Ga0207706_104257022 152
229 3300025934 Ga0207686_10034798 Ga0207686_100347982 152
230 3300025935 Ga0207709_10398842 Ga0207709_103988422 152
231 3300025936 Ga0207670_10426746 Ga0207670_104267461 152
232 3300025938 Ga0207704_10045190 Ga0207704_100451902 152
233 3300025940 Ga0207691_10020197 Ga0207691_100201978 152
234 3300025940 Ga0207691_10175211 Ga0207691_101752113 152
235 3300025941 Ga0207711_10098837 Ga0207711_100988374 152
236 3300025942 Ga0207689_10002696 Ga0207689_1000269620 152
237 3300025942 Ga0207689_10232999 Ga0207689_102329992 152
238 3300025949 Ga0207667_10049270 Ga0207667_100492704 152
239 3300025949 Ga0207667_10156341 Ga0207667_101563412 152
240 3300025960 Ga0207651_10284922 Ga0207651_102849223 152
241 3300025960 Ga0207651_10303786 Ga0207651_103037862 152
242 3300025961 Ga0207712_10807661 Ga0207712_108076612 152
243 3300025972 Ga0207668_10183568 Ga0207668_101835681 152
244 3300025986 Ga0207658_10185118 Ga0207658_101851183 152
245 3300025986 Ga0207658_10665864 Ga0207658_106658642 152
246 3300026035 Ga0207703_10005488 Ga0207703_1000548813 152
247 3300026041 Ga0207639_10282524 Ga0207639_102825242 152
248 3300026067 Ga0207678_10044174 Ga0207678_100441742 152
249 3300026075 Ga0207708_10326366 Ga0207708_103263662 152
250 3300026078 Ga0207702_10423332 Ga0207702_104233322 152
251 3300026088 Ga0207641_10032290 Ga0207641_100322902 152
252 3300026088 Ga0207641_10110005 Ga0207641_101100053 152
253 3300026088 Ga0207641_10113411 Ga0207641_101134114 152
254 3300026089 Ga0207648_10003591 Ga0207648_100035916 152
255 3300026089 Ga0207648_10718808 Ga0207648_107188082 152
256 3300026095 Ga0207676_10041891 Ga0207676_100418916 152
257 3300026095 Ga0207676_11107857 Ga0207676_111078572 152
258 3300026121 Ga0207683_10003507 Ga0207683_100035076 152
259 3300026121 Ga0207683_10033867 Ga0207683_100338673 152
260 3300026121 Ga0207683_10177024 Ga0207683_101770243 152
261 3300026121 Ga0207683_10523342 Ga0207683_105233422 152
262 3300026142 Ga0207698_10434032 Ga0207698_104340321 152
263 3300026142 Ga0207698_10817870 Ga0207698_108178702 152
264 3300028379 Ga0268266_10188324 Ga0268266_101883243 152
265 3300028380 Ga0268265_10033497 Ga0268265_100334973 152
266 3300028381 Ga0268264_10140534 Ga0268264_101405343 152
267 3300028381 Ga0268264_10263938 Ga0268264_102639383 152
268 3300028794 Ga0307515_10007649 Ga0307515_1000764913 152
269 3300030745 Ga0316182_1197348 Ga0316182_11973482 152
270 3300030878 Ga0265770_1001726 Ga0265770_10017264 152
271 3300031090 Ga0265760_10001092 Ga0265760_100010924 152
272 3300031239 Ga0265328_10263738 Ga0265328_102637382 152
273 3300031548 Ga0307408_100030675 Ga0307408_1000306754 152
274 3300031730 Ga0307516_10014785 Ga0307516_100147856 152
275 3300031731 Ga0307405_10031427 Ga0307405_100314276 152
276 3300031731 Ga0307405_10440511 Ga0307405_104405113 152
277 3300031731 Ga0307405_11262083 Ga0307405_112620831 152
278 3300031852 Ga0307410_10041771 Ga0307410_100417714 152
279 3300031901 Ga0307406_10082856 Ga0307406_100828562 152
280 3300031911 Ga0307412_10183017 Ga0307412_101830172 152
281 3300031911 Ga0307412_10538968 Ga0307412_105389683 152
282 3300031995 Ga0307409_100020599 Ga0307409_1000205994 152
283 3300031995 Ga0307409_100474781 Ga0307409_1004747812 152
284 3300032005 Ga0307411_10017082 Ga0307411_100170824 152
285 3300032126 Ga0307415_100035568 Ga0307415_1000355686 152
286 3300036401 Ga0373937_0229300 Ga0373937_0229300_754_1239 152
287 3300036712 Ga0316584_0133089 Ga0316584_0133089_55_519 152
288 3300037418 Ga0395900_0672086 Ga0395900_0672086_62_532 152
289 3300038443 Ga0395901_0090821 Ga0395901_0090821_1246_1716 152
290 3300039062 Ga0400483_071908 Ga0400483_071908_4798_5256 152
291 3300041460 Ga0451802_0707868 Ga0451802_0707868_135_596 152
292 3300041505 Ga0451849_1095774 Ga0451849_1095774_128_604 152
293 3300041512 Ga0451853_2047447 Ga0451853_2047447_547_1023 152
294 3300044683 Ga0466965_0149997 Ga0466965_0149997_268_729 152
295 3300045051 Ga0451576_0833246 Ga0451576_0833246_208_696 152
296 3300046459 Ga0495629_0590837 Ga0495629_0590837_177_698 152
297 3300046473 Ga0495582_0008976 Ga0495582_0008976_2208_2684 152
298 3300046531 Ga0495665_0177082 Ga0495665_0177082_132_599 152
299 3300046539 Ga0495621_0419622 Ga0495621_0419622_66_536 152
300 3300046675 Ga0495657_0032701 Ga0495657_0032701_2472_2957 152
301 3300046683 Ga0495658_0003662 Ga0495658_0003662_4218_4694 152
302 3300047315 Ga0495581_0593978 Ga0495581_0593978_37_513 152
303 3300047319 Ga0495674_1034687 Ga0495674_1034687_41_508 152
304 3300049521 Ga0501298_071070 Ga0501298_071070_125_598 152
305 3300049741 Ga0501079_1162723 Ga0501079_1162723_24_500 152
306 3300049743 Ga0501081_0233160 Ga0501081_0233160_151_627 152
307 3300050493 nmdc:mga0k408_41990_c1 nmdc:mga0k408_41990_c1_1642_2157 152
308 3300050493 nmdc:mga0k408_6301_c1 nmdc:mga0k408_6301_c1_4760_5224 152
309 3300050496 nmdc:mga07m45_82064_c1 nmdc:mga07m45_82064_c1_1315_1830 152
310 3300050510 nmdc:mga06r32_285687_c1 nmdc:mga06r32_285687_c1_1089_1610 152
311 3300050512 nmdc:mga0n895_853503_c1 nmdc:mga0n895_853503_c1_252_737 152
312 3300053093 Ga0500651_0571967 Ga0500651_0571967_107_580 152
313 3300053154 Ga0500619_000132 Ga0500619_000132_7344_7805 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

13

152

0.88

PF00149

Metallophos

Calcineurin-like phosphoesterase

13

100

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.8281 1 148
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.8036 1 148
5osi-assembly3.cif.gz_G structure of retromer vps29-vps35c subunits complexed with ridl harpin loop (163-176) 0.7961 1 149
6tl0-assembly1.cif.gz_A solution structure and 1h, 13c and 15n chemical shift assignments for the complex of vps29 with varp 687-747 0.7931 1 149
1w24-assembly1.cif.gz_A crystal structure of human vps29 0.7865 1 149
ID Description Score Start End Superfamily
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8648 1 148 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8396 1 149 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8381 1 148 3.60.21.10
1s3lA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8281 1 148 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8193 1 149 3.60.21.10
ID Description Score Start End GO Terms
AF-E8WZF2-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9873 1 152 GO:0016787
GO:0046872
AF-A0A2V7E4R1-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9859 2 151 GO:0016787
GO:0046872
AF-A0A831Y7A1-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9858 1 152 GO:0016787
GO:0046872
AF-H0S9A3-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9853 1 152 GO:0016787
GO:0046872
AF-A0A530HE49-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9845 1 118 GO:0016787
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.4 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map