F402297

General Info

Members Datasets Scaffolds Average Seq Length
313 217 290 362

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_126329|Ga0400483_126329_21581_22816
Length 411
Sequence MNEVTAAGGPQPDSEPVRYGVIGTGMMGIEHIHNINAIEGACVVAVSDPDDGSRAEGLTAAEAGGGQATGYADHIQLLDHSELDAVVVASPNFTHLDVVSDVLESGHHVLVEKPMCITVDRCLELIDRETATAEANPDRVVQVGLEYRYMPAVSHLVDEVGGGAVGRVRMVAIREHRFPFLVKVGDWNRFSANTGGTLVEKCCHFFDLMNLILAERPSRVMASGGQDVNHLDEVYDGRQSDILDNAYVIVDYPSGARAMLDLCMFAEATRNQEEVSVVGDIGKAEALIPDGVFRLGVRGRDWIGEVADHRVADDHIDYQGLHHGSSYLEHLDFLDAVAGRRPVPVTTVDGLWSVAMGQAAHLSIAEGRPVELGELSDRLVPGPYEPPPFGQPTPGPDDNPQSSRTDEVAAS

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
5 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
6 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
7 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
8 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
9 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
10 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
11 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
12 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
13 2851153111 Caulobacter radicis 736 Isolate Unclassified
14 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
15 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
16 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
17 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
18 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
19 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
20 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
21 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
22 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
23 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003556 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003560 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003561 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003564 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
33 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
131 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
139 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
140 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
141 3300031816 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
142 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
148 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
184 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
210 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
215 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.86
Metatranscriptomes 4.79
Isolates 7.35

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 15.02
Nodule 1.92
Rhizoplane 1.28
Rhizosphere 63.58
Stem 0
Stem Tuber 0
Unclassified 17.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000203 3300003214 Bacteria 86823
2 Ga0006556J51387_1022988 3300003479 Eukaryota 1448
3 Ga0006557J51388_1010972 3300003556 Eukaryota 1516
4 Ga0006558J51389_1011525 3300003558 Eukaryota 1450
5 Ga0006559J51393_1030344 3300003560 Eukaryota 1416
6 Ga0006553J51392_1011784 3300003561 Eukaryota 1481
7 Ga0006555J51386_1014142 3300003564 Eukaryota 1469
8 Ga0006560J51390_1018661 3300003565 Eukaryota 1431
9 Ga0006554J51385_1013439 3300003567 Eukaryota 1552
10 Ga0055525_1000012 3300003759 Bacteria 486564
11 Ga0055542_1000020 3300003762 Bacteria 335745
12 Ga0055529_1000016 3300003763 Bacteria 364775
13 Ga0055526_1000338 3300003771 Bacteria 38466
14 Ga0055524_1000109 3300003775 Bacteria 100308
15 Ga0055530_10000026 3300003791 Bacteria 129960
16 Ga0055530_10000027 3300003791 Bacteria 129838
17 Ga0055531_10000013 3300003794 Bacteria 187583
18 Ga0055531_10004565 3300003794 Bacteria 8372
19 Ga0055543_1008200 3300004625 Bacteria 2332
20 Ga0065165_1001071 3300005262 Bacteria 32650
21 Ga0065165_1002325 3300005262 Bacteria 16628
22 Ga0070658_10126414 3300005327 Bacteria 2128
23 Ga0070658_10149450 3300005327 Bacteria 1955
24 Ga0070690_100152236 3300005330 Bacteria 1579
25 Ga0070670_100008078 3300005331 Bacteria 8948
26 Ga0070677_10052374 3300005333 Bacteria 1656
27 Ga0070680_100005031 3300005336 Bacteria 9972
28 Ga0070680_100018331 3300005336 Bacteria 5530
29 Ga0070660_100076071 3300005339 Bacteria 2629
30 Ga0070661_100009470 3300005344 Bacteria 6744
31 Ga0070668_100126849 3300005347 Bacteria 2044
32 Ga0070669_100001300 3300005353 Bacteria 18039
33 Ga0070675_100019880 3300005354 Bacteria 5357
34 Ga0070671_100000999 3300005355 Bacteria 20812
35 Ga0070671_100283581 3300005355 Bacteria 1409
36 Ga0070659_100000835 3300005366 Bacteria 22470
37 Ga0070659_100028267 3300005366 Bacteria 4328
38 Ga0070667_100017954 3300005367 Bacteria 5865
39 Ga0070713_100000313 3300005436 Bacteria 31800
40 Ga0070681_10004856 3300005458 Bacteria 12893
41 Ga0070681_10010199 3300005458 Bacteria 9267
42 Ga0068853_100020040 3300005539 Bacteria 5558
43 Ga0068853_100050382 3300005539 Bacteria 3582
44 Ga0070665_100000657 3300005548 Bacteria 46640
45 Ga0070665_100000816 3300005548 Bacteria 40734
46 Ga0070665_100123622 3300005548 Bacteria 2590
47 Ga0070665_100228270 3300005548 Bacteria 1862
48 Ga0068855_100035418 3300005563 Bacteria 5946
49 Ga0070664_100214818 3300005564 Bacteria 1719
50 Ga0068857_100164906 3300005577 Bacteria 2012
51 Ga0068854_100001802 3300005578 Bacteria 13027
52 Ga0068854_100007944 3300005578 Bacteria 6793
53 Ga0068852_100118226 3300005616 Bacteria 2422
54 Ga0068861_100178652 3300005719 Bacteria 1765
55 Ga0068851_10023196 3300005834 Bacteria 3030
56 Ga0068863_100003708 3300005841 Bacteria 15113
57 Ga0068858_100011452 3300005842 Bacteria 8371
58 Ga0068860_100005627 3300005843 Bacteria 12658
59 Ga0068862_100010390 3300005844 Bacteria 7683
60 Ga0068862_100014302 3300005844 Bacteria 6583
61 Ga0070717_10046298 3300006028 Bacteria 3559
62 Ga0079104_1000001 3300006946 Bacteria 521847
63 Ga0105251_10005641 3300009011 Bacteria 8131
64 Ga0105240_10030556 3300009093 Bacteria 6999
65 Ga0105240_10100832 3300009093 Bacteria 3513
66 Ga0105247_10011753 3300009101 Bacteria 5266
67 Ga0105248_10000346 3300009177 Bacteria 54370
68 Ga0105248_10044719 3300009177 Bacteria 4967
69 Ga0105237_10048984 3300009545 Bacteria 4247
70 Ga0105239_10036572 3300010375 Bacteria 5391
71 Ga0157370_10011388 3300013104 Bacteria 9307
72 Ga0157369_10140112 3300013105 Bacteria 2560
73 Ga0157378_10058352 3300013297 Bacteria 3442
74 Ga0157372_10045061 3300013307 Bacteria 4890
75 Ga0163161_10004517 3300017792 Bacteria 9684
76 Ga0206351_10567948 3300020077 Eukaryota 1455
77 Ga0206352_11362350 3300020078 Eukaryota 1391
78 Ga0206350_11335671 3300020080 Eukaryota 1352
79 Ga0213872_10007390 3300021361 Bacteria 5410
80 Ga0213872_10010882 3300021361 Bacteria 4317
81 Ga0209563_100030 3300025230 Bacteria 489259
82 Ga0209563_103698 3300025230 Bacteria 3102
83 Ga0209437_104473 3300025233 Bacteria 2461
84 Ga0209026_1003284 3300025250 Bacteria 5410
85 Ga0209148_1000017 3300025254 Bacteria 787064
86 Ga0209148_1004637 3300025254 Bacteria 3328
87 Ga0209233_1000066 3300025261 Bacteria 381218
88 Ga0209455_1000005 3300025272 Bacteria 1416756
89 Ga0209675_1013771 3300025291 Bacteria 2506
90 Ga0209564_1000750 3300025295 Bacteria 45965
91 Ga0209758_1000261 3300025297 Bacteria 104423
92 Ga0209050_1000014 3300025298 Bacteria 774327
93 Ga0209050_1000029 3300025298 Bacteria 465801
94 Ga0209050_1000127 3300025298 Bacteria 187951
95 Ga0209050_1003055 3300025298 Bacteria 12903
96 Ga0209256_1000015 3300025299 Bacteria 622953
97 Ga0209256_1010063 3300025299 Bacteria 4028
98 Ga0209257_1000019 3300025304 Bacteria 774261
99 Ga0209257_1000152 3300025304 Bacteria 189432
100 Ga0207713_1001737 3300025735 Bacteria 16750
101 Ga0207688_10017622 3300025901 Bacteria 3884
102 Ga0207645_10091747 3300025907 Bacteria 1954
103 Ga0207705_10026258 3300025909 Bacteria 4154
104 Ga0207707_10009052 3300025912 Bacteria 8650
105 Ga0207707_10028285 3300025912 Bacteria 4900
106 Ga0207695_10087784 3300025913 Bacteria 3132
107 Ga0207671_10192535 3300025914 Bacteria 1590
108 Ga0207660_10003761 3300025917 Bacteria 9884
109 Ga0207660_10013094 3300025917 Bacteria 5430
110 Ga0207657_10000314 3300025919 Bacteria 51222
111 Ga0207657_10085551 3300025919 Bacteria 2641
112 Ga0207649_10007662 3300025920 Bacteria 5872
113 Ga0207652_10007712 3300025921 Bacteria 8648
114 Ga0207681_10000843 3300025923 Bacteria 20218
115 Ga0207650_10008948 3300025925 Bacteria 6843
116 Ga0207659_10030377 3300025926 Bacteria 3691
117 Ga0207700_10000161 3300025928 Bacteria 39987
118 Ga0207644_10016647 3300025931 Bacteria 4949
119 Ga0207690_10000132 3300025932 Bacteria 60604
120 Ga0207691_10008856 3300025940 Bacteria 9657
121 Ga0207711_10001878 3300025941 Bacteria 19149
122 Ga0207711_10053673 3300025941 Bacteria 3456
123 Ga0207668_10032825 3300025972 Bacteria 3435
124 Ga0207640_10003692 3300025981 Bacteria 8253
125 Ga0207639_10012872 3300026041 Bacteria 5837
126 Ga0207639_10088917 3300026041 Bacteria 2467
127 Ga0207641_10002631 3300026088 Bacteria 16459
128 Ga0207675_100012715 3300026118 Bacteria 7865
129 Ga0207683_10046336 3300026121 Bacteria 3805
130 Ga0209281_1000057 3300027111 Bacteria 307145
131 Ga0268266_10000003 3300028379 Bacteria 1701703
132 Ga0268266_10000387 3300028379 Bacteria 67080
133 Ga0268266_10235185 3300028379 Bacteria 1689
134 Ga0268265_10018192 3300028380 Bacteria 4867
135 Ga0268264_10002390 3300028381 Bacteria 16545
136 Ga0307515_10000252 3300028794 Bacteria 132500
137 Ga0265338_10006775 3300028800 Bacteria 14446
138 Ga0265338_10011130 3300028800 Bacteria 10430
139 Ga0314311_1062757 3300030733 Bacteria 2866
140 Ga0265760_10053274 3300031090 Bacteria 1220
141 Ga0265325_10003717 3300031241 Bacteria 9865
142 Ga0265339_10001916 3300031249 Bacteria 15263
143 Ga0265327_10000280 3300031251 Bacteria 100757
144 Ga0265327_10002489 3300031251 Bacteria 19327
145 Ga0265327_10005291 3300031251 Bacteria 10838
146 Ga0307509_10003701 3300031507 Bacteria 22882
147 Ga0307509_10056748 3300031507 Bacteria 4155
148 Ga0265313_10001016 3300031595 Bacteria 27359
149 Ga0265314_10021995 3300031711 Bacteria 4890
150 Ga0316576_10005570 3300031727 Bacteria 7715
151 Ga0316576_10040846 3300031727 Bacteria 3336
152 Ga0316576_10093162 3300031727 Bacteria 2245
153 Ga0316578_10046954 3300031728 Bacteria 2519
154 Ga0316577_10000841 3300031733 Bacteria 13401
155 Ga0316577_10111868 3300031733 Bacteria 1532
156 Ga0316042_106498 3300031816 Eukaryota 1692
157 Ga0316043_106061 3300031828 Eukaryota 1730
158 Ga0307407_10001965 3300031903 Bacteria 7803
159 Ga0307409_100145455 3300031995 Bacteria 2049
160 Ga0307510_10001188 3300033180 Bacteria 28138
161 Ga0316574_0003163 3300035398 Bacteria 8429
162 Ga0316574_0005171 3300035398 Bacteria 6940
163 Ga0316574_0023693 3300035398 Bacteria 3667
164 Ga0316574_0025775 3300035398 Bacteria 3531
165 Ga0316574_0039672 3300035398 Bacteria 2897
166 Ga0310110_006000 3300036535 Eukaryota 1761
167 Ga0316582_0058043 3300036647 Bacteria 2474
168 Ga0316582_0204902 3300036647 Bacteria 1346
169 Ga0316584_0003487 3300036712 Bacteria 10239
170 Ga0316584_0044726 3300036712 Bacteria 3302
171 Ga0316584_0222324 3300036712 Bacteria 1387
172 Ga0395899_0001587 3300037312 Bacteria 19106
173 Ga0395900_0000010 3300037418 Bacteria 461364
174 Ga0395898_0009399 3300037466 Bacteria 10267
175 Ga0395905_0003647 3300037471 Bacteria 16330
176 Ga0395905_0030387 3300037471 Bacteria 5090
177 Ga0395905_0095974 3300037471 Bacteria 2783
178 Ga0395905_0259693 3300037471 Bacteria 1622
179 Ga0395905_0479023 3300037471 Bacteria 1144
180 Ga0395901_0000007 3300038443 Bacteria 497408
181 Ga0395901_0065627 3300038443 Bacteria 3780
182 Ga0395901_0299868 3300038443 Bacteria 1666
183 Ga0400483_004945 3300039062 Bacteria 2670
184 Ga0400483_019225 3300039062 Bacteria 19325
185 Ga0400483_032227 3300039062 Bacteria 1141
186 Ga0400483_102094 3300039062 Bacteria 15349
187 Ga0400483_118672 3300039062 Bacteria 9100
188 Ga0400483_126329 3300039062 Bacteria 26216
189 Ga0400483_174420 3300039062 Bacteria 1917
190 Ga0400483_181981 3300039062 Bacteria 4571
191 Ga0400483_184045 3300039062 Bacteria 18001
192 Ga0400483_197700 3300039062 Bacteria 3053
193 Ga0400483_218489 3300039062 Bacteria 26326
194 Ga0400483_242500 3300039062 Bacteria 4318
195 Ga0400483_278300 3300039062 Bacteria 7976
196 Ga0436361_0087676 3300039447 Bacteria 55960
197 Ga0436361_1168954 3300039447 Bacteria 2376
198 Ga0436363_0674109 3300039450 Bacteria 3483
199 Ga0451577_0019508 3300042876 Bacteria 6234
200 Ga0451577_0309033 3300042876 Bacteria 1433
201 Ga0453684_0226868 3300044712 Bacteria 2159
202 Ga0451576_0000458 3300045051 Bacteria 92512
203 Ga0451576_0015011 3300045051 Bacteria 8605
204 Ga0495627_000114 3300046453 Bacteria 100085
205 Ga0495627_000270 3300046453 Bacteria 52984
206 Ga0495638_0000021 3300046460 Bacteria 365602
207 Ga0495638_0053097 3300046460 Bacteria 2523
208 Ga0495638_0091515 3300046460 Bacteria 1832
209 Ga0495650_0000782 3300046471 Bacteria 39029
210 Ga0495583_0000332 3300046506 Bacteria 74708
211 Ga0495583_0008854 3300046506 Bacteria 6088
212 Ga0495606_0000273 3300046507 Bacteria 90641
213 Ga0495606_0037114 3300046507 Bacteria 3311
214 Ga0495610_0000052 3300046512 Bacteria 143261
215 Ga0495610_0001138 3300046512 Bacteria 24178
216 Ga0495620_0013848 3300046515 Bacteria 4118
217 Ga0495628_0132054 3300046516 Bacteria 1909
218 Ga0495630_0254351 3300046517 Bacteria 1342
219 Ga0495632_0000662 3300046519 Bacteria 31571
220 Ga0495632_0001683 3300046519 Bacteria 18097
221 Ga0495643_0009407 3300046522 Bacteria 6076
222 Ga0495648_0000026 3300046524 Bacteria 232162
223 Ga0495648_0000131 3300046524 Bacteria 88077
224 Ga0495648_0003680 3300046524 Bacteria 13398
225 Ga0495648_0005335 3300046524 Bacteria 10713
226 Ga0495654_0056022 3300046530 Bacteria 1907
227 Ga0495645_0049954 3300046543 Bacteria 3045
228 Ga0495645_0240507 3300046543 Bacteria 1208
229 Ga0495633_0013296 3300046558 Bacteria 4342
230 Ga0495668_0003078 3300046616 Bacteria 12905
231 Ga0495625_0002558 3300046660 Bacteria 19548
232 Ga0495670_0004786 3300046691 Bacteria 6648
233 Ga0495671_0000050 3300046692 Bacteria 141936
234 Ga0495649_0031398 3300046694 Bacteria 2929
235 Ga0495687_000041 3300047443 Bacteria 229171
236 Ga0495677_0000231 3300047445 Bacteria 25471
237 Ga0495673_0000125 3300047469 Bacteria 141937
238 Ga0495673_0000801 3300047469 Bacteria 29520
239 Ga0495681_0000012 3300047470 Bacteria 200275
240 Ga0495681_0013740 3300047470 Bacteria 4682
241 Ga0495686_0029556 3300047472 Bacteria 3564
242 Ga0495626_0001213 3300048091 Bacteria 21258
243 Ga0496102_0239837 3300048905 Bacteria 1710
244 Ga0496103_0001509 3300048906 Bacteria 15574
245 Ga0496114_0001345 3300048917 Bacteria 18621
246 Ga0496116_0000035 3300048919 Bacteria 402424
247 Ga0496117_0038672 3300048920 Bacteria 3533
248 Ga0496118_0044123 3300048921 Bacteria 3494
249 Ga0496121_0001542 3300048924 Bacteria 38556
250 Ga0496121_0003797 3300048924 Bacteria 21062
251 Ga0496121_0068650 3300048924 Bacteria 2866
252 Ga0496122_0003554 3300048925 Bacteria 20385
253 Ga0496123_0000159 3300048926 Bacteria 136014
254 Ga0496123_0010491 3300048926 Bacteria 8178
255 Ga0496123_0015684 3300048926 Bacteria 6200
256 Ga0496123_0034238 3300048926 Bacteria 3643
257 Ga0496124_0002527 3300048927 Bacteria 23742
258 Ga0496124_0002850 3300048927 Bacteria 21855
259 Ga0496124_0008543 3300048927 Bacteria 10691
260 Ga0496124_0010646 3300048927 Bacteria 9282
261 Ga0496124_0143164 3300048927 Bacteria 1884
262 Ga0496125_0008780 3300048928 Bacteria 10510
263 Ga0496125_0039723 3300048928 Bacteria 4047
264 Ga0496125_0095305 3300048928 Bacteria 2214
265 Ga0496126_0000077 3300048929 Bacteria 231592
266 Ga0501033_0000026 3300049570 Bacteria 169104
267 Ga0501080_0125913 3300049742 Bacteria 2373
268 Ga0501083_0006914 3300049744 Bacteria 8055
269 Ga0501280_001808 3300049776 Bacteria 3753
270 Ga0501035_0000208 3300049822 Bacteria 70678
271 nmdc:mga07m45_45395_c1 3300050496 Bacteria 2467
272 Ga0495601_0035362 3300053077 Bacteria 3118
273 Ga0495601_0075824 3300053077 Bacteria 2153
274 Ga0500643_002521 3300053087 Bacteria 9374
275 Ga0500643_011247 3300053087 Bacteria 3276
276 Ga0500641_0002052 3300053096 Bacteria 7154
277 Ga0500595_019356 3300053119 Bacteria 2471
278 Ga0500607_000035 3300053121 Bacteria 87430
279 Ga0500618_000066 3300053125 Bacteria 89937
280 Ga0500658_0000127 3300053134 Bacteria 35874
281 Ga0500658_0033037 3300053134 Bacteria 2032
282 Ga0500559_0000057 3300053136 Bacteria 88463
283 Ga0500559_0000254 3300053136 Bacteria 42378
284 Ga0500559_0008833 3300053136 Bacteria 4390
285 Ga0500622_0001753 3300053156 Bacteria 16708
286 Ga0500636_0085761 3300053177 Bacteria 1809
287 Ga0500637_0014048 3300053178 Bacteria 4213
288 Ga0500645_009124 3300053730 Bacteria 3346
289 Ga0501082_0074703 3300060353 Bacteria 2920
290 Ga0501082_0305354 3300060353 Bacteria 1386

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0674109 Ga0436363_0674109_20_937 305
2 3300046543 Ga0495645_0240507 Ga0495645_0240507_37_1032 305
3 3300039062 Ga0400483_004945 Ga0400483_004945_17_1000 324
4 3300003762 Ga0055542_1000020 Ga0055542_100002020 333
5 3300003763 Ga0055529_1000016 Ga0055529_1000016327 333
6 3300025254 Ga0209148_1000017 Ga0209148_1000017423 333
7 3300025272 Ga0209455_1000005 Ga0209455_1000005423 333
8 3300049776 Ga0501280_001808 Ga0501280_001808_1796_2875 339
9 3300037471 Ga0395905_0095974 Ga0395905_0095974_328_1401 340
10 3300005330 Ga0070690_100152236 Ga0070690_1001522362 341
11 3300005354 Ga0070675_100019880 Ga0070675_1000198803 341
12 3300005548 Ga0070665_100123622 Ga0070665_1001236223 341
13 3300025926 Ga0207659_10030377 Ga0207659_100303773 341
14 3300028379 Ga0268266_10235185 Ga0268266_102351852 341
15 3300031816 Ga0316042_106498 Ga0316042_1064982 341
16 3300031828 Ga0316043_106061 Ga0316043_1060612 341
17 3300005336 Ga0070680_100018331 Ga0070680_1000183314 342
18 3300005344 Ga0070661_100009470 Ga0070661_1000094704 342
19 3300005458 Ga0070681_10010199 Ga0070681_100101995 342
20 3300005539 Ga0068853_100020040 Ga0068853_1000200404 342
21 3300013104 Ga0157370_10011388 Ga0157370_100113884 342
22 3300013307 Ga0157372_10045061 Ga0157372_100450612 342
23 3300020077 Ga0206351_10567948 Ga0206351_105679482 342
24 3300025912 Ga0207707_10028285 Ga0207707_100282851 342
25 3300025917 Ga0207660_10013094 Ga0207660_100130944 342
26 3300025920 Ga0207649_10007662 Ga0207649_100076624 342
27 3300026041 Ga0207639_10012872 Ga0207639_100128724 342
28 3300036535 Ga0310110_006000 Ga0310110_006000_69_1160 342
29 3300005577 Ga0068857_100164906 Ga0068857_1001649061 343
30 iso_pu_bacteria 2513237351 2514589462 343
31 3300020078 Ga0206352_11362350 Ga0206352_113623502 344
32 3300020080 Ga0206350_11335671 Ga0206350_113356711 344
33 3300031507 Ga0307509_10003701 Ga0307509_100037016 344
34 3300035398 Ga0316574_0005171 Ga0316574_0005171_2297_3574 344
35 3300005339 Ga0070660_100076071 Ga0070660_1000760712 346
36 3300009093 Ga0105240_10030556 Ga0105240_100305562 346
37 3300025919 Ga0207657_10085551 Ga0207657_100855512 346
38 3300036712 Ga0316584_0222324 Ga0316584_0222324_19_1098 346
39 3300039062 Ga0400483_118672 Ga0400483_118672_3856_4917 346
40 3300039062 Ga0400483_181981 Ga0400483_181981_2061_3122 346
41 iso_pu_bacteria 2508501127 2509139809 346
42 iso_pu_bacteria 2856342000 2856347859 346
43 iso_pu_bacteria 2970524798 2970528007 346
44 3300039062 Ga0400483_019225 Ga0400483_019225_6007_7071 347
45 3300039062 Ga0400483_102094 Ga0400483_102094_6298_7362 347
46 3300039062 Ga0400483_174420 Ga0400483_174420_479_1543 347
47 3300039062 Ga0400483_184045 Ga0400483_184045_3892_4956 347
48 iso_pu_bacteria 2919679072 2919682972 347
49 3300003759 Ga0055525_1000012 Ga0055525_1000012236 348
50 3300013297 Ga0157378_10058352 Ga0157378_100583523 348
51 3300025230 Ga0209563_100030 Ga0209563_100030211 348
52 3300028794 Ga0307515_10000252 Ga0307515_1000025229 348
53 3300039062 Ga0400483_032227 Ga0400483_032227_27_1115 348
54 3300048926 Ga0496123_0010491 Ga0496123_0010491_2783_3844 348
55 3300048927 Ga0496124_0002850 Ga0496124_0002850_1517_2578 348
56 iso_pu_bacteria 2738541317 2738944718 348
57 iso_pu_bacteria 2913308742 2913309339 348
58 3300009545 Ga0105237_10048984 Ga0105237_100489844 349
59 3300013105 Ga0157369_10140112 Ga0157369_101401122 349
60 3300046460 Ga0495638_0000021 Ga0495638_0000021_113300_114349 349
61 3300046460 Ga0495638_0053097 Ga0495638_0053097_593_1642 349
62 3300046506 Ga0495583_0000332 Ga0495583_0000332_46036_47085 349
63 3300046506 Ga0495583_0008854 Ga0495583_0008854_3104_4153 349
64 3300046519 Ga0495632_0001683 Ga0495632_0001683_11970_13019 349
65 3300046524 Ga0495648_0000026 Ga0495648_0000026_113272_114321 349
66 3300046558 Ga0495633_0013296 Ga0495633_0013296_3099_4148 349
67 3300046616 Ga0495668_0003078 Ga0495668_0003078_10768_11817 349
68 3300046660 Ga0495625_0002558 Ga0495625_0002558_4905_5954 349
69 3300046691 Ga0495670_0004786 Ga0495670_0004786_3763_4812 349
70 3300046692 Ga0495671_0000050 Ga0495671_0000050_27642_28691 349
71 3300047445 Ga0495677_0000231 Ga0495677_0000231_19699_20748 349
72 3300047469 Ga0495673_0000125 Ga0495673_0000125_113247_114296 349
73 3300048926 Ga0496123_0015684 Ga0496123_0015684_5094_6158 349
74 3300048927 Ga0496124_0010646 Ga0496124_0010646_1498_2562 349
75 3300048927 Ga0496124_0143164 Ga0496124_0143164_538_1602 349
76 3300053087 Ga0500643_002521 Ga0500643_002521_2646_3695 349
77 3300053087 Ga0500643_011247 Ga0500643_011247_1622_2671 349
78 3300053136 Ga0500559_0008833 Ga0500559_0008833_807_1856 349
79 3300053156 Ga0500622_0001753 Ga0500622_0001753_5004_6068 349
80 3300060353 Ga0501082_0305354 Ga0501082_0305354_312_1361 349
81 iso_pu_bacteria 2643221654 2644301558 349
82 3300031995 Ga0307409_100145455 Ga0307409_1001454552 350
83 3300045051 Ga0451576_0000458 Ga0451576_0000458_25856_26962 350
84 3300005355 Ga0070671_100283581 Ga0070671_1002835811 351
85 3300031727 Ga0316576_10005570 Ga0316576_100055705 351
86 3300031727 Ga0316576_10040846 Ga0316576_100408461 351
87 3300031727 Ga0316576_10093162 Ga0316576_100931621 351
88 3300031728 Ga0316578_10046954 Ga0316578_100469542 351
89 3300031733 Ga0316577_10000841 Ga0316577_100008412 351
90 3300035398 Ga0316574_0023693 Ga0316574_0023693_146_1282 351
91 3300036712 Ga0316584_0003487 Ga0316584_0003487_88_1173 351
92 3300037471 Ga0395905_0003647 Ga0395905_0003647_5762_6874 351
93 3300005333 Ga0070677_10052374 Ga0070677_100523742 352
94 3300005548 Ga0070665_100228270 Ga0070665_1002282702 352
95 3300005616 Ga0068852_100118226 Ga0068852_1001182262 352
96 3300005719 Ga0068861_100178652 Ga0068861_1001786522 352
97 3300005834 Ga0068851_10023196 Ga0068851_100231963 352
98 3300010375 Ga0105239_10036572 Ga0105239_100365723 352
99 3300025230 Ga0209563_103698 Ga0209563_1036983 352
100 3300025901 Ga0207688_10017622 Ga0207688_100176223 352
101 3300025907 Ga0207645_10091747 Ga0207645_100917472 352
102 3300025940 Ga0207691_10008856 Ga0207691_100088564 352
103 3300026118 Ga0207675_100012715 Ga0207675_1000127154 352
104 3300026121 Ga0207683_10046336 Ga0207683_100463364 352
105 3300039062 Ga0400483_197700 Ga0400483_197700_1583_2650 352
106 3300039062 Ga0400483_242500 Ga0400483_242500_1770_2837 352
107 3300047469 Ga0495673_0000801 Ga0495673_0000801_18615_19673 352
108 3300049570 Ga0501033_0000026 Ga0501033_0000026_116718_117833 352
109 3300049742 Ga0501080_0125913 Ga0501080_0125913_696_1841 352
110 3300049744 Ga0501083_0006914 Ga0501083_0006914_6543_7688 352
111 3300049822 Ga0501035_0000208 Ga0501035_0000208_22423_23538 352
112 3300003479 Ga0006556J51387_1022988 Ga0006556J51387_10229881 353
113 3300003556 Ga0006557J51388_1010972 Ga0006557J51388_10109721 353
114 3300003558 Ga0006558J51389_1011525 Ga0006558J51389_10115251 353
115 3300003560 Ga0006559J51393_1030344 Ga0006559J51393_10303441 353
116 3300003561 Ga0006553J51392_1011784 Ga0006553J51392_10117841 353
117 3300003564 Ga0006555J51386_1014142 Ga0006555J51386_10141421 353
118 3300003565 Ga0006560J51390_1018661 Ga0006560J51390_10186611 353
119 3300003567 Ga0006554J51385_1013439 Ga0006554J51385_10134391 353
120 3300028800 Ga0265338_10006775 Ga0265338_1000677510 353
121 3300031241 Ga0265325_10003717 Ga0265325_100037176 353
122 3300031249 Ga0265339_10001916 Ga0265339_100019164 353
123 3300031595 Ga0265313_10001016 Ga0265313_100010164 353
124 3300031711 Ga0265314_10021995 Ga0265314_100219952 353
125 3300031903 Ga0307407_10001965 Ga0307407_100019656 353
126 3300042876 Ga0451577_0019508 Ga0451577_0019508_227_1339 353
127 3300044712 Ga0453684_0226868 Ga0453684_0226868_958_2082 353
128 3300045051 Ga0451576_0015011 Ga0451576_0015011_7020_8144 353
129 3300003791 Ga0055530_10000027 Ga0055530_1000002771 354
130 3300003794 Ga0055531_10000013 Ga0055531_1000001392 354
131 3300005436 Ga0070713_100000313 Ga0070713_10000031315 354
132 3300025298 Ga0209050_1000014 Ga0209050_100001471 354
133 3300025304 Ga0209257_1000019 Ga0209257_1000019621 354
134 3300025928 Ga0207700_10000161 Ga0207700_1000016124 354
135 3300031507 Ga0307509_10056748 Ga0307509_100567483 354
136 3300048906 Ga0496103_0001509 Ga0496103_0001509_4707_5771 354
137 3300048920 Ga0496117_0038672 Ga0496117_0038672_2122_3186 354
138 3300048921 Ga0496118_0044123 Ga0496118_0044123_1900_2964 354
139 3300048924 Ga0496121_0003797 Ga0496121_0003797_4822_5886 354
140 3300048924 Ga0496121_0068650 Ga0496121_0068650_229_1293 354
141 3300048926 Ga0496123_0034238 Ga0496123_0034238_2198_3262 354
142 3300048928 Ga0496125_0039723 Ga0496125_0039723_621_1685 354
143 3300053077 Ga0495601_0035362 Ga0495601_0035362_167_1279 354
144 3300003775 Ga0055524_1000109 Ga0055524_10001098 355
145 3300005844 Ga0068862_100014302 Ga0068862_1000143024 355
146 3300006946 Ga0079104_1000001 Ga0079104_1000001118 355
147 3300025291 Ga0209675_1013771 Ga0209675_10137712 355
148 3300025298 Ga0209050_1003055 Ga0209050_100305511 355
149 3300025299 Ga0209256_1000015 Ga0209256_1000015308 355
150 3300027111 Ga0209281_1000057 Ga0209281_1000057198 355
151 3300035398 Ga0316574_0003163 Ga0316574_0003163_5879_6979 355
152 3300048917 Ga0496114_0001345 Ga0496114_0001345_16851_17969 355
153 3300039062 Ga0400483_126329 Ga0400483_126329_21581_22816 356
154 3300039062 Ga0400483_218489 Ga0400483_218489_18575_19810 356
155 3300060353 Ga0501082_0074703 Ga0501082_0074703_893_1999 356
156 iso_pu_bacteria 2851153111 2851154353 356
157 3300028800 Ga0265338_10011130 Ga0265338_100111303 357
158 3300030733 Ga0314311_1062757 Ga0314311_10627573 357
159 3300047470 Ga0495681_0013740 Ga0495681_0013740_2291_3376 357
160 3300047472 Ga0495686_0029556 Ga0495686_0029556_387_1466 357
161 3300053096 Ga0500641_0002052 Ga0500641_0002052_672_1754 357
162 3300053134 Ga0500658_0000127 Ga0500658_0000127_33964_35049 357
163 3300053134 Ga0500658_0033037 Ga0500658_0033037_172_1308 357
164 iso_pu_bacteria 2738541275 2738710347 357
165 iso_pu_bacteria 2738541301 2738848772 357
166 iso_pu_bacteria 2738541304 2738864501 357
167 iso_pu_bacteria 2738543022 2739297019 357
168 iso_pu_bacteria 2738543033 2739358697 357
169 iso_pu_bacteria 2818991438 2819552203 357
170 iso_pu_bacteria 2928100450 2928101993 357
171 iso_pu_bacteria 2928959182 2928962090 357
172 3300021361 Ga0213872_10007390 Ga0213872_100073905 358
173 3300031251 Ga0265327_10002489 Ga0265327_100024894 358
174 3300031251 Ga0265327_10005291 Ga0265327_100052916 358
175 3300033180 Ga0307510_10001188 Ga0307510_100011884 358
176 3300039062 Ga0400483_278300 Ga0400483_278300_2329_3516 358
177 3300039447 Ga0436361_1168954 Ga0436361_1168954_1118_2194 358
178 3300042876 Ga0451577_0309033 Ga0451577_0309033_156_1241 358
179 3300046507 Ga0495606_0000273 Ga0495606_0000273_77705_78805 358
180 3300046522 Ga0495643_0009407 Ga0495643_0009407_3972_5072 358
181 3300046524 Ga0495648_0000131 Ga0495648_0000131_43093_44193 358
182 3300046694 Ga0495649_0031398 Ga0495649_0031398_1772_2911 358
183 3300047443 Ga0495687_000041 Ga0495687_000041_75172_76311 358
184 3300050496 nmdc:mga07m45_45395_c1 nmdc:mga07m45_45395_c1_630_1709 358
185 3300053121 Ga0500607_000035 Ga0500607_000035_48415_49494 358
186 3300053136 Ga0500559_0000254 Ga0500559_0000254_37545_38624 358
187 3300053177 Ga0500636_0085761 Ga0500636_0085761_295_1371 358
188 3300053178 Ga0500637_0014048 Ga0500637_0014048_2724_3803 358
189 3300053730 Ga0500645_009124 Ga0500645_009124_755_1834 358
190 iso_pu_bacteria 2599185359 2600227652 358
191 iso_pu_bacteria 2818991466 2819715020 358
192 iso_pu_bacteria 2879163058 2879166248 358
193 iso_pu_bacteria 2928526807 2928529486 358
194 iso_pu_bacteria 2928968154 2928972213 358
195 iso_pu_bacteria 2984564862 2984566974 358
196 3300005366 Ga0070659_100000835 Ga0070659_1000008354 359
197 3300046453 Ga0495627_000270 Ga0495627_000270_33930_35012 359
198 3300046471 Ga0495650_0000782 Ga0495650_0000782_11849_12931 359
199 3300046512 Ga0495610_0000052 Ga0495610_0000052_74116_75198 359
200 3300046515 Ga0495620_0013848 Ga0495620_0013848_949_2031 359
201 3300046519 Ga0495632_0000662 Ga0495632_0000662_22841_23923 359
202 3300046530 Ga0495654_0056022 Ga0495654_0056022_700_1782 359
203 3300047470 Ga0495681_0000012 Ga0495681_0000012_135446_136528 359
204 3300003771 Ga0055526_1000338 Ga0055526_10003387 360
205 3300005262 Ga0065165_1002325 Ga0065165_10023258 360
206 3300005327 Ga0070658_10149450 Ga0070658_101494502 360
207 3300025295 Ga0209564_1000750 Ga0209564_100075010 360
208 3300031090 Ga0265760_10053274 Ga0265760_100532741 360
209 3300038443 Ga0395901_0299868 Ga0395901_0299868_299_1384 360
210 3300025298 Ga0209050_1000127 Ga0209050_100012724 361
211 3300031733 Ga0316577_10111868 Ga0316577_101118682 361
212 3300035398 Ga0316574_0025775 Ga0316574_0025775_896_2032 361
213 3300036647 Ga0316582_0204902 Ga0316582_0204902_171_1307 361
214 3300036712 Ga0316584_0044726 Ga0316584_0044726_1778_2914 361
215 3300038443 Ga0395901_0065627 Ga0395901_0065627_2378_3472 361
216 3300046507 Ga0495606_0037114 Ga0495606_0037114_110_1198 361
217 3300046512 Ga0495610_0001138 Ga0495610_0001138_3055_4143 361
218 3300048091 Ga0495626_0001213 Ga0495626_0001213_4128_5216 361
219 3300048919 Ga0496116_0000035 Ga0496116_0000035_331841_332929 361
220 3300048924 Ga0496121_0001542 Ga0496121_0001542_33891_34979 361
221 3300048925 Ga0496122_0003554 Ga0496122_0003554_10176_11264 361
222 3300048926 Ga0496123_0000159 Ga0496123_0000159_103042_104130 361
223 3300048927 Ga0496124_0002527 Ga0496124_0002527_14289_15377 361
224 3300048927 Ga0496124_0008543 Ga0496124_0008543_5921_7009 361
225 3300048928 Ga0496125_0008780 Ga0496125_0008780_5257_6345 361
226 3300048929 Ga0496126_0000077 Ga0496126_0000077_114361_115449 361
227 3300003214 JGI25165J46597_1000203 JGI25165J46597_100020311 362
228 3300003791 Ga0055530_10000026 Ga0055530_1000002669 362
229 3300003794 Ga0055531_10004565 Ga0055531_100045655 362
230 3300004625 Ga0055543_1008200 Ga0055543_10082002 362
231 3300005262 Ga0065165_1001071 Ga0065165_10010716 362
232 3300005327 Ga0070658_10126414 Ga0070658_101264142 362
233 3300005331 Ga0070670_100008078 Ga0070670_1000080785 362
234 3300005336 Ga0070680_100005031 Ga0070680_1000050312 362
235 3300005347 Ga0070668_100126849 Ga0070668_1001268492 362
236 3300005353 Ga0070669_100001300 Ga0070669_1000013008 362
237 3300005355 Ga0070671_100000999 Ga0070671_10000099912 362
238 3300005366 Ga0070659_100028267 Ga0070659_1000282672 362
239 3300005367 Ga0070667_100017954 Ga0070667_1000179543 362
240 3300005458 Ga0070681_10004856 Ga0070681_1000485616 362
241 3300005539 Ga0068853_100050382 Ga0068853_1000503822 362
242 3300005548 Ga0070665_100000657 Ga0070665_1000006575 362
243 3300005548 Ga0070665_100000816 Ga0070665_10000081616 362
244 3300005563 Ga0068855_100035418 Ga0068855_1000354182 362
245 3300005564 Ga0070664_100214818 Ga0070664_1002148182 362
246 3300005578 Ga0068854_100001802 Ga0068854_1000018025 362
247 3300005578 Ga0068854_100007944 Ga0068854_1000079443 362
248 3300005841 Ga0068863_100003708 Ga0068863_1000037089 362
249 3300005842 Ga0068858_100011452 Ga0068858_1000114522 362
250 3300005843 Ga0068860_100005627 Ga0068860_1000056273 362
251 3300005844 Ga0068862_100010390 Ga0068862_1000103902 362
252 3300006028 Ga0070717_10046298 Ga0070717_100462983 362
253 3300009011 Ga0105251_10005641 Ga0105251_100056416 362
254 3300009093 Ga0105240_10100832 Ga0105240_101008322 362
255 3300009101 Ga0105247_10011753 Ga0105247_100117531 362
256 3300009177 Ga0105248_10000346 Ga0105248_1000034638 362
257 3300009177 Ga0105248_10044719 Ga0105248_100447192 362
258 3300017792 Ga0163161_10004517 Ga0163161_100045171 362
259 3300021361 Ga0213872_10010882 Ga0213872_100108821 362
260 3300025233 Ga0209437_104473 Ga0209437_1044732 362
261 3300025250 Ga0209026_1003284 Ga0209026_10032842 362
262 3300025254 Ga0209148_1004637 Ga0209148_10046372 362
263 3300025261 Ga0209233_1000066 Ga0209233_1000066273 362
264 3300025297 Ga0209758_1000261 Ga0209758_100026175 362
265 3300025298 Ga0209050_1000029 Ga0209050_1000029228 362
266 3300025299 Ga0209256_1010063 Ga0209256_10100634 362
267 3300025304 Ga0209257_1000152 Ga0209257_100015288 362
268 3300025735 Ga0207713_1001737 Ga0207713_10017372 362
269 3300025909 Ga0207705_10026258 Ga0207705_100262583 362
270 3300025912 Ga0207707_10009052 Ga0207707_100090522 362
271 3300025913 Ga0207695_10087784 Ga0207695_100877842 362
272 3300025914 Ga0207671_10192535 Ga0207671_101925352 362
273 3300025917 Ga0207660_10003761 Ga0207660_100037612 362
274 3300025919 Ga0207657_10000314 Ga0207657_1000031448 362
275 3300025921 Ga0207652_10007712 Ga0207652_100077125 362
276 3300025923 Ga0207681_10000843 Ga0207681_1000084315 362
277 3300025925 Ga0207650_10008948 Ga0207650_100089483 362
278 3300025931 Ga0207644_10016647 Ga0207644_100166475 362
279 3300025932 Ga0207690_10000132 Ga0207690_1000013226 362
280 3300025941 Ga0207711_10001878 Ga0207711_100018782 362
281 3300025941 Ga0207711_10053673 Ga0207711_100536734 362
282 3300025972 Ga0207668_10032825 Ga0207668_100328253 362
283 3300025981 Ga0207640_10003692 Ga0207640_100036923 362
284 3300026041 Ga0207639_10088917 Ga0207639_100889172 362
285 3300026088 Ga0207641_10002631 Ga0207641_100026313 362
286 3300028379 Ga0268266_10000003 Ga0268266_10000003512 362
287 3300028379 Ga0268266_10000387 Ga0268266_1000038740 362
288 3300028380 Ga0268265_10018192 Ga0268265_100181923 362
289 3300028381 Ga0268264_10002390 Ga0268264_1000239010 362
290 3300031251 Ga0265327_10000280 Ga0265327_1000028040 362
291 3300035398 Ga0316574_0039672 Ga0316574_0039672_1511_2662 362
292 3300036647 Ga0316582_0058043 Ga0316582_0058043_890_2041 362
293 3300037312 Ga0395899_0001587 Ga0395899_0001587_4219_5307 362
294 3300037418 Ga0395900_0000010 Ga0395900_0000010_250641_251729 362
295 3300037466 Ga0395898_0009399 Ga0395898_0009399_8761_9849 362
296 3300037471 Ga0395905_0030387 Ga0395905_0030387_3453_4541 362
297 3300037471 Ga0395905_0259693 Ga0395905_0259693_259_1359 362
298 3300037471 Ga0395905_0479023 Ga0395905_0479023_16_1116 362
299 3300038443 Ga0395901_0000007 Ga0395901_0000007_335003_336091 362
300 3300039447 Ga0436361_0087676 Ga0436361_0087676_52845_54014 362
301 3300046453 Ga0495627_000114 Ga0495627_000114_48966_50054 362
302 3300046460 Ga0495638_0091515 Ga0495638_0091515_552_1646 362
303 3300046516 Ga0495628_0132054 Ga0495628_0132054_419_1507 362
304 3300046517 Ga0495630_0254351 Ga0495630_0254351_112_1200 362
305 3300046524 Ga0495648_0003680 Ga0495648_0003680_3444_4532 362
306 3300046524 Ga0495648_0005335 Ga0495648_0005335_1787_2875 362
307 3300046543 Ga0495645_0049954 Ga0495645_0049954_59_1147 362
308 3300048905 Ga0496102_0239837 Ga0496102_0239837_478_1566 362
309 3300048928 Ga0496125_0095305 Ga0496125_0095305_732_1853 362
310 3300053077 Ga0495601_0075824 Ga0495601_0075824_112_1200 362
311 3300053119 Ga0500595_019356 Ga0500595_019356_63_1151 362
312 3300053125 Ga0500618_000066 Ga0500618_000066_68208_69302 362
313 3300053136 Ga0500559_0000057 Ga0500559_0000057_13962_15056 362

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

153

285

0.9

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

17

143

0.89

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

158

372

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8qc5-assembly1.cif.gz_B crystal structure of nad-dependent glycoside hydrolase from arthrobacter sp. u41 in complex with nad+ cofactor and citrate 0.9535 4 356
8qc2-assembly1.cif.gz_A crystal structure of nad-dependent glycoside hydrolase from flavobacterium sp. (strain k172) in complex with co-factor nad+ and sulfoquinovose (sq) 0.9525 3 356
8qc2-assembly1.cif.gz_A crystal structure of nad-dependent glycoside hydrolase from flavobacterium sp. (strain k172) in complex with co-factor nad+ and sulfoquinovose (sq) 0.9293 3 356
8qc5-assembly1.cif.gz_B crystal structure of nad-dependent glycoside hydrolase from arthrobacter sp. u41 in complex with nad+ cofactor and citrate 0.9276 4 356
8qc8-assembly2.cif.gz_D crystal structure of nad-dependent glycoside hydrolase from flavobacterium sp. (strain k172) in complex with co-factor nad+ 0.9264 4 356
ID Description Score Start End Superfamily
af_Q66GR2_140_367_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9466 130 359 3.30.360.10
af_Q66GR2_140_367_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9386 130 359 3.30.360.10
af_P39353_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9227 4 126 3.40.50.720
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.917 4 124 3.40.50.720
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9122 5 126 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A836RGM9-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9546 3 197 GO:0000166
AF-A0A6I3HPH6-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9526 65 362 GO:0000166
AF-A0A6I2X144-F1-model_v4 deleted 0.9483 1 331
AF-A0A7V6AK52-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9459 3 149 GO:0000166
AF-G5ZW16-F1-model_v4 Putative dehydrogenase 0.9371 3 356 GO:0000166

Feature Viewer

pLDDT pTM Quality
95.12 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map