F402425

General Info

Members Datasets Scaffolds Average Seq Length
313 228 626 317

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_32639_c1|nmdc:mga06z11_32639_c1_740_1777
Length 345
Sequence MKKSTCFITYSSCSLHAAWKIWKSRMSDIDRVVRSNLKLKHLQLIVALDEFRHLGRSAEFLSLTQPAVSKSLAEIERMFGLDLFVRSTRGTEPTAYGEKVARFARSVLADFDRTRDDIAMVASGGAGRIRVGAMVVATTSLLAGAVEQLKKQSPHTTVSVEEGDLTRLLPRLRVGELDFIVGRLEPGYAAPDLETEALYTEPMCVVVAPDHALARLRKPAWADLAVHPWVVPPAWASSRVKLNQVFYKHGLQPPPDIIETASFLVTLTFLRQRRCVGFVARDVARFLASERLARALPLEVPIELPPVGLIMLRGGLRTPAGARLVDAIRSVARRVSSAQPRPRAA

Samples

Sample ID Description Type Environment
1 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
54 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
84 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
89 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
90 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
91 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
92 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
93 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
94 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
95 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
108 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
111 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
112 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
113 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
114 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
115 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
119 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
120 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
121 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
122 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
123 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
124 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
127 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
130 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
131 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
161 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
174 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
175 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
185 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
186 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
187 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
188 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
189 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
190 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
191 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
192 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
193 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
194 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
195 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
198 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
199 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
200 2511231015 Pseudomonas sp. GM49 Isolate Nodule
201 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
202 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
203 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
204 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
205 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
206 2643221609 Acidovorax sp. Root217 Isolate Unclassified
207 2643221611 Acidovorax sp. Root219 Isolate Unclassified
208 2643221621 Achromobacter sp. Root83 Isolate Unclassified
209 2643221658 Variovorax sp. Root411 Isolate Unclassified
210 2643221672 Variovorax sp. Root434 Isolate Unclassified
211 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
212 2831864461 Roseateles noduli HZ7 Isolate Nodule
213 2842677519 Variovorax sp. R-72495 Isolate Unclassified
214 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
215 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
216 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
217 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
218 2904456579 Variovorax sp. 2002 Isolate Unclassified
219 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
220 2928070936 Variovorax gossypii 1167 Isolate Unclassified
221 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
222 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
223 2929520902 Variovorax beijingensis 502 Isolate Unclassified
224 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
225 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
226 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
227 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
228 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.42
Metatranscriptomes 0.32
Isolates 9.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.07
Nodule 1.6
Rhizoplane 1.92
Rhizosphere 53.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06z11_32639_c1 3300050494 Bacteria 2541
2 JGI25151J46595_10003335 3300003187 Bacteria 8899
3 rootH1_10039828 3300003316 Bacteria 3338
4 rootH2_10017886 3300003320 Bacteria 6964
5 rootL2_10000180 3300003322 Bacteria 87226
6 rootH1_10019495 3300003323 Bacteria 26145
7 Ga0006562J51391_1139586 3300003578 Bacteria 3680
8 Ga0055525_1000036 3300003759 Bacteria 298878
9 Ga0055529_1000806 3300003763 Bacteria 19128
10 Ga0055526_1011324 3300003771 Bacteria 4033
11 Ga0055524_1000123 3300003775 Bacteria 90603
12 Ga0055540_1001224 3300003792 Bacteria 15781
13 Ga0055531_10001112 3300003794 Bacteria 20889
14 Ga0055531_10006039 3300003794 Bacteria 6945
15 Ga0055543_1002841 3300004625 Bacteria 5460
16 Ga0065165_1000476 3300005262 Bacteria 62550
17 Ga0065714_10106115 3300005288 Bacteria 1555
18 Ga0070676_10059572 3300005328 Bacteria 2265
19 Ga0070675_100091157 3300005354 Bacteria 2553
20 Ga0070674_100064424 3300005356 Bacteria 2568
21 Ga0070678_100046111 3300005456 Bacteria 3123
22 Ga0070662_100022761 3300005457 Bacteria 4295
23 Ga0070706_100002762 3300005467 Bacteria 17556
24 Ga0070699_100089246 3300005518 Bacteria 2693
25 Ga0070672_100057426 3300005543 Bacteria 3055
26 Ga0070672_100075397 3300005543 Bacteria 2693
27 Ga0070665_100018477 3300005548 Bacteria 6988
28 Ga0068857_100155474 3300005577 Bacteria 2073
29 Ga0068854_100024099 3300005578 Bacteria 4163
30 Ga0068862_100051232 3300005844 Bacteria 3530
31 Ga0081455_10097318 3300005937 Bacteria 2371
32 Ga0075365_10185220 3300006038 Bacteria 1456
33 Ga0075363_100078200 3300006048 Bacteria 1806
34 Ga0075364_10006140 3300006051 Bacteria 7030
35 Ga0075364_10032181 3300006051 Bacteria 3370
36 Ga0075364_10045109 3300006051 Bacteria 2869
37 Ga0075432_10000502 3300006058 Bacteria 11734
38 Ga0075362_10001104 3300006177 Bacteria 8380
39 Ga0075362_10024948 3300006177 Bacteria 2540
40 Ga0075367_10003811 3300006178 Bacteria 7268
41 Ga0075367_10012736 3300006178 Bacteria 4499
42 Ga0075369_10016716 3300006186 Bacteria 2964
43 Ga0075369_10022029 3300006186 Bacteria 2625
44 Ga0075369_10047027 3300006186 Bacteria 1860
45 Ga0075366_10016512 3300006195 Bacteria 4246
46 Ga0075366_10018002 3300006195 Bacteria 4076
47 Ga0075366_10039455 3300006195 Bacteria 2792
48 Ga0075366_10053983 3300006195 Bacteria 2387
49 Ga0075370_10007482 3300006353 Bacteria 5565
50 Ga0075370_10009595 3300006353 Bacteria 5033
51 Ga0075370_10015938 3300006353 Bacteria 4035
52 Ga0075370_10037926 3300006353 Bacteria 2711
53 Ga0075370_10048945 3300006353 Bacteria 2395
54 Ga0075370_10060946 3300006353 Bacteria 2150
55 Ga0075370_10109825 3300006353 Bacteria 1601
56 Ga0075429_100002378 3300006880 Bacteria 15843
57 Ga0099823_1000061 3300006944 Bacteria 52139
58 Ga0099826_10063652 3300006948 Bacteria 2382
59 Ga0105251_10004346 3300009011 Bacteria 9693
60 Ga0105244_10011395 3300009036 Bacteria 5335
61 Ga0105244_10023673 3300009036 Bacteria 3364
62 Ga0105245_10185815 3300009098 Bacteria 1988
63 Ga0114129_10080603 3300009147 Bacteria 4524
64 Ga0105243_10003512 3300009148 Bacteria 12663
65 Ga0105243_10069711 3300009148 Bacteria 2837
66 Ga0105237_10043943 3300009545 Bacteria 4499
67 Ga0105239_10022095 3300010375 Bacteria 7013
68 Ga0105246_10041734 3300011119 Bacteria 3103
69 Ga0105246_10335364 3300011119 Bacteria 1234
70 Ga0157319_1000004 3300012497 Bacteria 394735
71 Ga0157373_10005691 3300013100 Bacteria 9340
72 Ga0182008_10004020 3300014497 Bacteria 8686
73 Ga0183362_10002 3300015683 Bacteria 1432711
74 Ga0209674_104281 3300025226 Bacteria 2356
75 Ga0209563_100014 3300025230 Bacteria 940582
76 Ga0209129_1002051 3300025258 Bacteria 10387
77 Ga0209673_1002563 3300025273 Bacteria 12371
78 Ga0209675_1018517 3300025291 Bacteria 1947
79 Ga0209676_1001506 3300025292 Bacteria 21245
80 Ga0209676_1012330 3300025292 Bacteria 3369
81 Ga0209025_1000424 3300025294 Bacteria 83948
82 Ga0209564_1000021 3300025295 Bacteria 571316
83 Ga0209050_1001049 3300025298 Bacteria 34100
84 Ga0209050_1018184 3300025298 Bacteria 2745
85 Ga0209256_1000085 3300025299 Bacteria 219043
86 Ga0209256_1002081 3300025299 Bacteria 17580
87 Ga0209051_1000182 3300025303 Bacteria 113251
88 Ga0209051_1001201 3300025303 Bacteria 23394
89 Ga0209051_1004362 3300025303 Bacteria 8760
90 Ga0209257_1000351 3300025304 Bacteria 94766
91 Ga0209257_1000397 3300025304 Bacteria 85732
92 Ga0209257_1003108 3300025304 Bacteria 14868
93 Ga0207655_1000006 3300025728 Bacteria 861092
94 Ga0207713_1013791 3300025735 Bacteria 4236
95 Ga0207688_10043245 3300025901 Bacteria 2508
96 Ga0207645_10085381 3300025907 Bacteria 2027
97 Ga0207643_10140011 3300025908 Bacteria 1445
98 Ga0207684_10004381 3300025910 Bacteria 13322
99 Ga0207646_10212396 3300025922 Bacteria 1747
100 Ga0207681_10218524 3300025923 Bacteria 1473
101 Ga0207687_10071601 3300025927 Bacteria 2477
102 Ga0207706_10040136 3300025933 Bacteria 4148
103 Ga0207706_10145849 3300025933 Bacteria 2082
104 Ga0207709_10003266 3300025935 Bacteria 9727
105 Ga0207691_10396371 3300025940 Bacteria 1177
106 Ga0207651_10075050 3300025960 Bacteria 2411
107 Ga0207639_10053013 3300026041 Bacteria 3093
108 Ga0207648_10297321 3300026089 Bacteria 1447
109 Ga0207648_10354564 3300026089 Bacteria 1323
110 Ga0207683_10120810 3300026121 Bacteria 2351
111 Ga0207698_10098696 3300026142 Bacteria 2414
112 Ga0209389_1006837 3300027296 Bacteria 9970
113 Ga0209371_1013640 3300027312 Bacteria 2268
114 Ga0268266_10059901 3300028379 Bacteria 3280
115 Ga0307517_10000327 3300028786 Bacteria 82422
116 Ga0307517_10161609 3300028786 Bacteria 1501
117 Ga0307515_10000064 3300028794 Bacteria 245452
118 Ga0307515_10000150 3300028794 Bacteria 169644
119 Ga0307515_10011385 3300028794 Bacteria 16884
120 Ga0307515_10140104 3300028794 Bacteria 2600
121 Ga0268256_1015101 3300030500 Bacteria 2268
122 Ga0316177_1024664 3300030731 Bacteria 1246
123 Ga0314311_1173484 3300030733 Bacteria 2058
124 Ga0316179_1118416 3300030734 Bacteria 3161
125 Ga0316178_1082410 3300030735 Bacteria 3398
126 Ga0316180_1030939 3300030736 Bacteria 4444
127 Ga0316181_1049773 3300030744 Bacteria 1815
128 Ga0316182_1105450 3300030745 Bacteria 2750
129 Ga0316182_1254970 3300030745 Bacteria 4258
130 Ga0307513_10003109 3300031456 Bacteria 22657
131 Ga0307513_10273151 3300031456 Bacteria 1472
132 Ga0307509_10000795 3300031507 Bacteria 54146
133 Ga0307509_10002463 3300031507 Bacteria 29929
134 Ga0307509_10002617 3300031507 Bacteria 28807
135 Ga0307408_100007126 3300031548 Bacteria 7399
136 Ga0307408_100072505 3300031548 Bacteria 2550
137 Ga0307408_100274351 3300031548 Bacteria 1401
138 Ga0307508_10001110 3300031616 Bacteria 31159
139 Ga0307508_10009055 3300031616 Bacteria 9171
140 Ga0307514_10001710 3300031649 Bacteria 25203
141 Ga0307405_10005122 3300031731 Bacteria 6277
142 Ga0307405_10177208 3300031731 Bacteria 1527
143 Ga0307406_10001118 3300031901 Bacteria 14969
144 Ga0307412_10145265 3300031911 Bacteria 1742
145 Ga0307416_100061842 3300032002 Bacteria 3058
146 Ga0307416_100095733 3300032002 Bacteria 2565
147 Ga0307414_10153204 3300032004 Bacteria 1821
148 Ga0307411_10089064 3300032005 Bacteria 2148
149 Ga0307411_10121770 3300032005 Bacteria 1889
150 Ga0307411_10166256 3300032005 Bacteria 1659
151 Ga0307411_10204285 3300032005 Bacteria 1520
152 Ga0307507_10092780 3300033179 Bacteria 2575
153 Ga0307510_10003186 3300033180 Bacteria 19042
154 Ga0307510_10113887 3300033180 Bacteria 2435
155 Ga0395905_0000088 3300037471 Bacteria 152506
156 Ga0395905_0003111 3300037471 Bacteria 17907
157 Ga0395905_0174555 3300037471 Bacteria 2018
158 Ga0439436_0001856 3300041404 Bacteria 6241
159 Ga0439436_0011811 3300041404 Bacteria 2650
160 Ga0439439_0017000 3300041406 Bacteria 1785
161 Ga0439466_0006952 3300041411 Bacteria 4291
162 Ga0439466_0032701 3300041411 Bacteria 1771
163 Ga0439465_0002672 3300041413 Bacteria 5829
164 Ga0439431_0002113 3300041997 Bacteria 4386
165 Ga0439431_0016091 3300041997 Bacteria 1747
166 Ga0439433_0003537 3300041999 Bacteria 3356
167 Ga0439433_0030942 3300041999 Bacteria 1224
168 Ga0439445_0000110 3300042004 Bacteria 13718
169 Ga0439445_0006977 3300042004 Bacteria 2611
170 Ga0439432_015841 3300042006 Bacteria 2539
171 Ga0439432_051571 3300042006 Bacteria 1282
172 Ga0439449_0000377 3300042007 Bacteria 16423
173 Ga0439449_0008172 3300042007 Bacteria 3977
174 Ga0439452_003500 3300042010 Bacteria 5488
175 Ga0439452_009941 3300042010 Bacteria 2786
176 Ga0439454_000234 3300042011 Bacteria 3989
177 Ga0439455_0004137 3300042012 Bacteria 2851
178 Ga0439457_003218 3300042014 Bacteria 4486
179 Ga0439457_012787 3300042014 Bacteria 1889
180 Ga0450890_004992 3300042127 Bacteria 1716
181 Ga0450896_003904 3300042133 Bacteria 2004
182 Ga0439446_0017311 3300042156 Bacteria 2013
183 Ga0439446_0050696 3300042156 Bacteria 1239
184 Ga0450908_002694 3300042184 Bacteria 3466
185 Ga0439434_0012068 3300042435 Bacteria 2555
186 Ga0466963_0022900 3300044694 Bacteria 3961
187 Ga0466963_0072441 3300044694 Bacteria 2321
188 Ga0495617_001094 3300046452 Bacteria 12322
189 Ga0495627_009115 3300046453 Bacteria 3665
190 Ga0495590_0009634 3300046457 Bacteria 3663
191 Ga0495590_0070944 3300046457 Bacteria 1222
192 Ga0495629_0049899 3300046459 Bacteria 2933
193 Ga0495638_0100046 3300046460 Bacteria 1735
194 Ga0495638_0110782 3300046460 Bacteria 1631
195 Ga0495650_0001947 3300046471 Bacteria 18260
196 Ga0495605_0014375 3300046474 Bacteria 4338
197 Ga0495585_0000105 3300046492 Bacteria 89432
198 Ga0495583_0000354 3300046506 Bacteria 72235
199 Ga0495610_0012777 3300046512 Bacteria 5025
200 Ga0495616_0000266 3300046513 Bacteria 42286
201 Ga0495616_0008027 3300046513 Bacteria 6287
202 Ga0495620_0040864 3300046515 Bacteria 2038
203 Ga0495631_0000260 3300046518 Bacteria 36819
204 Ga0495632_0014851 3300046519 Bacteria 4390
205 Ga0495648_0004813 3300046524 Bacteria 11390
206 Ga0495648_0126641 3300046524 Bacteria 1364
207 Ga0495654_0015130 3300046530 Bacteria 4100
208 Ga0495598_0004446 3300046537 Bacteria 3036
209 Ga0495609_0000362 3300046538 Bacteria 39087
210 Ga0495621_0002039 3300046539 Bacteria 5336
211 Ga0495621_0014735 3300046539 Bacteria 2480
212 Ga0495597_0000481 3300046542 Bacteria 33500
213 Ga0495656_0000085 3300046615 Bacteria 41208
214 Ga0495656_0028791 3300046615 Bacteria 2230
215 Ga0495668_0059298 3300046616 Bacteria 2112
216 Ga0495625_0005297 3300046660 Bacteria 11830
217 Ga0495625_0043864 3300046660 Bacteria 3240
218 Ga0495588_0039214 3300046674 Bacteria 2412
219 Ga0495669_0011779 3300046684 Bacteria 3718
220 Ga0495670_0004698 3300046691 Bacteria 6703
221 Ga0495670_0029470 3300046691 Bacteria 2724
222 Ga0495671_0008730 3300046692 Bacteria 5690
223 Ga0495660_0000151 3300046810 Bacteria 74982
224 Ga0495672_0000671 3300047320 Bacteria 37991
225 Ga0495676_0012204 3300047321 Bacteria 7749
226 Ga0495687_007963 3300047443 Bacteria 6150
227 Ga0495677_0072423 3300047445 Bacteria 1285
228 Ga0495673_0003080 3300047469 Bacteria 11207
229 Ga0495593_0027221 3300047673 Bacteria 3148
230 Ga0495614_0006587 3300048089 Bacteria 5202
231 Ga0495626_0083458 3300048091 Bacteria 1415
232 Ga0496102_0004649 3300048905 Bacteria 11622
233 Ga0496117_0044489 3300048920 Bacteria 3216
234 Ga0496118_0056620 3300048921 Bacteria 2946
235 Ga0496121_0014575 3300048924 Bacteria 8327
236 Ga0496122_0047599 3300048925 Bacteria 3309
237 Ga0496122_0077561 3300048925 Bacteria 2332
238 Ga0496124_0010740 3300048927 Bacteria 9233
239 Ga0496125_0037869 3300048928 Bacteria 4187
240 Ga0496125_0056784 3300048928 Bacteria 3176
241 Ga0496126_0132971 3300048929 Bacteria 2148
242 Ga0495682_0009579 3300049460 Bacteria 3778
243 Ga0501225_0023223 3300049705 Bacteria 1710
244 Ga0501262_000162 3300049759 Bacteria 8223
245 nmdc:mga03683_23913_c1 3300050489 Bacteria 2385
246 nmdc:mga03683_84134_c1 3300050489 Bacteria 1378
247 nmdc:mga03n38_49545_c1 3300050490 Bacteria 1868
248 nmdc:mga00v17_15749_c1 3300050491 Bacteria 4250
249 nmdc:mga00v17_22555_c1 3300050491 Bacteria 3633
250 nmdc:mga00v17_4136_c1 3300050491 Bacteria 7510
251 nmdc:mga00v17_45878_c1 3300050491 Bacteria 2642
252 nmdc:mga00v17_90362_c1 3300050491 Bacteria 1922
253 nmdc:mga0k408_102100_c1 3300050493 Bacteria 1692
254 nmdc:mga0k408_12288_c1 3300050493 Bacteria 4678
255 nmdc:mga0k408_274_c1 3300050493 Bacteria 28068
256 nmdc:mga07m45_101320_c1 3300050496 Bacteria 1653
257 nmdc:mga07m45_143043_c1 3300050496 Bacteria 1386
258 nmdc:mga07m45_1832_c1 3300050496 Bacteria 9814
259 nmdc:mga07m45_2224_c1 3300050496 Bacteria 9065
260 nmdc:mga07m45_300_c1 3300050496 Bacteria 19984
261 nmdc:mga05p37_195020_c1 3300050507 Bacteria 2456
262 nmdc:mga05p37_418286_c1 3300050507 Bacteria 1560
263 nmdc:mga09592_15637_c1 3300050508 Bacteria 6200
264 nmdc:mga0sz30_53839_c1 3300050516 Bacteria 1710
265 Ga0500610_0031942 3300053079 Bacteria 2678
266 Ga0500578_0088224 3300053086 Bacteria 1970
267 Ga0500643_006679 3300053087 Bacteria 4778
268 Ga0500651_0001993 3300053093 Bacteria 10596
269 Ga0500571_009714 3300053110 Bacteria 5300
270 Ga0500593_000808 3300053117 Bacteria 11711
271 Ga0500593_000828 3300053117 Bacteria 11572
272 Ga0500593_001775 3300053117 Bacteria 7756
273 Ga0500597_006539 3300053120 Bacteria 3878
274 Ga0500607_008094 3300053121 Bacteria 6421
275 Ga0500626_064966 3300053128 Bacteria 1629
276 Ga0500655_001071 3300053133 Bacteria 5258
277 Ga0500658_0000934 3300053134 Bacteria 11917
278 Ga0500658_0001155 3300053134 Bacteria 10727
279 Ga0500564_010712 3300053138 Bacteria 4028
280 Ga0500568_0006801 3300053139 Bacteria 5697
281 Ga0500619_000221 3300053154 Bacteria 12972
282 Ga0500627_0017114 3300053158 Bacteria 2842
283 Ga0500634_0004247 3300053161 Bacteria 6586
284 Ga0500634_0028903 3300053161 Bacteria 3020
285 2511317856 2511231015 Bacteria 6598026
286 2599627574 2599185214 Bacteria 8209958
287 2599677827 2599185226 Bacteria 8233575
288 2599685300 2599185227 Bacteria 8246414
289 2599697051 2599185229 Bacteria 8216126
290 2599902504 2599185292 Bacteria 6290804
291 2644057144 2643221609 Bacteria 6756331
292 2644072032 2643221611 Bacteria 6820941
293 2644121202 2643221621 Bacteria 6212786
294 2644328130 2643221658 Bacteria 6064537
295 2644397184 2643221672 Bacteria 6322190
296 2671126696 2667528176 Bacteria 6724917
297 2831865269 2831864461 Bacteria 6502356
298 2842678512 2842677519 Bacteria 5615038
299 2842719758 2842718218 Bacteria 4560148
300 2885197344 2885192300 Bacteria 5882526
301 2886854292 2886848708 Bacteria 5632523
302 2904454976 2904449895 Bacteria 6927402
303 2904457333 2904456579 Bacteria 6819253
304 2919483738 2919481497 Bacteria 6907839
305 2928075175 2928070936 Bacteria 8062541
306 2928090771 2928084124 Bacteria 7159212
307 2928119067 2928115317 Bacteria 6477646
308 2929525228 2929520902 Bacteria 6765052
309 2945948646 2945945610 Bacteria 5951079
310 2945977862 2945972063 Bacteria 6086495
311 2954772844 2954767861 Bacteria 5535784
312 2974323833 2974320154 Bacteria 4571377
313 8056161896 8056161164 Bacteria 6106669
314 nmdc:mga06z11_32639_c1
315 JGI25151J46595_10003335
316 rootH1_10039828
317 rootH2_10017886
318 rootL2_10000180
319 rootH1_10019495
320 Ga0006562J51391_1139586
321 Ga0055525_1000036
322 Ga0055529_1000806
323 Ga0055526_1011324
324 Ga0055524_1000123
325 Ga0055540_1001224
326 Ga0055531_10001112
327 Ga0055531_10006039
328 Ga0055543_1002841
329 Ga0065165_1000476
330 Ga0065714_10106115
331 Ga0070676_10059572
332 Ga0070675_100091157
333 Ga0070674_100064424
334 Ga0070678_100046111
335 Ga0070662_100022761
336 Ga0070706_100002762
337 Ga0070699_100089246
338 Ga0070672_100057426
339 Ga0070672_100075397
340 Ga0070665_100018477
341 Ga0068857_100155474
342 Ga0068854_100024099
343 Ga0068862_100051232
344 Ga0081455_10097318
345 Ga0075365_10185220
346 Ga0075363_100078200
347 Ga0075364_10006140
348 Ga0075364_10032181
349 Ga0075364_10045109
350 Ga0075432_10000502
351 Ga0075362_10001104
352 Ga0075362_10024948
353 Ga0075367_10003811
354 Ga0075367_10012736
355 Ga0075369_10016716
356 Ga0075369_10022029
357 Ga0075369_10047027
358 Ga0075366_10016512
359 Ga0075366_10018002
360 Ga0075366_10039455
361 Ga0075366_10053983
362 Ga0075370_10007482
363 Ga0075370_10009595
364 Ga0075370_10015938
365 Ga0075370_10037926
366 Ga0075370_10048945
367 Ga0075370_10060946
368 Ga0075370_10109825
369 Ga0075429_100002378
370 Ga0099823_1000061
371 Ga0099826_10063652
372 Ga0105251_10004346
373 Ga0105244_10011395
374 Ga0105244_10023673
375 Ga0105245_10185815
376 Ga0114129_10080603
377 Ga0105243_10003512
378 Ga0105243_10069711
379 Ga0105237_10043943
380 Ga0105239_10022095
381 Ga0105246_10041734
382 Ga0105246_10335364
383 Ga0157319_1000004
384 Ga0157373_10005691
385 Ga0182008_10004020
386 Ga0183362_10002
387 Ga0209674_104281
388 Ga0209563_100014
389 Ga0209129_1002051
390 Ga0209673_1002563
391 Ga0209675_1018517
392 Ga0209676_1001506
393 Ga0209676_1012330
394 Ga0209025_1000424
395 Ga0209564_1000021
396 Ga0209050_1001049
397 Ga0209050_1018184
398 Ga0209256_1000085
399 Ga0209256_1002081
400 Ga0209051_1000182
401 Ga0209051_1001201
402 Ga0209051_1004362
403 Ga0209257_1000351
404 Ga0209257_1000397
405 Ga0209257_1003108
406 Ga0207655_1000006
407 Ga0207713_1013791
408 Ga0207688_10043245
409 Ga0207645_10085381
410 Ga0207643_10140011
411 Ga0207684_10004381
412 Ga0207646_10212396
413 Ga0207681_10218524
414 Ga0207687_10071601
415 Ga0207706_10040136
416 Ga0207706_10145849
417 Ga0207709_10003266
418 Ga0207691_10396371
419 Ga0207651_10075050
420 Ga0207639_10053013
421 Ga0207648_10297321
422 Ga0207648_10354564
423 Ga0207683_10120810
424 Ga0207698_10098696
425 Ga0209389_1006837
426 Ga0209371_1013640
427 Ga0268266_10059901
428 Ga0307517_10000327
429 Ga0307517_10161609
430 Ga0307515_10000064
431 Ga0307515_10000150
432 Ga0307515_10011385
433 Ga0307515_10140104
434 Ga0268256_1015101
435 Ga0316177_1024664
436 Ga0314311_1173484
437 Ga0316179_1118416
438 Ga0316178_1082410
439 Ga0316180_1030939
440 Ga0316181_1049773
441 Ga0316182_1105450
442 Ga0316182_1254970
443 Ga0307513_10003109
444 Ga0307513_10273151
445 Ga0307509_10000795
446 Ga0307509_10002463
447 Ga0307509_10002617
448 Ga0307408_100007126
449 Ga0307408_100072505
450 Ga0307408_100274351
451 Ga0307508_10001110
452 Ga0307508_10009055
453 Ga0307514_10001710
454 Ga0307405_10005122
455 Ga0307405_10177208
456 Ga0307406_10001118
457 Ga0307412_10145265
458 Ga0307416_100061842
459 Ga0307416_100095733
460 Ga0307414_10153204
461 Ga0307411_10089064
462 Ga0307411_10121770
463 Ga0307411_10166256
464 Ga0307411_10204285
465 Ga0307507_10092780
466 Ga0307510_10003186
467 Ga0307510_10113887
468 Ga0395905_0000088
469 Ga0395905_0003111
470 Ga0395905_0174555
471 Ga0439436_0001856
472 Ga0439436_0011811
473 Ga0439439_0017000
474 Ga0439466_0006952
475 Ga0439466_0032701
476 Ga0439465_0002672
477 Ga0439431_0002113
478 Ga0439431_0016091
479 Ga0439433_0003537
480 Ga0439433_0030942
481 Ga0439445_0000110
482 Ga0439445_0006977
483 Ga0439432_015841
484 Ga0439432_051571
485 Ga0439449_0000377
486 Ga0439449_0008172
487 Ga0439452_003500
488 Ga0439452_009941
489 Ga0439454_000234
490 Ga0439455_0004137
491 Ga0439457_003218
492 Ga0439457_012787
493 Ga0450890_004992
494 Ga0450896_003904
495 Ga0439446_0017311
496 Ga0439446_0050696
497 Ga0450908_002694
498 Ga0439434_0012068
499 Ga0466963_0022900
500 Ga0466963_0072441
501 Ga0495617_001094
502 Ga0495627_009115
503 Ga0495590_0009634
504 Ga0495590_0070944
505 Ga0495629_0049899
506 Ga0495638_0100046
507 Ga0495638_0110782
508 Ga0495650_0001947
509 Ga0495605_0014375
510 Ga0495585_0000105
511 Ga0495583_0000354
512 Ga0495610_0012777
513 Ga0495616_0000266
514 Ga0495616_0008027
515 Ga0495620_0040864
516 Ga0495631_0000260
517 Ga0495632_0014851
518 Ga0495648_0004813
519 Ga0495648_0126641
520 Ga0495654_0015130
521 Ga0495598_0004446
522 Ga0495609_0000362
523 Ga0495621_0002039
524 Ga0495621_0014735
525 Ga0495597_0000481
526 Ga0495656_0000085
527 Ga0495656_0028791
528 Ga0495668_0059298
529 Ga0495625_0005297
530 Ga0495625_0043864
531 Ga0495588_0039214
532 Ga0495669_0011779
533 Ga0495670_0004698
534 Ga0495670_0029470
535 Ga0495671_0008730
536 Ga0495660_0000151
537 Ga0495672_0000671
538 Ga0495676_0012204
539 Ga0495687_007963
540 Ga0495677_0072423
541 Ga0495673_0003080
542 Ga0495593_0027221
543 Ga0495614_0006587
544 Ga0495626_0083458
545 Ga0496102_0004649
546 Ga0496117_0044489
547 Ga0496118_0056620
548 Ga0496121_0014575
549 Ga0496122_0047599
550 Ga0496122_0077561
551 Ga0496124_0010740
552 Ga0496125_0037869
553 Ga0496125_0056784
554 Ga0496126_0132971
555 Ga0495682_0009579
556 Ga0501225_0023223
557 Ga0501262_000162
558 nmdc:mga03683_23913_c1
559 nmdc:mga03683_84134_c1
560 nmdc:mga03n38_49545_c1
561 nmdc:mga00v17_15749_c1
562 nmdc:mga00v17_22555_c1
563 nmdc:mga00v17_4136_c1
564 nmdc:mga00v17_45878_c1
565 nmdc:mga00v17_90362_c1
566 nmdc:mga0k408_102100_c1
567 nmdc:mga0k408_12288_c1
568 nmdc:mga0k408_274_c1
569 nmdc:mga07m45_101320_c1
570 nmdc:mga07m45_143043_c1
571 nmdc:mga07m45_1832_c1
572 nmdc:mga07m45_2224_c1
573 nmdc:mga07m45_300_c1
574 nmdc:mga05p37_195020_c1
575 nmdc:mga05p37_418286_c1
576 nmdc:mga09592_15637_c1
577 nmdc:mga0sz30_53839_c1
578 Ga0500610_0031942
579 Ga0500578_0088224
580 Ga0500643_006679
581 Ga0500651_0001993
582 Ga0500571_009714
583 Ga0500593_000808
584 Ga0500593_000828
585 Ga0500593_001775
586 Ga0500597_006539
587 Ga0500607_008094
588 Ga0500626_064966
589 Ga0500655_001071
590 Ga0500658_0000934
591 Ga0500658_0001155
592 Ga0500564_010712
593 Ga0500568_0006801
594 Ga0500619_000221
595 Ga0500627_0017114
596 Ga0500634_0004247
597 Ga0500634_0028903
598 2511317856
599 2599627574
600 2599677827
601 2599685300
602 2599697051
603 2599902504
604 2644057144
605 2644072032
606 2644121202
607 2644328130
608 2644397184
609 2671126696
610 2831865269
611 2842678512
612 2842719758
613 2885197344
614 2886854292
615 2904454976
616 2904457333
617 2919483738
618 2928075175
619 2928090771
620 2928119067
621 2929525228
622 2945948646
623 2945977862
624 2954772844
625 2974323833
626 8056161896

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

39

98

0.98

PF03466

LysR_substrate

LysR substrate binding domain

122

333

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.8431 12 99
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.8418 12 99
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.8325 12 99
6l33-assembly2.cif.gz_C crystal structure of the regulatory domain of mext, a transcriptional activator in pseudomonas aeruginosa 0.8289 102 305
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.8272 12 96
ID Description Score Start End Superfamily
2fyiD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8888 101 173 3.40.190.10
3fxqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8738 103 175 3.40.190.10
2ql3D01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.87 101 173 3.40.190.10
1iz1B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8681 101 173 3.40.190.10
2f7cA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8674 103 174 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6N0X1J7-F1-model_v4 LysR family transcriptional regulator 0.9 101 307 GO:0005829
GO:0006355
AF-A0A0E1SFF0-F1-model_v4 deleted 0.8993 103 308
AF-A0A843YU20-F1-model_v4 LysR family transcriptional regulator 0.894 12 307 GO:0003700
GO:0005829
AF-A0A4Y9T0Q7-F1-model_v4 LysR family transcriptional regulator 0.8831 45 166 GO:0003700
GO:0005829
AF-A0A5E4TXH3-F1-model_v4 HTH-type transcriptional regulator GbpR 0.8781 10 307 GO:0003700
GO:0005829

Map