F403178

General Info

Members Datasets Scaffolds Average Seq Length
315 150 630 259

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10368407|Ga0157372_103684072
Length 294
Sequence MAIDLQSVCWNKEHFHRPNRTKLPTTRSNSPMPSTPLHAEEEISSLKERIAALGPWFHNIRLAGVQTAPDHFLGDYPQIKYKRFSDSLPQDLSGKTVLDIGCNGGFYSLEMKRRGADRVLGIDTDDHYLAQARFAAEVSQMDVEFRRMSVWEVGGLNERFDLIIFMGVFYHLRHPLLALDLIHEHVARDLLLFQSMQRGSREIAHVDPDYDFHAEVHFDDPGYPKMHFVEHRYSHDETNWWVPNRACVEAMLRSSGFAIESQPEDEVYICRSIPVEIPPDGPHCVYPARGRSNS

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
99 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
107 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
108 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
109 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
110 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
140 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
141 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
142 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
148 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
149 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
150 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.02
Metatranscriptomes 5.71
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0.32
Rhizoplane 7.3
Rhizosphere 84.76
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10368407 3300013307 Bacteria 1674
2 rootH2_10027561 3300003320 Bacteria 12840
3 rootL2_10123646 3300003322 Bacteria 2925
4 rootH1_10037731 3300003323 Bacteria 3409
5 rootH1_10109929 3300003323 Bacteria 2479
6 Ga0070658_10004165 3300005327 Bacteria 11840
7 Ga0070658_10008140 3300005327 Bacteria 8432
8 Ga0070658_10045108 3300005327 Bacteria 3563
9 Ga0070658_10054436 3300005327 Bacteria 3249
10 Ga0070658_10098883 3300005327 Bacteria 2410
11 Ga0070658_10170603 3300005327 Bacteria 1827
12 Ga0070683_100001653 3300005329 Bacteria 17279
13 Ga0070683_100004696 3300005329 Bacteria 11290
14 Ga0070683_100013006 3300005329 Bacteria 7245
15 Ga0070682_100236817 3300005337 Bacteria 1308
16 Ga0070660_100045348 3300005339 Bacteria 3365
17 Ga0070660_100112654 3300005339 Bacteria 2166
18 Ga0070660_100292130 3300005339 Bacteria 1335
19 Ga0070661_100005762 3300005344 Bacteria 8526
20 Ga0070661_100010015 3300005344 Bacteria 6579
21 Ga0070671_100078723 3300005355 Bacteria 2755
22 Ga0070659_100018994 3300005366 Bacteria 5197
23 Ga0070714_100065169 3300005435 Bacteria 3138
24 Ga0070714_100134362 3300005435 Bacteria 2213
25 Ga0070663_100012694 3300005455 Bacteria 5340
26 Ga0070681_10044178 3300005458 Bacteria 4459
27 Ga0070679_100021610 3300005530 Bacteria 6284
28 Ga0070679_100078483 3300005530 Bacteria 3290
29 Ga0070679_100322660 3300005530 Unclassified 1493
30 Ga0070684_100008163 3300005535 Bacteria 8174
31 Ga0068853_100000645 3300005539 Bacteria 23916
32 Ga0068853_100066507 3300005539 Unclassified 3130
33 Ga0070665_100087607 3300005548 Bacteria 3119
34 Ga0068855_100005800 3300005563 Bacteria 15070
35 Ga0068855_100006032 3300005563 Bacteria 14780
36 Ga0068855_100017111 3300005563 Bacteria 8721
37 Ga0068855_100018498 3300005563 Bacteria 8376
38 Ga0068855_100021972 3300005563 Bacteria 7650
39 Ga0068855_100060232 3300005563 Bacteria 4440
40 Ga0068855_100069438 3300005563 Bacteria 4100
41 Ga0068855_100125480 3300005563 Bacteria 2935
42 Ga0068857_100076739 3300005577 Bacteria 2980
43 Ga0068857_100195722 3300005577 Bacteria 1842
44 Ga0068854_100034282 3300005578 Bacteria 3545
45 Ga0068856_100002433 3300005614 Bacteria 19150
46 Ga0068856_100020304 3300005614 Bacteria 6453
47 Ga0068856_100029739 3300005614 Bacteria 5336
48 Ga0068856_100035204 3300005614 Bacteria 4906
49 Ga0068856_100123150 3300005614 Bacteria 2596
50 Ga0068856_100202220 3300005614 Bacteria 2001
51 Ga0068856_100525490 3300005614 Bacteria 1204
52 Ga0068852_100000027 3300005616 Bacteria 113819
53 Ga0068852_100001198 3300005616 Bacteria 17225
54 Ga0068852_100025823 3300005616 Unclassified 4765
55 Ga0068851_10006212 3300005834 Bacteria 5452
56 Ga0068851_10046798 3300005834 Bacteria 2189
57 Ga0070717_10069114 3300006028 Bacteria 2940
58 Ga0099823_1028728 3300006944 Bacteria 4756
59 Ga0105240_10000002 3300009093 Bacteria 1924170
60 Ga0105240_10000222 3300009093 Bacteria 113825
61 Ga0105240_10021105 3300009093 Bacteria 8670
62 Ga0105240_10024191 3300009093 Bacteria 8015
63 Ga0105240_10035763 3300009093 Bacteria 6397
64 Ga0105240_10048712 3300009093 Bacteria 5353
65 Ga0105240_10172488 3300009093 Bacteria 2560
66 Ga0105241_10000074 3300009174 Bacteria 75523
67 Ga0105241_10002755 3300009174 Bacteria 13168
68 Ga0105241_10002874 3300009174 Bacteria 12868
69 Ga0105237_10004817 3300009545 Bacteria 15502
70 Ga0105238_10000516 3300009551 Bacteria 40563
71 Ga0105238_10005260 3300009551 Bacteria 12797
72 Ga0105238_10012158 3300009551 Bacteria 8674
73 Ga0105238_10065900 3300009551 Bacteria 3623
74 Ga0105238_10100281 3300009551 Bacteria 2879
75 Ga0105238_10102973 3300009551 Bacteria 2836
76 Ga0105239_10034561 3300010375 Bacteria 5552
77 Ga0105239_10097928 3300010375 Bacteria 3242
78 Ga0105239_10349000 3300010375 Bacteria 1670
79 Ga0105239_10942250 3300010375 Unclassified 992
80 Ga0105246_10338912 3300011119 Bacteria 1228
81 Ga0157370_10001610 3300013104 Bacteria 27915
82 Ga0157370_10030278 3300013104 Bacteria 5304
83 Ga0157370_10144247 3300013104 Bacteria 2218
84 Ga0157370_10288022 3300013104 Bacteria 1517
85 Ga0157370_10288861 3300013104 Bacteria 1515
86 Ga0157369_10000112 3300013105 Bacteria 114309
87 Ga0157369_10004670 3300013105 Bacteria 16098
88 Ga0157369_10005663 3300013105 Bacteria 14513
89 Ga0157369_10032098 3300013105 Bacteria 5776
90 Ga0157369_10072665 3300013105 Bacteria 3692
91 Ga0157369_10074155 3300013105 Unclassified 3650
92 Ga0157369_10092307 3300013105 Bacteria 3231
93 Ga0157369_10153416 3300013105 Bacteria 2434
94 Ga0157369_10161090 3300013105 Bacteria 2368
95 Ga0157369_10209860 3300013105 Bacteria 2041
96 Ga0157369_10260979 3300013105 Bacteria 1807
97 Ga0157369_10321087 3300013105 Bacteria 1610
98 Ga0157369_10371063 3300013105 Bacteria 1485
99 Ga0157374_10110829 3300013296 Bacteria 2640
100 Ga0157374_10201947 3300013296 Unclassified 1947
101 Ga0157374_10503147 3300013296 Bacteria 1216
102 Ga0157374_10942817 3300013296 Bacteria 881
103 Ga0157372_10000422 3300013307 Bacteria 46497
104 Ga0157372_10001211 3300013307 Bacteria 27915
105 Ga0157372_10001505 3300013307 Bacteria 25337
106 Ga0157372_10013465 3300013307 Bacteria 8739
107 Ga0157372_10014790 3300013307 Bacteria 8353
108 Ga0157372_10020524 3300013307 Bacteria 7129
109 Ga0157372_10035598 3300013307 Bacteria 5482
110 Ga0157372_10094842 3300013307 Bacteria 3399
111 Ga0163163_10243469 3300014325 Bacteria 1848
112 Ga0197907_10276965 3300020069 Bacteria 2495
113 Ga0206356_11854622 3300020070 Bacteria 2243
114 Ga0206349_1579503 3300020075 Bacteria 1615
115 Ga0206351_10134588 3300020077 Bacteria 3473
116 Ga0206351_10158272 3300020077 Bacteria 3840
117 Ga0206351_10532110 3300020077 Bacteria 1113
118 Ga0206350_10481610 3300020080 Bacteria 1747
119 Ga0206350_11186952 3300020080 Bacteria 949
120 Ga0206350_11441557 3300020080 Bacteria 1213
121 Ga0206350_11490550 3300020080 Bacteria 4155
122 Ga0154015_1224164 3300020610 Bacteria 1052
123 Ga0154015_1510406 3300020610 Bacteria 4423
124 Ga0154015_1575426 3300020610 Bacteria 1549
125 Ga0213872_10000159 3300021361 Bacteria 61788
126 Ga0213872_10037354 3300021361 Bacteria 2217
127 Ga0213872_10048351 3300021361 Bacteria 1933
128 Ga0213874_10006927 3300021377 Bacteria 2700
129 Ga0213876_10001363 3300021384 Bacteria 15279
130 Ga0213876_10002881 3300021384 Bacteria 9990
131 Ga0213871_10003772 3300021441 Bacteria 2963
132 Ga0224712_10003361 3300022467 Bacteria 4146
133 Ga0224712_10033272 3300022467 Bacteria 1885
134 Ga0209677_100828 3300025253 Bacteria 15410
135 Ga0209455_1002604 3300025272 Bacteria 6861
136 Ga0207705_10016369 3300025909 Bacteria 5317
137 Ga0207705_10029850 3300025909 Unclassified 3887
138 Ga0207654_10000380 3300025911 Bacteria 25850
139 Ga0207654_10002712 3300025911 Bacteria 8987
140 Ga0207654_10114732 3300025911 Bacteria 1682
141 Ga0207707_10011452 3300025912 Bacteria 7724
142 Ga0207695_10000002 3300025913 Bacteria 2188391
143 Ga0207695_10000028 3300025913 Bacteria 551835
144 Ga0207695_10003411 3300025913 Bacteria 22444
145 Ga0207695_10006107 3300025913 Bacteria 15714
146 Ga0207695_10020709 3300025913 Bacteria 7525
147 Ga0207695_10053211 3300025913 Bacteria 4235
148 Ga0207695_10155020 3300025913 Unclassified 2226
149 Ga0207695_10618339 3300025913 Bacteria 964
150 Ga0207671_10003647 3300025914 Bacteria 15208
151 Ga0207660_10118600 3300025917 Bacteria 2002
152 Ga0207657_10010380 3300025919 Bacteria 9295
153 Ga0207657_10027138 3300025919 Bacteria 5249
154 Ga0207657_10224928 3300025919 Bacteria 1502
155 Ga0207649_10008237 3300025920 Bacteria 5678
156 Ga0207649_10099619 3300025920 Bacteria 1920
157 Ga0207649_10318469 3300025920 Bacteria 1142
158 Ga0207652_10006209 3300025921 Bacteria 9650
159 Ga0207694_10000160 3300025924 Bacteria 68770
160 Ga0207694_10003078 3300025924 Bacteria 13349
161 Ga0207694_10277280 3300025924 Bacteria 1376
162 Ga0207694_10506667 3300025924 Bacteria 1011
163 Ga0207664_10013192 3300025929 Bacteria 5920
164 Ga0207664_10065928 3300025929 Bacteria 2901
165 Ga0207664_10112994 3300025929 Bacteria 2261
166 Ga0207664_10129824 3300025929 Bacteria 2120
167 Ga0207664_10148409 3300025929 Bacteria 1990
168 Ga0207664_10179942 3300025929 Bacteria 1815
169 Ga0207664_10323935 3300025929 Bacteria 1360
170 Ga0207661_10002715 3300025944 Bacteria 12180
171 Ga0207661_10087320 3300025944 Bacteria 2590
172 Ga0207667_10000056 3300025949 Bacteria 206107
173 Ga0207667_10004966 3300025949 Bacteria 16249
174 Ga0207667_10034201 3300025949 Bacteria 5460
175 Ga0207667_10066880 3300025949 Bacteria 3745
176 Ga0207667_10078951 3300025949 Bacteria 3411
177 Ga0207667_10144585 3300025949 Bacteria 2448
178 Ga0207640_10018996 3300025981 Bacteria 4050
179 Ga0207639_10000145 3300026041 Bacteria 53212
180 Ga0207639_10009789 3300026041 Bacteria 6623
181 Ga0207639_10068772 3300026041 Bacteria 2760
182 Ga0207639_10084866 3300026041 Bacteria 2517
183 Ga0207678_10005705 3300026067 Bacteria 11113
184 Ga0207702_10016469 3300026078 Bacteria 6117
185 Ga0207702_10126598 3300026078 Bacteria 2294
186 Ga0207702_10133810 3300026078 Bacteria 2234
187 Ga0207702_10264079 3300026078 Bacteria 1622
188 Ga0207702_10313237 3300026078 Bacteria 1493
189 Ga0207702_10556737 3300026078 Bacteria 1122
190 Ga0207674_10006143 3300026116 Bacteria 14185
191 Ga0207674_10034456 3300026116 Bacteria 5292
192 Ga0207674_10157023 3300026116 Bacteria 2230
193 Ga0207674_10200589 3300026116 Bacteria 1944
194 Ga0207698_10000021 3300026142 Bacteria 133280
195 Ga0207698_10000738 3300026142 Bacteria 18978
196 Ga0207698_10081891 3300026142 Bacteria 2607
197 Ga0207698_10094295 3300026142 Bacteria 2460
198 Ga0268266_10066435 3300028379 Bacteria 3119
199 Ga0265339_10006604 3300031249 Bacteria 7591
200 Ga0307408_100098304 3300031548 Unclassified 2225
201 Ga0307405_10010522 3300031731 Bacteria 4801
202 Ga0307409_100118300 3300031995 Bacteria 2238
203 Ga0307409_100575509 3300031995 Bacteria 1109
204 Ga0307416_100260242 3300032002 Bacteria 1695
205 Ga0307414_10111363 3300032004 Bacteria 2085
206 Ga0395900_0348954 3300037418 Bacteria 1454
207 Ga0395898_0001253 3300037466 Bacteria 37794
208 Ga0395898_0046500 3300037466 Bacteria 4263
209 Ga0395898_0677545 3300037466 Bacteria 973
210 Ga0436364_0415739 3300037853 Bacteria 2197
211 Ga0436364_0584951 3300037853 Bacteria 1288
212 Ga0436364_0941071 3300037853 Bacteria 4320
213 Ga0436364_1403352 3300037853 Bacteria 2772
214 Ga0436364_1465313 3300037853 Bacteria 2066
215 Ga0395901_0000682 3300038443 Bacteria 38923
216 Ga0395901_0088912 3300038443 Bacteria 3232
217 Ga0395901_0818221 3300038443 Bacteria 919
218 Ga0436365_0320692 3300039437 Bacteria 2853
219 Ga0436365_0546549 3300039437 Bacteria 13799
220 Ga0436365_1793529 3300039437 Bacteria 27914
221 Ga0436360_0024264 3300039438 Bacteria 4072
222 Ga0436360_0066433 3300039438 Bacteria 1509
223 Ga0436360_0551360 3300039438 Bacteria 5805
224 Ga0436361_0265451 3300039447 Bacteria 1011
225 Ga0436361_0335407 3300039447 Bacteria 151349
226 Ga0436361_0449247 3300039447 Bacteria 2846
227 Ga0436361_0533731 3300039447 Bacteria 1298
228 Ga0436361_0619787 3300039447 Bacteria 4625
229 Ga0436361_0861100 3300039447 Bacteria 7498
230 Ga0436363_1530268 3300039450 Bacteria 33359
231 Ga0439431_0014934 3300041997 Bacteria 1804
232 Ga0466969_0161902 3300044656 Bacteria 1028
233 Ga0466966_0015657 3300044684 Bacteria 5014
234 Ga0466966_0282417 3300044684 Bacteria 998
235 Ga0466961_0040006 3300044693 Bacteria 3005
236 Ga0466961_0091914 3300044693 Bacteria 1916
237 Ga0466957_0110189 3300044842 Bacteria 1745
238 Ga0466959_0007015 3300045049 Bacteria 7875
239 Ga0466967_0004335 3300045976 Bacteria 9541
240 Ga0466967_0096954 3300045976 Bacteria 2691
241 Ga0466967_0109883 3300045976 Bacteria 2532
242 Ga0466967_0153675 3300045976 Bacteria 2153
243 Ga0495590_0000721 3300046457 Bacteria 15128
244 Ga0495638_0001239 3300046460 Bacteria 24050
245 Ga0495584_0005454 3300046491 Bacteria 6740
246 Ga0495585_0050800 3300046492 Bacteria 2299
247 Ga0495606_0001733 3300046507 Bacteria 28021
248 Ga0495610_0017689 3300046512 Bacteria 4057
249 Ga0495610_0025663 3300046512 Bacteria 3158
250 Ga0495620_0021742 3300046515 Bacteria 3108
251 Ga0495631_0035010 3300046518 Bacteria 2248
252 Ga0495632_0000379 3300046519 Bacteria 42470
253 Ga0495643_0001666 3300046522 Bacteria 19506
254 Ga0495648_0034342 3300046524 Bacteria 3301
255 Ga0495597_0044005 3300046542 Bacteria 1986
256 Ga0495668_0001340 3300046616 Bacteria 24198
257 Ga0495611_0055724 3300046648 Bacteria 1789
258 Ga0495625_0000382 3300046660 Bacteria 67633
259 Ga0495669_0136003 3300046684 Bacteria 1158
260 Ga0495649_0000693 3300046694 Bacteria 27497
261 Ga0495589_0063896 3300046794 Bacteria 1805
262 Ga0495683_0053035 3300047323 Bacteria 2023
263 Ga0495677_0034045 3300047445 Bacteria 1858
264 Ga0495686_0006188 3300047472 Bacteria 9245
265 Ga0496100_0001256 3300048903 Bacteria 12372
266 Ga0496101_0012155 3300048904 Bacteria 5738
267 Ga0496102_0019791 3300048905 Bacteria 5933
268 Ga0496103_0025348 3300048906 Bacteria 3584
269 Ga0496104_0006034 3300048907 Bacteria 10626
270 Ga0496104_0057750 3300048907 Bacteria 3672
271 Ga0496105_0162822 3300048908 Bacteria 1831
272 Ga0496106_0001479 3300048909 Bacteria 17653
273 Ga0496108_0004513 3300048911 Bacteria 11213
274 Ga0496108_0014345 3300048911 Bacteria 6469
275 Ga0496109_0008617 3300048912 Bacteria 8681
276 Ga0496109_0134709 3300048912 Bacteria 2307
277 Ga0496110_0000924 3300048913 Bacteria 20595
278 Ga0496110_0001281 3300048913 Bacteria 18012
279 Ga0496110_0184069 3300048913 Bacteria 1897
280 Ga0496110_0397100 3300048913 Bacteria 1257
281 Ga0496111_0015758 3300048914 Bacteria 5198
282 Ga0496111_0029260 3300048914 Bacteria 3911
283 Ga0496112_0004028 3300048915 Bacteria 12326
284 Ga0496112_0014305 3300048915 Bacteria 7352
285 Ga0496112_0115143 3300048915 Bacteria 2659
286 Ga0496113_0061388 3300048916 Bacteria 2836
287 Ga0496113_0062874 3300048916 Bacteria 2804
288 Ga0496118_0034733 3300048921 Bacteria 4108
289 Ga0496121_0063271 3300048924 Bacteria 3024
290 Ga0501034_0000320 3300049571 Bacteria 84295
291 Ga0501046_0059867 3300049580 Bacteria 2982
292 Ga0501047_0037140 3300049581 Bacteria 4710
293 Ga0501048_0152988 3300049582 Bacteria 1632
294 Ga0501068_0218300 3300049584 Bacteria 1212
295 Ga0501069_0018504 3300049585 Bacteria 3760
296 Ga0501070_0283409 3300049586 Bacteria 1351
297 Ga0501070_0477104 3300049586 Bacteria 1003
298 Ga0501071_0049777 3300049587 Bacteria 3017
299 Ga0501071_0217236 3300049587 Bacteria 1438
300 Ga0501074_0068995 3300049590 Bacteria 2542
301 Ga0501079_0266115 3300049741 Bacteria 1340
302 Ga0501035_0088996 3300049822 Bacteria 2720
303 Ga0501044_0000155 3300049823 Bacteria 84608
304 Ga0495655_0033284 3300053083 Bacteria 1267
305 Ga0500556_0000207 3300053104 Bacteria 48431
306 Ga0500658_0029177 3300053134 Bacteria 2144
307 Ga0590075_015318 3300059424 Bacteria 1881
308 Ga0587073_0001765 3300059492 Bacteria 2623
309 Ga0587082_015372 3300059504 Bacteria 1181
310 Ga0587072_030710 3300059643 Bacteria 1002
311 Ga0501082_0057377 3300060353 Bacteria 3355
312 2844535517 2844533157 Bacteria 7517899
313 2883579765 2883577096 Bacteria 4709178
314 2902405481 2902405164 Bacteria 6784948
315 2919456055 2919450847 Bacteria 5631160
316 Ga0157372_10368407
317 rootH2_10027561
318 rootL2_10123646
319 rootH1_10037731
320 rootH1_10109929
321 Ga0070658_10004165
322 Ga0070658_10008140
323 Ga0070658_10045108
324 Ga0070658_10054436
325 Ga0070658_10098883
326 Ga0070658_10170603
327 Ga0070683_100001653
328 Ga0070683_100004696
329 Ga0070683_100013006
330 Ga0070682_100236817
331 Ga0070660_100045348
332 Ga0070660_100112654
333 Ga0070660_100292130
334 Ga0070661_100005762
335 Ga0070661_100010015
336 Ga0070671_100078723
337 Ga0070659_100018994
338 Ga0070714_100065169
339 Ga0070714_100134362
340 Ga0070663_100012694
341 Ga0070681_10044178
342 Ga0070679_100021610
343 Ga0070679_100078483
344 Ga0070679_100322660
345 Ga0070684_100008163
346 Ga0068853_100000645
347 Ga0068853_100066507
348 Ga0070665_100087607
349 Ga0068855_100005800
350 Ga0068855_100006032
351 Ga0068855_100017111
352 Ga0068855_100018498
353 Ga0068855_100021972
354 Ga0068855_100060232
355 Ga0068855_100069438
356 Ga0068855_100125480
357 Ga0068857_100076739
358 Ga0068857_100195722
359 Ga0068854_100034282
360 Ga0068856_100002433
361 Ga0068856_100020304
362 Ga0068856_100029739
363 Ga0068856_100035204
364 Ga0068856_100123150
365 Ga0068856_100202220
366 Ga0068856_100525490
367 Ga0068852_100000027
368 Ga0068852_100001198
369 Ga0068852_100025823
370 Ga0068851_10006212
371 Ga0068851_10046798
372 Ga0070717_10069114
373 Ga0099823_1028728
374 Ga0105240_10000002
375 Ga0105240_10000222
376 Ga0105240_10021105
377 Ga0105240_10024191
378 Ga0105240_10035763
379 Ga0105240_10048712
380 Ga0105240_10172488
381 Ga0105241_10000074
382 Ga0105241_10002755
383 Ga0105241_10002874
384 Ga0105237_10004817
385 Ga0105238_10000516
386 Ga0105238_10005260
387 Ga0105238_10012158
388 Ga0105238_10065900
389 Ga0105238_10100281
390 Ga0105238_10102973
391 Ga0105239_10034561
392 Ga0105239_10097928
393 Ga0105239_10349000
394 Ga0105239_10942250
395 Ga0105246_10338912
396 Ga0157370_10001610
397 Ga0157370_10030278
398 Ga0157370_10144247
399 Ga0157370_10288022
400 Ga0157370_10288861
401 Ga0157369_10000112
402 Ga0157369_10004670
403 Ga0157369_10005663
404 Ga0157369_10032098
405 Ga0157369_10072665
406 Ga0157369_10074155
407 Ga0157369_10092307
408 Ga0157369_10153416
409 Ga0157369_10161090
410 Ga0157369_10209860
411 Ga0157369_10260979
412 Ga0157369_10321087
413 Ga0157369_10371063
414 Ga0157374_10110829
415 Ga0157374_10201947
416 Ga0157374_10503147
417 Ga0157374_10942817
418 Ga0157372_10000422
419 Ga0157372_10001211
420 Ga0157372_10001505
421 Ga0157372_10013465
422 Ga0157372_10014790
423 Ga0157372_10020524
424 Ga0157372_10035598
425 Ga0157372_10094842
426 Ga0163163_10243469
427 Ga0197907_10276965
428 Ga0206356_11854622
429 Ga0206349_1579503
430 Ga0206351_10134588
431 Ga0206351_10158272
432 Ga0206351_10532110
433 Ga0206350_10481610
434 Ga0206350_11186952
435 Ga0206350_11441557
436 Ga0206350_11490550
437 Ga0154015_1224164
438 Ga0154015_1510406
439 Ga0154015_1575426
440 Ga0213872_10000159
441 Ga0213872_10037354
442 Ga0213872_10048351
443 Ga0213874_10006927
444 Ga0213876_10001363
445 Ga0213876_10002881
446 Ga0213871_10003772
447 Ga0224712_10003361
448 Ga0224712_10033272
449 Ga0209677_100828
450 Ga0209455_1002604
451 Ga0207705_10016369
452 Ga0207705_10029850
453 Ga0207654_10000380
454 Ga0207654_10002712
455 Ga0207654_10114732
456 Ga0207707_10011452
457 Ga0207695_10000002
458 Ga0207695_10000028
459 Ga0207695_10003411
460 Ga0207695_10006107
461 Ga0207695_10020709
462 Ga0207695_10053211
463 Ga0207695_10155020
464 Ga0207695_10618339
465 Ga0207671_10003647
466 Ga0207660_10118600
467 Ga0207657_10010380
468 Ga0207657_10027138
469 Ga0207657_10224928
470 Ga0207649_10008237
471 Ga0207649_10099619
472 Ga0207649_10318469
473 Ga0207652_10006209
474 Ga0207694_10000160
475 Ga0207694_10003078
476 Ga0207694_10277280
477 Ga0207694_10506667
478 Ga0207664_10013192
479 Ga0207664_10065928
480 Ga0207664_10112994
481 Ga0207664_10129824
482 Ga0207664_10148409
483 Ga0207664_10179942
484 Ga0207664_10323935
485 Ga0207661_10002715
486 Ga0207661_10087320
487 Ga0207667_10000056
488 Ga0207667_10004966
489 Ga0207667_10034201
490 Ga0207667_10066880
491 Ga0207667_10078951
492 Ga0207667_10144585
493 Ga0207640_10018996
494 Ga0207639_10000145
495 Ga0207639_10009789
496 Ga0207639_10068772
497 Ga0207639_10084866
498 Ga0207678_10005705
499 Ga0207702_10016469
500 Ga0207702_10126598
501 Ga0207702_10133810
502 Ga0207702_10264079
503 Ga0207702_10313237
504 Ga0207702_10556737
505 Ga0207674_10006143
506 Ga0207674_10034456
507 Ga0207674_10157023
508 Ga0207674_10200589
509 Ga0207698_10000021
510 Ga0207698_10000738
511 Ga0207698_10081891
512 Ga0207698_10094295
513 Ga0268266_10066435
514 Ga0265339_10006604
515 Ga0307408_100098304
516 Ga0307405_10010522
517 Ga0307409_100118300
518 Ga0307409_100575509
519 Ga0307416_100260242
520 Ga0307414_10111363
521 Ga0395900_0348954
522 Ga0395898_0001253
523 Ga0395898_0046500
524 Ga0395898_0677545
525 Ga0436364_0415739
526 Ga0436364_0584951
527 Ga0436364_0941071
528 Ga0436364_1403352
529 Ga0436364_1465313
530 Ga0395901_0000682
531 Ga0395901_0088912
532 Ga0395901_0818221
533 Ga0436365_0320692
534 Ga0436365_0546549
535 Ga0436365_1793529
536 Ga0436360_0024264
537 Ga0436360_0066433
538 Ga0436360_0551360
539 Ga0436361_0265451
540 Ga0436361_0335407
541 Ga0436361_0449247
542 Ga0436361_0533731
543 Ga0436361_0619787
544 Ga0436361_0861100
545 Ga0436363_1530268
546 Ga0439431_0014934
547 Ga0466969_0161902
548 Ga0466966_0015657
549 Ga0466966_0282417
550 Ga0466961_0040006
551 Ga0466961_0091914
552 Ga0466957_0110189
553 Ga0466959_0007015
554 Ga0466967_0004335
555 Ga0466967_0096954
556 Ga0466967_0109883
557 Ga0466967_0153675
558 Ga0495590_0000721
559 Ga0495638_0001239
560 Ga0495584_0005454
561 Ga0495585_0050800
562 Ga0495606_0001733
563 Ga0495610_0017689
564 Ga0495610_0025663
565 Ga0495620_0021742
566 Ga0495631_0035010
567 Ga0495632_0000379
568 Ga0495643_0001666
569 Ga0495648_0034342
570 Ga0495597_0044005
571 Ga0495668_0001340
572 Ga0495611_0055724
573 Ga0495625_0000382
574 Ga0495669_0136003
575 Ga0495649_0000693
576 Ga0495589_0063896
577 Ga0495683_0053035
578 Ga0495677_0034045
579 Ga0495686_0006188
580 Ga0496100_0001256
581 Ga0496101_0012155
582 Ga0496102_0019791
583 Ga0496103_0025348
584 Ga0496104_0006034
585 Ga0496104_0057750
586 Ga0496105_0162822
587 Ga0496106_0001479
588 Ga0496108_0004513
589 Ga0496108_0014345
590 Ga0496109_0008617
591 Ga0496109_0134709
592 Ga0496110_0000924
593 Ga0496110_0001281
594 Ga0496110_0184069
595 Ga0496110_0397100
596 Ga0496111_0015758
597 Ga0496111_0029260
598 Ga0496112_0004028
599 Ga0496112_0014305
600 Ga0496112_0115143
601 Ga0496113_0061388
602 Ga0496113_0062874
603 Ga0496118_0034733
604 Ga0496121_0063271
605 Ga0501034_0000320
606 Ga0501046_0059867
607 Ga0501047_0037140
608 Ga0501048_0152988
609 Ga0501068_0218300
610 Ga0501069_0018504
611 Ga0501070_0283409
612 Ga0501070_0477104
613 Ga0501071_0049777
614 Ga0501071_0217236
615 Ga0501074_0068995
616 Ga0501079_0266115
617 Ga0501035_0088996
618 Ga0501044_0000155
619 Ga0495655_0033284
620 Ga0500556_0000207
621 Ga0500658_0029177
622 Ga0590075_015318
623 Ga0587073_0001765
624 Ga0587082_015372
625 Ga0587072_030710
626 Ga0501082_0057377
627 2844535517
628 2883579765
629 2902405481
630 2919456055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

98

193

0.93

PF13649

Methyltransf_25

Methyltransferase domain

97

189

0.9

PF13847

Methyltransf_31

Methyltransferase domain

91

213

0.87

PF08003

Methyltransf_9

Protein of unknown function (DUF1698)

7

208

0.82

PF13489

Methyltransf_23

Methyltransferase domain

71

262

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.8497 63 133
4kwc-assembly1.cif.gz_A structure of the plantazolicin methyltransferase bpuml in complex with sah 0.849 63 165
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.8482 61 133
5dnk-assembly1.cif.gz_B the structure of pkmt1 from rickettsia prowazekii in complex with adohcy 0.8344 59 163
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.8273 49 165
ID Description Score Start End Superfamily
af_Q8ILX8_228_372_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8955 60 114 3.40.50.150
af_I1JDM5_91_303_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8767 60 155 3.40.50.150
af_Q55C78_181_338_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8735 60 137 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8733 56 124 3.40.50.150
af_I6X9X6_5_255_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8587 49 155 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4Q2YU95-F1-model_v4 TIGR04290 family methyltransferase 0.9869 65 243 GO:0008168
GO:0032259
AF-A0A7W1SGT1-F1-model_v4 DUF1698 domain-containing protein 0.9693 12 106
AF-A0A7W0FNL2-F1-model_v4 TIGR04290 family methyltransferase 0.9682 8 243 GO:0008168
GO:0032259
AF-A0A1Q6XGG7-F1-model_v4 Methyltransferase, TIGR04290 family 0.9671 16 244 GO:0008168
GO:0032259
AF-A0A4Q3NU32-F1-model_v4 deleted 0.964 124 242

Map