F403246

General Info

Members Datasets Scaffolds Average Seq Length
315 249 263 331

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10005467|Ga0307407_100054673
Length 386
Sequence VAERALAEAAAPLLSVRNLRVEFPTRRGRLVAVHDVSFDIAAGEVLGVVGESGAGKSLTGAAIIGLIDPPGRIAGGEVHLDGRRIDQLPYEAMRRVRGREIGAIFQDPLTSLNPLYTIGRQLVETIRTHLDMNEAQARARAVALLEEVGIPAAARRVDQYPHQFSGGMRQRVVIALALAARPKLIIADEPTTALDVSIQAQIIQLLKRLCREHGTSVMLVTHDMGVIAETAHRVAVMYAGRIVEIGPVADVIHRAQHPYSIGLMGSIPSIAQDRDRLAQIDGTMPRLTSVPPGCPFHPRCPRAFVRCTRERPELIPAMASLAACWLHDPVARLEAHQRIAPAGASAEAAHAADTDHAGARGRDPFVTPDDVAGTGEAIDAPRGDTR

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
4 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
5 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
6 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
7 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
8 2643221626 Ensifer sp. Root31 Isolate Unclassified
9 2643221723 Ensifer sp. Root278 Isolate Unclassified
10 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
11 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
12 2858950400 Achromobacter sp. K91 Isolate Unclassified
13 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
14 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
15 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
16 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
17 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
18 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
19 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
20 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
21 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
22 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
23 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
24 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
25 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
26 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
27 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
28 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
29 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
30 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
31 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
32 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
33 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
34 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
35 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
36 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
37 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
38 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
39 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
40 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
41 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
42 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
43 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
44 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
45 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
46 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
49 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
50 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
147 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
162 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
235 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
236 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
242 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
243 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
244 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
245 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
246 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
247 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
248 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
249 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.86
Metatranscriptomes 0.63
Isolates 16.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.25
Nodule 13.33
Rhizoplane 2.22
Rhizosphere 69.84
Stem 0
Stem Tuber 0
Unclassified 6.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014321 3300001979 Bacteria 2928
2 JGI25156J39149_1001032 3300002705 Bacteria 12996
3 JGI25151J46595_10031803 3300003187 Bacteria 2055
4 JGI25153J46596_10000870 3300003215 Bacteria 18404
5 JGI25153J46596_10059184 3300003215 Bacteria 1050
6 Ga0055526_1000950 3300003771 Bacteria 21443
7 Ga0055524_1027513 3300003775 Bacteria 1723
8 Ga0055536_1007009 3300003781 Bacteria 5125
9 Ga0055531_10001642 3300003794 Bacteria 16179
10 Ga0055543_1001756 3300004625 Bacteria 8100
11 Ga0065165_1006796 3300005262 Bacteria 5844
12 Ga0070683_100091025 3300005329 Bacteria 2864
13 Ga0070670_100005250 3300005331 Bacteria 10910
14 Ga0070670_100023104 3300005331 Bacteria 5352
15 Ga0070670_100039475 3300005331 Bacteria 4059
16 Ga0070670_100097924 3300005331 Bacteria 2523
17 Ga0068869_100006765 3300005334 Bacteria 7287
18 Ga0070668_100001697 3300005347 Bacteria 15982
19 Ga0070668_100007090 3300005347 Bacteria 8303
20 Ga0070668_100024660 3300005347 Bacteria 4558
21 Ga0070669_100007523 3300005353 Bacteria 7801
22 Ga0070671_100051322 3300005355 Bacteria 3430
23 Ga0070674_100031037 3300005356 Bacteria 3537
24 Ga0070674_100110675 3300005356 Bacteria 2016
25 Ga0070673_100027633 3300005364 Bacteria 4208
26 Ga0070673_100029931 3300005364 Bacteria 4067
27 Ga0070688_100085528 3300005365 Bacteria 2050
28 Ga0070667_100012423 3300005367 Bacteria 7047
29 Ga0070667_100376490 3300005367 Bacteria 1289
30 Ga0070678_100180910 3300005456 Bacteria 1726
31 Ga0070662_100020661 3300005457 Bacteria 4489
32 Ga0068867_100036721 3300005459 Bacteria 3559
33 Ga0068867_100299064 3300005459 Bacteria 1326
34 Ga0070698_100069315 3300005471 Bacteria 3541
35 Ga0070697_100008976 3300005536 Bacteria 7813
36 Ga0070672_100002453 3300005543 Bacteria 11773
37 Ga0070672_100039031 3300005543 Bacteria 3634
38 Ga0070672_100136855 3300005543 Bacteria 2018
39 Ga0070672_100195793 3300005543 Bacteria 1689
40 Ga0070672_100212780 3300005543 Bacteria 1619
41 Ga0070686_100349063 3300005544 Bacteria 1111
42 Ga0070695_100010690 3300005545 Bacteria 5484
43 Ga0070665_100003283 3300005548 Bacteria 17362
44 Ga0070665_100025418 3300005548 Bacteria 5968
45 Ga0070665_100129684 3300005548 Bacteria 2524
46 Ga0070704_100004664 3300005549 Bacteria 7931
47 Ga0068855_100115080 3300005563 Bacteria 3083
48 Ga0068856_100194876 3300005614 Bacteria 2040
49 Ga0068859_100002711 3300005617 Bacteria 17963
50 Ga0068864_100001221 3300005618 Bacteria 21344
51 Ga0068861_100000947 3300005719 Bacteria 17633
52 Ga0068870_10049295 3300005840 Bacteria 2221
53 Ga0068863_100005462 3300005841 Bacteria 12517
54 Ga0068863_100041085 3300005841 Bacteria 4396
55 Ga0068863_100105124 3300005841 Bacteria 2686
56 Ga0068858_100001698 3300005842 Bacteria 22498
57 Ga0068858_100268954 3300005842 Bacteria 1621
58 Ga0068860_100007624 3300005843 Bacteria 10830
59 Ga0068860_100121735 3300005843 Bacteria 2499
60 Ga0068860_100164800 3300005843 Bacteria 2139
61 Ga0068862_100034597 3300005844 Bacteria 4276
62 Ga0068862_100190190 3300005844 Bacteria 1846
63 Ga0081538_10015651 3300005981 Bacteria 5860
64 Ga0075364_10015268 3300006051 Bacteria 4761
65 Ga0075369_10020142 3300006186 Bacteria 2731
66 Ga0075428_100076210 3300006844 Bacteria 3662
67 Ga0075431_100011241 3300006847 Bacteria 9016
68 Ga0075431_100032176 3300006847 Bacteria 5404
69 Ga0075434_100092631 3300006871 Bacteria 3025
70 Ga0075429_100000007 3300006880 Bacteria 90776
71 Ga0068865_100053695 3300006881 Bacteria 2796
72 Ga0097620_100002711 3300006931 Bacteria 17963
73 Ga0105240_10559459 3300009093 Bacteria 1264
74 Ga0111539_10292534 3300009094 Bacteria 1895
75 Ga0111539_10574916 3300009094 Bacteria 1312
76 Ga0105247_10014134 3300009101 Bacteria 4788
77 Ga0114129_10016509 3300009147 Bacteria 10514
78 Ga0114129_10470221 3300009147 Bacteria 1646
79 Ga0105242_10001842 3300009176 Bacteria 16643
80 Ga0105248_10083518 3300009177 Bacteria 3593
81 Ga0105248_10209041 3300009177 Bacteria 2199
82 Ga0163162_10185804 3300013306 Bacteria 2205
83 Ga0163163_10035683 3300014325 Bacteria 4825
84 Ga0157379_10003651 3300014968 Bacteria 13064
85 Ga0157376_10035554 3300014969 Bacteria 4030
86 Ga0163161_10014440 3300017792 Bacteria 5498
87 Ga0213875_10000968 3300021388 Bacteria 20539
88 Ga0209677_103337 3300025253 Bacteria 5282
89 Ga0209233_1006918 3300025261 Bacteria 3628
90 Ga0209676_1000049 3300025292 Bacteria 403210
91 Ga0209676_1001291 3300025292 Bacteria 25765
92 Ga0209025_1000337 3300025294 Bacteria 103480
93 Ga0209564_1000117 3300025295 Bacteria 207096
94 Ga0209050_1009352 3300025298 Bacteria 5030
95 Ga0209256_1000352 3300025299 Bacteria 74849
96 Ga0209051_1035541 3300025303 Bacteria 1852
97 Ga0209257_1001572 3300025304 Bacteria 26338
98 Ga0207643_10020693 3300025908 Bacteria 3612
99 Ga0207705_10074720 3300025909 Bacteria 2461
100 Ga0207681_10055615 3300025923 Bacteria 2696
101 Ga0207650_10080158 3300025925 Bacteria 2474
102 Ga0207650_10099117 3300025925 Bacteria 2239
103 Ga0207650_10174036 3300025925 Bacteria 1712
104 Ga0207644_10049532 3300025931 Bacteria 3008
105 Ga0207686_10002209 3300025934 Bacteria 10705
106 Ga0207709_10036924 3300025935 Bacteria 2899
107 Ga0207670_10110397 3300025936 Bacteria 1981
108 Ga0207691_10004737 3300025940 Bacteria 13155
109 Ga0207691_10072665 3300025940 Bacteria 3103
110 Ga0207691_10072686 3300025940 Bacteria 3102
111 Ga0207691_10128463 3300025940 Bacteria 2240
112 Ga0207691_10179765 3300025940 Bacteria 1849
113 Ga0207689_10000689 3300025942 Bacteria 32315
114 Ga0207667_10113480 3300025949 Bacteria 2794
115 Ga0207667_10313447 3300025949 Bacteria 1602
116 Ga0207651_10026174 3300025960 Bacteria 3639
117 Ga0207651_10207291 3300025960 Bacteria 1575
118 Ga0207668_10033910 3300025972 Bacteria 3385
119 Ga0207658_10194886 3300025986 Bacteria 1687
120 Ga0207677_10054919 3300026023 Bacteria 2721
121 Ga0207703_10005214 3300026035 Bacteria 10503
122 Ga0207703_10513972 3300026035 Bacteria 1126
123 Ga0207702_10169679 3300026078 Bacteria 2000
124 Ga0207641_10024811 3300026088 Bacteria 4942
125 Ga0207641_10044170 3300026088 Bacteria 3747
126 Ga0207641_10047643 3300026088 Bacteria 3615
127 Ga0207641_10047963 3300026088 Bacteria 3604
128 Ga0207641_10164405 3300026088 Bacteria 2020
129 Ga0207648_10037670 3300026089 Bacteria 4260
130 Ga0207676_10012853 3300026095 Bacteria 6012
131 Ga0207676_10025667 3300026095 Bacteria 4373
132 Ga0207675_100020226 3300026118 Bacteria 6205
133 Ga0207683_10085443 3300026121 Bacteria 2805
134 Ga0209371_1004646 3300027312 Bacteria 5854
135 Ga0268266_10033636 3300028379 Bacteria 4358
136 Ga0268266_10035240 3300028379 Bacteria 4257
137 Ga0268266_10196046 3300028379 Bacteria 1846
138 Ga0268265_10010373 3300028380 Bacteria 6293
139 Ga0268265_10187503 3300028380 Bacteria 1783
140 Ga0268264_10001909 3300028381 Bacteria 18834
141 Ga0265324_10001251 3300029957 Bacteria 15017
142 Ga0265770_1000469 3300030878 Bacteria 5560
143 Ga0265760_10001236 3300031090 Bacteria 7471
144 Ga0307408_100065005 3300031548 Bacteria 2674
145 Ga0307408_100291542 3300031548 Bacteria 1363
146 Ga0316579_10005398 3300031691 Bacteria 5155
147 Ga0265314_10067359 3300031711 Bacteria 2412
148 Ga0316578_10003809 3300031728 Bacteria 6986
149 Ga0316578_10062597 3300031728 Bacteria 2194
150 Ga0316577_10024128 3300031733 Bacteria 3380
151 Ga0307413_10000255 3300031824 Bacteria 16118
152 Ga0307413_10147891 3300031824 Bacteria 1633
153 Ga0307410_10002057 3300031852 Bacteria 9513
154 Ga0307410_10046226 3300031852 Bacteria 2903
155 Ga0307410_10263371 3300031852 Bacteria 1345
156 Ga0307406_10002797 3300031901 Bacteria 9518
157 Ga0307406_10047062 3300031901 Bacteria 2717
158 Ga0307407_10005467 3300031903 Bacteria 5517
159 Ga0307409_100005627 3300031995 Bacteria 7247
160 Ga0307416_100014012 3300032002 Bacteria 5472
161 Ga0307411_10039517 3300032005 Bacteria 2985
162 Ga0307411_10064884 3300032005 Bacteria 2446
163 Ga0307411_10121973 3300032005 Bacteria 1888
164 Ga0307415_100031680 3300032126 Bacteria 3409
165 Ga0316585_10028944 3300032137 Bacteria 1734
166 Ga0307510_10016646 3300033180 Bacteria 8677
167 Ga0373923_0090181 3300035111 Bacteria 1340
168 Ga0373933_0029109 3300035724 Bacteria 3191
169 Ga0373937_0043163 3300036401 Bacteria 4115
170 Ga0316582_0273388 3300036647 Bacteria 1159
171 Ga0316584_0000145 3300036712 Bacteria 31908
172 Ga0373925_0004001 3300037068 Bacteria 11219
173 Ga0316581_0024674 3300037588 Bacteria 1785
174 Ga0436364_0256383 3300037853 Bacteria 83938
175 Ga0237819_01102 3300038705 Bacteria 7907
176 Ga0436365_0736190 3300039437 Bacteria 1917
177 Ga0453683_0003773 3300044673 Bacteria 11042
178 Ga0466965_0003588 3300044683 Bacteria 6830
179 Ga0466964_0000482 3300044706 Bacteria 12299
180 Ga0466971_0065657 3300044719 Bacteria 1643
181 Ga0466970_0087199 3300044765 Bacteria 1692
182 Ga0466957_0005170 3300044842 Bacteria 7297
183 Ga0451576_0120783 3300045051 Bacteria 2728
184 Ga0466958_0036428 3300045836 Bacteria 2944
185 Ga0466967_0017980 3300045976 Bacteria 5635
186 Ga0466967_0099126 3300045976 Bacteria 2661
187 Ga0495629_0000023 3300046459 Bacteria 142325
188 Ga0495638_0010868 3300046460 Bacteria 6295
189 Ga0495653_0006156 3300046463 Bacteria 9840
190 Ga0495580_0011501 3300046472 Bacteria 6846
191 Ga0495582_0104574 3300046473 Bacteria 1587
192 Ga0495605_0011715 3300046474 Bacteria 4881
193 Ga0495583_0000946 3300046506 Bacteria 33756
194 Ga0495583_0013502 3300046506 Bacteria 4552
195 Ga0495630_0304855 3300046517 Bacteria 1217
196 Ga0495648_0063520 3300046524 Bacteria 2179
197 Ga0495652_0189818 3300046529 Bacteria 1569
198 Ga0495611_0026481 3300046648 Bacteria 2530
199 Ga0495661_0164981 3300046665 Bacteria 1186
200 Ga0495646_0040421 3300046680 Bacteria 2872
201 Ga0495613_0096134 3300046689 Bacteria 2142
202 Ga0495624_0029063 3300046690 Bacteria 3608
203 Ga0495624_0186187 3300046690 Bacteria 1263
204 Ga0495649_0001549 3300046694 Bacteria 17248
205 Ga0495674_0250823 3300047319 Bacteria 1456
206 Ga0495679_000022 3300047446 Bacteria 215296
207 Ga0495593_0056618 3300047673 Bacteria 2060
208 Ga0495626_0032221 3300048091 Bacteria 2518
209 Ga0495626_0100012 3300048091 Bacteria 1265
210 Ga0496102_0002356 3300048905 Bacteria 16116
211 Ga0496108_0339523 3300048911 Bacteria 1310
212 Ga0496109_0170130 3300048912 Bacteria 2044
213 Ga0496109_0290096 3300048912 Bacteria 1542
214 Ga0496112_0000240 3300048915 Bacteria 35240
215 Ga0496113_0042005 3300048916 Bacteria 3377
216 Ga0496115_0121491 3300048918 Bacteria 2149
217 Ga0496118_0015067 3300048921 Bacteria 7186
218 Ga0496118_0064402 3300048921 Bacteria 2690
219 Ga0496119_0069509 3300048922 Bacteria 2069
220 Ga0496120_0059668 3300048923 Bacteria 2137
221 Ga0496121_0028871 3300048924 Bacteria 5151
222 Ga0496124_0000004 3300048927 Bacteria 976131
223 Ga0495678_033994 3300049459 Bacteria 2101
224 Ga0501031_0092088 3300049568 Bacteria 1978
225 Ga0501034_0091085 3300049571 Bacteria 3047
226 Ga0501034_0160800 3300049571 Bacteria 2217
227 Ga0501034_0438530 3300049571 Bacteria 1225
228 Ga0501036_0013709 3300049572 Bacteria 6741
229 Ga0501038_0110161 3300049574 Bacteria 2282
230 Ga0501041_0053739 3300049577 Bacteria 2457
231 Ga0501042_0242801 3300049578 Bacteria 1299
232 Ga0501046_0118904 3300049580 Bacteria 2012
233 Ga0501046_0274289 3300049580 Bacteria 1236
234 Ga0501047_0153191 3300049581 Bacteria 2180
235 Ga0501048_0062733 3300049582 Bacteria 2630
236 Ga0501069_0061504 3300049585 Bacteria 2097
237 Ga0501070_0128074 3300049586 Bacteria 2098
238 Ga0501071_0050421 3300049587 Bacteria 2998
239 Ga0501072_0076395 3300049588 Bacteria 2650
240 Ga0501075_0030313 3300049591 Bacteria 4006
241 Ga0501075_0314638 3300049591 Bacteria 1193
242 Ga0501076_0135815 3300049592 Bacteria 1996
243 Ga0501076_0145357 3300049592 Bacteria 1928
244 Ga0501077_0061057 3300049593 Bacteria 2392
245 Ga0501079_0073809 3300049741 Bacteria 2637
246 Ga0501044_0081559 3300049823 Bacteria 3274
247 Ga0501045_0016628 3300049824 Bacteria 5226
248 Ga0501045_0244414 3300049824 Bacteria 1336
249 nmdc:mga05p37_145_c1 3300050507 Bacteria 66709
250 nmdc:mga05p37_443549_c1 3300050507 Bacteria 1504
251 nmdc:mga09592_300_c1 3300050508 Bacteria 35915
252 nmdc:mga0n895_125126_c1 3300050512 Bacteria 2594
253 nmdc:mga0sz30_16810_c1 3300050516 Bacteria 2910
254 Ga0500635_0004993 3300053080 Bacteria 3454
255 Ga0495619_0113782 3300053085 Bacteria 1851
256 Ga0500651_0109825 3300053093 Bacteria 1684
257 Ga0500557_000050 3300053105 Bacteria 54589
258 Ga0500642_0002479 3300053130 Bacteria 5428
259 Ga0501084_0111389 3300054114 Bacteria 2300
260 Ga0501084_0128130 3300054114 Bacteria 2136
261 Ga0501082_0130395 3300060353 Bacteria 2181
262 Ga0466962_0012820 3300061719 Bacteria 4033
263 Ga0530510_0030765 3300061734 Bacteria 3857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0153191 Ga0501047_0153191_37_894 268
2 3300049824 Ga0501045_0244414 Ga0501045_0244414_460_1320 278
3 3300036647 Ga0316582_0273388 Ga0316582_0273388_13_909 290
4 3300050516 nmdc:mga0sz30_16810_c1 nmdc:mga0sz30_16810_c1_12_899 294
5 3300049591 Ga0501075_0314638 Ga0501075_0314638_30_986 296
6 3300032005 Ga0307411_10039517 Ga0307411_100395172 298
7 3300005981 Ga0081538_10015651 Ga0081538_100156511 300
8 3300005614 Ga0068856_100194876 Ga0068856_1001948762 303
9 3300026078 Ga0207702_10169679 Ga0207702_101696792 303
10 3300048918 Ga0496115_0121491 Ga0496115_0121491_920_1963 308
11 3300053080 Ga0500635_0004993 Ga0500635_0004993_70_1050 309
12 3300005331 Ga0070670_100039475 Ga0070670_1000394753 310
13 3300005347 Ga0070668_100001697 Ga0070668_1000016973 310
14 3300005459 Ga0068867_100036721 Ga0068867_1000367213 310
15 3300031728 Ga0316578_10062597 Ga0316578_100625972 310
16 3300049574 Ga0501038_0110161 Ga0501038_0110161_1108_2109 311
17 3300049577 Ga0501041_0053739 Ga0501041_0053739_360_1361 311
18 3300049580 Ga0501046_0118904 Ga0501046_0118904_774_1775 311
19 3300049592 Ga0501076_0135815 Ga0501076_0135815_758_1759 311
20 3300049824 Ga0501045_0016628 Ga0501045_0016628_754_1755 311
21 3300006847 Ga0075431_100032176 Ga0075431_1000321762 312
22 3300009093 Ga0105240_10559459 Ga0105240_105594592 312
23 3300044683 Ga0466965_0003588 Ga0466965_0003588_226_1209 312
24 3300044706 Ga0466964_0000482 Ga0466964_0000482_7603_8586 312
25 3300044719 Ga0466971_0065657 Ga0466971_0065657_539_1522 312
26 3300044765 Ga0466970_0087199 Ga0466970_0087199_687_1670 312
27 3300044842 Ga0466957_0005170 Ga0466957_0005170_1803_2786 312
28 3300045976 Ga0466967_0099126 Ga0466967_0099126_1067_2050 312
29 3300046506 Ga0495583_0000946 Ga0495583_0000946_234_1214 312
30 3300046694 Ga0495649_0001549 Ga0495649_0001549_8515_9495 312
31 3300053085 Ga0495619_0113782 Ga0495619_0113782_31_1023 312
32 3300061719 Ga0466962_0012820 Ga0466962_0012820_904_1887 312
33 3300045836 Ga0466958_0036428 Ga0466958_0036428_1046_2029 313
34 3300006186 Ga0075369_10020142 Ga0075369_100201423 314
35 3300049571 Ga0501034_0438530 Ga0501034_0438530_20_994 314
36 3300049823 Ga0501044_0081559 Ga0501044_0081559_996_1970 314
37 3300050507 nmdc:mga05p37_443549_c1 nmdc:mga05p37_443549_c1_14_979 314
38 3300031691 Ga0316579_10005398 Ga0316579_100053983 315
39 3300031728 Ga0316578_10003809 Ga0316578_100038094 315
40 3300031733 Ga0316577_10024128 Ga0316577_100241282 315
41 3300032137 Ga0316585_10028944 Ga0316585_100289442 315
42 3300036712 Ga0316584_0000145 Ga0316584_0000145_11908_12885 315
43 3300037588 Ga0316581_0024674 Ga0316581_0024674_188_1165 315
44 3300038705 Ga0237819_01102 Ga0237819_01102_587_1534 315
45 3300005356 Ga0070674_100031037 Ga0070674_1000310373 316
46 3300005536 Ga0070697_100008976 Ga0070697_1000089769 316
47 3300005543 Ga0070672_100039031 Ga0070672_1000390313 316
48 3300005548 Ga0070665_100003283 Ga0070665_1000032839 316
49 3300025940 Ga0207691_10072665 Ga0207691_100726653 316
50 3300028379 Ga0268266_10035240 Ga0268266_100352403 316
51 3300031824 Ga0307413_10147891 Ga0307413_101478912 316
52 3300031852 Ga0307410_10002057 Ga0307410_100020574 316
53 3300032005 Ga0307411_10121973 Ga0307411_101219732 316
54 3300005329 Ga0070683_100091025 Ga0070683_1000910252 317
55 3300005543 Ga0070672_100136855 Ga0070672_1001368552 317
56 3300025936 Ga0207670_10110397 Ga0207670_101103972 317
57 3300025940 Ga0207691_10128463 Ga0207691_101284632 317
58 3300044673 Ga0453683_0003773 Ga0453683_0003773_4665_5642 317
59 3300045051 Ga0451576_0120783 Ga0451576_0120783_303_1280 317
60 3300049571 Ga0501034_0091085 Ga0501034_0091085_1419_2417 317
61 3300005456 Ga0070678_100180910 Ga0070678_1001809102 318
62 3300005457 Ga0070662_100020661 Ga0070662_1000206614 318
63 3300005543 Ga0070672_100002453 Ga0070672_1000024534 318
64 3300005841 Ga0068863_100041085 Ga0068863_1000410852 318
65 3300005841 Ga0068863_100105124 Ga0068863_1001051242 318
66 3300005842 Ga0068858_100268954 Ga0068858_1002689542 318
67 3300005843 Ga0068860_100164800 Ga0068860_1001648003 318
68 3300013306 Ga0163162_10185804 Ga0163162_101858042 318
69 3300017792 Ga0163161_10014440 Ga0163161_100144404 318
70 3300025940 Ga0207691_10004737 Ga0207691_100047379 318
71 3300026088 Ga0207641_10044170 Ga0207641_100441703 318
72 3300026088 Ga0207641_10047643 Ga0207641_100476433 318
73 3300026089 Ga0207648_10037670 Ga0207648_100376703 318
74 3300026095 Ga0207676_10012853 Ga0207676_100128533 318
75 3300026121 Ga0207683_10085443 Ga0207683_100854432 318
76 3300028380 Ga0268265_10187503 Ga0268265_101875032 318
77 3300030878 Ga0265770_1000469 Ga0265770_10004692 318
78 3300031090 Ga0265760_10001236 Ga0265760_100012364 318
79 3300005331 Ga0070670_100097924 Ga0070670_1000979242 319
80 3300005364 Ga0070673_100029931 Ga0070673_1000299312 319
81 3300005365 Ga0070688_100085528 Ga0070688_1000855282 319
82 3300005843 Ga0068860_100121735 Ga0068860_1001217352 319
83 3300005844 Ga0068862_100190190 Ga0068862_1001901902 319
84 3300021388 Ga0213875_10000968 Ga0213875_100009689 319
85 3300025925 Ga0207650_10174036 Ga0207650_101740362 319
86 3300025960 Ga0207651_10207291 Ga0207651_102072912 319
87 3300037853 Ga0436364_0256383 Ga0436364_0256383_73812_74819 319
88 iso_pu_bacteria 8055225921 8055227307 319
89 3300005544 Ga0070686_100349063 Ga0070686_1003490631 320
90 3300005548 Ga0070665_100129684 Ga0070665_1001296842 320
91 3300009176 Ga0105242_10001842 Ga0105242_100018422 320
92 3300014969 Ga0157376_10035554 Ga0157376_100355543 320
93 3300025934 Ga0207686_10002209 Ga0207686_100022098 320
94 3300025986 Ga0207658_10194886 Ga0207658_101948862 320
95 3300026088 Ga0207641_10047963 Ga0207641_100479632 320
96 3300028379 Ga0268266_10033636 Ga0268266_100336362 320
97 3300035111 Ga0373923_0090181 Ga0373923_0090181_139_1104 320
98 3300035724 Ga0373933_0029109 Ga0373933_0029109_1226_2191 320
99 3300036401 Ga0373937_0043163 Ga0373937_0043163_2792_3757 320
100 3300049571 Ga0501034_0160800 Ga0501034_0160800_827_1873 320
101 3300049586 Ga0501070_0128074 Ga0501070_0128074_978_2024 320
102 iso_pu_bacteria 2858950400 2858952701 320
103 3300003187 JGI25151J46595_10031803 JGI25151J46595_100318032 321
104 3300003771 Ga0055526_1000950 Ga0055526_10009509 321
105 3300003775 Ga0055524_1027513 Ga0055524_10275132 321
106 3300003781 Ga0055536_1007009 Ga0055536_10070094 321
107 3300003794 Ga0055531_10001642 Ga0055531_1000164210 321
108 3300005459 Ga0068867_100299064 Ga0068867_1002990641 321
109 3300005545 Ga0070695_100010690 Ga0070695_1000106906 321
110 3300005549 Ga0070704_100004664 Ga0070704_1000046648 321
111 3300006871 Ga0075434_100092631 Ga0075434_1000926313 321
112 3300006881 Ga0068865_100053695 Ga0068865_1000536953 321
113 3300025292 Ga0209676_1001291 Ga0209676_100129111 321
114 3300025294 Ga0209025_1000337 Ga0209025_100033710 321
115 3300025295 Ga0209564_1000117 Ga0209564_1000117120 321
116 3300025298 Ga0209050_1009352 Ga0209050_10093522 321
117 3300025299 Ga0209256_1000352 Ga0209256_100035212 321
118 3300025303 Ga0209051_1035541 Ga0209051_10355412 321
119 3300025304 Ga0209257_1001572 Ga0209257_10015728 321
120 3300026023 Ga0207677_10054919 Ga0207677_100549193 321
121 3300026035 Ga0207703_10513972 Ga0207703_105139721 321
122 3300037068 Ga0373925_0004001 Ga0373925_0004001_1557_2534 321
123 3300050512 nmdc:mga0n895_125126_c1 nmdc:mga0n895_125126_c1_1279_2301 321
124 iso_pu_bacteria 2508501009 2508543383 321
125 iso_pu_bacteria 2508501042 2508698843 321
126 iso_pu_bacteria 2513237091 2513621073 321
127 iso_pu_bacteria 2515154112 2515628919 321
128 iso_pu_bacteria 2551306086 2551694313 321
129 iso_pu_bacteria 2551306092 2551735092 321
130 iso_pu_bacteria 2643221723 2644672003 321
131 iso_pu_bacteria 2855839649 2855845992 321
132 iso_pu_bacteria 2857542790 2857546135 321
133 iso_pu_bacteria 2874590934 2874597436 321
134 iso_pu_bacteria 2874645413 2874648512 321
135 iso_pu_bacteria 2876771140 2876777767 321
136 iso_pu_bacteria 2876818435 2876822474 321
137 iso_pu_bacteria 2879074833 2879078175 321
138 iso_pu_bacteria 2879127579 2879134484 321
139 iso_pu_bacteria 2879142872 2879149981 321
140 iso_pu_bacteria 2903727486 2903729347 321
141 iso_pu_bacteria 2921257292 2921257749 321
142 iso_pu_bacteria 2935648319 2935651853 321
143 iso_pu_bacteria 2935656913 2935660663 321
144 iso_pu_bacteria 2935975950 2935980973 321
145 iso_pu_bacteria 2935984226 2935989580 321
146 iso_pu_bacteria 2936011229 2936014719 321
147 iso_pu_bacteria 2936019824 2936023484 321
148 iso_pu_bacteria 2936028420 2936032512 321
149 iso_pu_bacteria 2936046547 2936050460 321
150 iso_pu_bacteria 2936055302 2936059048 321
151 iso_pu_bacteria 2937023124 2937026993 321
152 iso_pu_bacteria 2957395598 2957401831 321
153 iso_pu_bacteria 2957484790 2957485940 321
154 iso_pu_bacteria 2960617483 2960622812 321
155 iso_pu_bacteria 2964615318 2964621476 321
156 iso_pu_bacteria 2964636051 2964637334 321
157 iso_pu_bacteria 2967755722 2967761246 321
158 iso_pu_bacteria 2967762386 2967768209 321
159 iso_pu_bacteria 2970102677 2970108150 321
160 iso_pu_bacteria 2977523885 2977524327 321
161 iso_pu_bacteria 8003992118 8003997535 321
162 iso_pu_bacteria 8016630954 8016631778 321
163 iso_pu_bacteria 8019629233 8019635208 321
164 iso_pu_bacteria 8019638758 8019644518 321
165 iso_pu_bacteria 8019648815 8019657540 321
166 iso_pu_bacteria 8019659431 8019663052 321
167 iso_pu_bacteria 8019668869 8019672649 321
168 iso_pu_bacteria 8019678201 8019683512 321
169 3300003215 JGI25153J46596_10000870 JGI25153J46596_1000087013 322
170 3300003215 JGI25153J46596_10059184 JGI25153J46596_100591841 322
171 3300004625 Ga0055543_1001756 Ga0055543_10017566 322
172 3300005262 Ga0065165_1006796 Ga0065165_10067965 322
173 3300005331 Ga0070670_100023104 Ga0070670_1000231043 322
174 3300005355 Ga0070671_100051322 Ga0070671_1000513222 322
175 3300005367 Ga0070667_100376490 Ga0070667_1003764902 322
176 3300005543 Ga0070672_100195793 Ga0070672_1001957932 322
177 3300005548 Ga0070665_100025418 Ga0070665_1000254185 322
178 3300006051 Ga0075364_10015268 Ga0075364_100152682 322
179 3300025261 Ga0209233_1006918 Ga0209233_10069182 322
180 3300025925 Ga0207650_10099117 Ga0207650_100991173 322
181 3300025931 Ga0207644_10049532 Ga0207644_100495322 322
182 3300025940 Ga0207691_10179765 Ga0207691_101797652 322
183 3300026088 Ga0207641_10164405 Ga0207641_101644052 322
184 3300033180 Ga0307510_10016646 Ga0307510_100166464 322
185 3300046665 Ga0495661_0164981 Ga0495661_0164981_184_1164 322
186 3300048905 Ga0496102_0002356 Ga0496102_0002356_7042_8016 322
187 3300048921 Ga0496118_0064402 Ga0496118_0064402_607_1587 322
188 3300048922 Ga0496119_0069509 Ga0496119_0069509_772_1752 322
189 3300048923 Ga0496120_0059668 Ga0496120_0059668_600_1580 322
190 3300048927 Ga0496124_0000004 Ga0496124_0000004_615716_616690 322
191 3300053093 Ga0500651_0109825 Ga0500651_0109825_488_1468 322
192 3300053105 Ga0500557_000050 Ga0500557_000050_13645_14625 322
193 iso_pu_bacteria 3004211236 3004217631 322
194 iso_pu_bacteria 3004218560 3004219978 322
195 3300005471 Ga0070698_100069315 Ga0070698_1000693153 323
196 3300005563 Ga0068855_100115080 Ga0068855_1001150802 323
197 3300009177 Ga0105248_10209041 Ga0105248_102090412 323
198 3300025949 Ga0207667_10313447 Ga0207667_103134472 323
199 3300028379 Ga0268266_10196046 Ga0268266_101960463 323
200 3300029957 Ga0265324_10001251 Ga0265324_100012515 323
201 3300031548 Ga0307408_100065005 Ga0307408_1000650051 323
202 3300031548 Ga0307408_100291542 Ga0307408_1002915422 323
203 3300031824 Ga0307413_10000255 Ga0307413_100002553 323
204 3300031852 Ga0307410_10046226 Ga0307410_100462262 323
205 3300031852 Ga0307410_10263371 Ga0307410_102633712 323
206 3300031901 Ga0307406_10002797 Ga0307406_100027973 323
207 3300031901 Ga0307406_10047062 Ga0307406_100470622 323
208 3300031903 Ga0307407_10005467 Ga0307407_100054673 323
209 3300031995 Ga0307409_100005627 Ga0307409_1000056273 323
210 3300032002 Ga0307416_100014012 Ga0307416_1000140124 323
211 3300032005 Ga0307411_10064884 Ga0307411_100648842 323
212 3300032126 Ga0307415_100031680 Ga0307415_1000316803 323
213 3300039437 Ga0436365_0736190 Ga0436365_0736190_851_1825 323
214 3300045976 Ga0466967_0017980 Ga0466967_0017980_3879_4862 323
215 3300048912 Ga0496109_0170130 Ga0496109_0170130_530_1516 323
216 3300048915 Ga0496112_0000240 Ga0496112_0000240_29702_30688 323
217 3300048916 Ga0496113_0042005 Ga0496113_0042005_2359_3345 323
218 3300053130 Ga0500642_0002479 Ga0500642_0002479_3724_4734 323
219 3300005331 Ga0070670_100005250 Ga0070670_1000052505 324
220 3300005334 Ga0068869_100006765 Ga0068869_1000067652 324
221 3300005347 Ga0070668_100007090 Ga0070668_1000070905 324
222 3300005347 Ga0070668_100024660 Ga0070668_1000246602 324
223 3300005353 Ga0070669_100007523 Ga0070669_1000075232 324
224 3300005356 Ga0070674_100110675 Ga0070674_1001106753 324
225 3300005364 Ga0070673_100027633 Ga0070673_1000276333 324
226 3300005367 Ga0070667_100012423 Ga0070667_1000124232 324
227 3300005543 Ga0070672_100212780 Ga0070672_1002127802 324
228 3300005617 Ga0068859_100002711 Ga0068859_1000027113 324
229 3300005618 Ga0068864_100001221 Ga0068864_10000122111 324
230 3300005719 Ga0068861_100000947 Ga0068861_1000009473 324
231 3300005840 Ga0068870_10049295 Ga0068870_100492953 324
232 3300005841 Ga0068863_100005462 Ga0068863_1000054624 324
233 3300005842 Ga0068858_100001698 Ga0068858_10000169819 324
234 3300005843 Ga0068860_100007624 Ga0068860_1000076243 324
235 3300005844 Ga0068862_100034597 Ga0068862_1000345973 324
236 3300006931 Ga0097620_100002711 Ga0097620_10000271117 324
237 3300009101 Ga0105247_10014134 Ga0105247_100141345 324
238 3300009177 Ga0105248_10083518 Ga0105248_100835183 324
239 3300014325 Ga0163163_10035683 Ga0163163_100356834 324
240 3300014968 Ga0157379_10003651 Ga0157379_100036517 324
241 3300025908 Ga0207643_10020693 Ga0207643_100206934 324
242 3300025923 Ga0207681_10055615 Ga0207681_100556152 324
243 3300025925 Ga0207650_10080158 Ga0207650_100801583 324
244 3300025940 Ga0207691_10072686 Ga0207691_100726863 324
245 3300025942 Ga0207689_10000689 Ga0207689_100006895 324
246 3300025960 Ga0207651_10026174 Ga0207651_100261743 324
247 3300025972 Ga0207668_10033910 Ga0207668_100339104 324
248 3300026035 Ga0207703_10005214 Ga0207703_100052142 324
249 3300026088 Ga0207641_10024811 Ga0207641_100248114 324
250 3300026095 Ga0207676_10025667 Ga0207676_100256673 324
251 3300026118 Ga0207675_100020226 Ga0207675_1000202265 324
252 3300028380 Ga0268265_10010373 Ga0268265_100103732 324
253 3300028381 Ga0268264_10001909 Ga0268264_1000190914 324
254 3300031711 Ga0265314_10067359 Ga0265314_100673592 324
255 3300048911 Ga0496108_0339523 Ga0496108_0339523_241_1236 324
256 3300048912 Ga0496109_0290096 Ga0496109_0290096_437_1432 324
257 3300009094 Ga0111539_10292534 Ga0111539_102925342 325
258 3300025253 Ga0209677_103337 Ga0209677_1033375 325
259 3300025909 Ga0207705_10074720 Ga0207705_100747203 325
260 3300025949 Ga0207667_10113480 Ga0207667_101134803 325
261 3300049568 Ga0501031_0092088 Ga0501031_0092088_37_1044 325
262 3300049572 Ga0501036_0013709 Ga0501036_0013709_1142_2149 325
263 3300049578 Ga0501042_0242801 Ga0501042_0242801_174_1181 325
264 3300049580 Ga0501046_0274289 Ga0501046_0274289_64_1071 325
265 3300049582 Ga0501048_0062733 Ga0501048_0062733_750_1751 325
266 3300049585 Ga0501069_0061504 Ga0501069_0061504_156_1163 325
267 3300049587 Ga0501071_0050421 Ga0501071_0050421_1045_2052 325
268 3300049588 Ga0501072_0076395 Ga0501072_0076395_64_1071 325
269 3300049591 Ga0501075_0030313 Ga0501075_0030313_2005_3012 325
270 3300049592 Ga0501076_0145357 Ga0501076_0145357_857_1864 325
271 3300049593 Ga0501077_0061057 Ga0501077_0061057_112_1113 325
272 3300049741 Ga0501079_0073809 Ga0501079_0073809_1158_2165 325
273 3300054114 Ga0501084_0111389 Ga0501084_0111389_1272_2273 325
274 3300054114 Ga0501084_0128130 Ga0501084_0128130_872_1879 325
275 3300060353 Ga0501082_0130395 Ga0501082_0130395_983_1984 325
276 3300061734 Ga0530510_0030765 Ga0530510_0030765_1999_3000 325
277 3300009094 Ga0111539_10574916 Ga0111539_105749162 326
278 3300025292 Ga0209676_1000049 Ga0209676_1000049318 326
279 3300025935 Ga0207709_10036924 Ga0207709_100369242 326
280 iso_pu_bacteria 2643221626 2644149190 326
281 3300009147 Ga0114129_10470221 Ga0114129_104702212 327
282 3300006844 Ga0075428_100076210 Ga0075428_1000762102 328
283 3300006847 Ga0075431_100011241 Ga0075431_1000112416 328
284 3300006880 Ga0075429_100000007 Ga0075429_10000000789 328
285 3300009147 Ga0114129_10016509 Ga0114129_100165097 328
286 3300050507 nmdc:mga05p37_145_c1 nmdc:mga05p37_145_c1_64179_65183 328
287 3300050508 nmdc:mga09592_300_c1 nmdc:mga09592_300_c1_34350_35354 328
288 3300002705 JGI25156J39149_1001032 JGI25156J39149_10010324 332
289 3300046459 Ga0495629_0000023 Ga0495629_0000023_134747_135745 332
290 3300046460 Ga0495638_0010868 Ga0495638_0010868_2614_3612 332
291 3300046463 Ga0495653_0006156 Ga0495653_0006156_3210_4208 332
292 3300046472 Ga0495580_0011501 Ga0495580_0011501_4900_5898 332
293 3300046473 Ga0495582_0104574 Ga0495582_0104574_32_1030 332
294 3300046474 Ga0495605_0011715 Ga0495605_0011715_2378_3376 332
295 3300046506 Ga0495583_0013502 Ga0495583_0013502_3082_4080 332
296 3300046517 Ga0495630_0304855 Ga0495630_0304855_53_1051 332
297 3300046524 Ga0495648_0063520 Ga0495648_0063520_199_1197 332
298 3300046648 Ga0495611_0026481 Ga0495611_0026481_200_1198 332
299 3300046680 Ga0495646_0040421 Ga0495646_0040421_1337_2335 332
300 3300046689 Ga0495613_0096134 Ga0495613_0096134_905_1903 332
301 3300046690 Ga0495624_0029063 Ga0495624_0029063_1324_2322 332
302 3300046690 Ga0495624_0186187 Ga0495624_0186187_101_1099 332
303 3300047319 Ga0495674_0250823 Ga0495674_0250823_358_1356 332
304 3300047446 Ga0495679_000022 Ga0495679_000022_124612_125610 332
305 3300047673 Ga0495593_0056618 Ga0495593_0056618_499_1497 332
306 3300048091 Ga0495626_0032221 Ga0495626_0032221_940_1938 332
307 3300048921 Ga0496118_0015067 Ga0496118_0015067_546_1544 332
308 3300048924 Ga0496121_0028871 Ga0496121_0028871_3795_4793 332
309 3300049459 Ga0495678_033994 Ga0495678_033994_321_1319 332
310 iso_pu_bacteria 2508501125 2509126372 332
311 iso_pu_bacteria 2945934425 2945940232 333
312 3300046529 Ga0495652_0189818 Ga0495652_0189818_68_1075 335
313 3300027312 Ga0209371_1004646 Ga0209371_10046463 336
314 3300001979 JGI24740J21852_10014321 JGI24740J21852_100143212 337
315 3300048091 Ga0495626_0100012 Ga0495626_0100012_34_1047 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08352

oligo_HPY

Oligopeptide/dipeptide transporter, C-terminal region

243

307

0.98

PF00005

ABC_tran

ABC transporter

33

192

0.96

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

128

228

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fwi-assembly1.cif.gz_B crystal structure of the nucleotide-binding domain of a dipeptide abc transporter 0.9386 1 325
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9349 1 258
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.9337 1 254
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9313 1 258
6cvl-assembly1.cif.gz_C crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.9281 3 254
ID Description Score Start End Superfamily
af_P33916_3_268_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9799 1 259 3.40.50.300
af_P75796_10_305_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9611 1 267 3.40.50.300
af_Q2FVF0_1_268_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9578 1 254 3.40.50.300
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9572 3 261 3.40.50.300
af_Q2FZR5_3_331_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9554 1 325 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2S9BS46-F1-model_v4 Dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein 0.9801 13 254 GO:0005524
GO:0005886
GO:0016887
AF-A0A3A0B278-F1-model_v4 Dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein 0.9741 1 202 GO:0005524
GO:0016887
AF-A0A352SRK6-F1-model_v4 Peptide ABC transporter ATP-binding protein 0.973 2 169 GO:0005524
GO:0005886
GO:0016887
AF-A0A853I3Z0-F1-model_v4 deleted 0.97 2 184
AF-A0A545AZY2-F1-model_v4 ABC transporter ATP-binding protein 0.9696 1 254 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.85 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map