F403264

General Info

Members Datasets Scaffolds Average Seq Length
315 232 630 147

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0259341|Ga0316574_0259341_52_570
Length 172
Sequence VDRGDDHPRRLPPRLDRDRGDEALVNDEELMRLALAAAASAPEHDDVPIGAVLARGGEPLATAANERELRRDPTAHAEILAIREGAELLGGWRLPDTTLYVTLEPCAMCAGAIVLARVPRVVYAAPDPKAGAAGSVLDVLGEPLLNHRPEVVGGVLGADAAELLRSFFRLRR

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
115 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
116 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
136 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
137 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
204 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
205 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
206 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
207 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
208 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
209 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
210 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
211 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
216 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
217 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
218 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
222 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 8.57
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0259341 3300035398 Bacteria 1110
2 JGI24746J21847_1000015 3300001977 Bacteria 16109
3 Ga0070658_10074234 3300005327 Bacteria 2789
4 Ga0070676_10891745 3300005328 Bacteria 662
5 Ga0070683_100002371 3300005329 Bacteria 14965
6 Ga0070683_100032357 3300005329 Bacteria 4762
7 Ga0070683_100084948 3300005329 Bacteria 2966
8 Ga0070683_100221687 3300005329 Bacteria 1797
9 Ga0070683_100222135 3300005329 Bacteria 1795
10 Ga0068869_100363146 3300005334 Bacteria 1183
11 Ga0070666_10016968 3300005335 Bacteria 4662
12 Ga0070680_100317630 3300005336 Bacteria 1322
13 Ga0070682_100010603 3300005337 Bacteria 5234
14 Ga0070682_100456723 3300005337 Bacteria 980
15 Ga0068868_100000314 3300005338 Bacteria 32538
16 Ga0068868_100009531 3300005338 Bacteria 6996
17 Ga0068868_100117937 3300005338 Bacteria 2163
18 Ga0070660_100026522 3300005339 Bacteria 4314
19 Ga0070691_10239312 3300005341 Bacteria 969
20 Ga0070661_100101294 3300005344 Bacteria 2142
21 Ga0070692_10007304 3300005345 Bacteria 4862
22 Ga0070668_100045876 3300005347 Bacteria 3354
23 Ga0070675_100055766 3300005354 Bacteria 3254
24 Ga0070674_100012881 3300005356 Bacteria 5149
25 Ga0070673_100317255 3300005364 Bacteria 1376
26 Ga0070659_100006808 3300005366 Bacteria 8274
27 Ga0070659_100008246 3300005366 Bacteria 7606
28 Ga0070659_100026053 3300005366 Bacteria 4498
29 Ga0070703_10070063 3300005406 Bacteria 1169
30 Ga0070714_100007897 3300005435 Bacteria 8286
31 Ga0070713_100000061 3300005436 Bacteria 68662
32 Ga0070710_10391836 3300005437 Bacteria 929
33 Ga0070700_100026747 3300005441 Bacteria 3412
34 Ga0070663_100020966 3300005455 Bacteria 4337
35 Ga0070663_100034273 3300005455 Bacteria 3515
36 Ga0070663_100071918 3300005455 Bacteria 2518
37 Ga0070678_100123282 3300005456 Bacteria 2047
38 Ga0070662_100000079 3300005457 Bacteria 53583
39 Ga0070662_100104982 3300005457 Bacteria 2144
40 Ga0068867_100049641 3300005459 Bacteria 3090
41 Ga0070679_100073737 3300005530 Bacteria 3404
42 Ga0070679_100237933 3300005530 Bacteria 1779
43 Ga0070684_100017290 3300005535 Bacteria 5914
44 Ga0070684_100025825 3300005535 Bacteria 4941
45 Ga0070684_100051265 3300005535 Bacteria 3585
46 Ga0070684_100068139 3300005535 Bacteria 3127
47 Ga0070684_100432266 3300005535 Bacteria 1216
48 Ga0068853_100071480 3300005539 Bacteria 3022
49 Ga0068853_100484249 3300005539 Bacteria 1166
50 Ga0070672_100000018 3300005543 Bacteria 70205
51 Ga0070672_100052463 3300005543 Bacteria 3184
52 Ga0070686_100208873 3300005544 Bacteria 1404
53 Ga0070693_100002093 3300005547 Bacteria 9134
54 Ga0070693_100081036 3300005547 Bacteria 1935
55 Ga0070665_100110065 3300005548 Bacteria 2757
56 Ga0070704_100461701 3300005549 Bacteria 1096
57 Ga0070664_100022138 3300005564 Bacteria 5242
58 Ga0070664_101103575 3300005564 Bacteria 747
59 Ga0068857_100298840 3300005577 Bacteria 1484
60 Ga0068857_100335098 3300005577 Bacteria 1399
61 Ga0068854_100050001 3300005578 Bacteria 2989
62 Ga0068856_101368186 3300005614 Bacteria 722
63 Ga0070702_100175445 3300005615 Bacteria 1398
64 Ga0070702_100603920 3300005615 Bacteria 823
65 Ga0068852_100002716 3300005616 Bacteria 12233
66 Ga0068859_100082740 3300005617 Bacteria 3253
67 Ga0068864_100162143 3300005618 Bacteria 2033
68 Ga0068866_10233675 3300005718 Bacteria 1116
69 Ga0068870_10099162 3300005840 Bacteria 1643
70 Ga0068858_100000178 3300005842 Bacteria 67760
71 Ga0068858_100106051 3300005842 Bacteria 2623
72 Ga0081455_10022386 3300005937 Bacteria 5908
73 Ga0081455_10474385 3300005937 Bacteria 848
74 Ga0081540_1000503 3300005983 Bacteria 38494
75 Ga0081539_10063061 3300005985 Bacteria 2024
76 Ga0075365_10018953 3300006038 Bacteria 4238
77 Ga0075363_100067463 3300006048 Bacteria 1938
78 Ga0075363_100177568 3300006048 Bacteria 1211
79 Ga0075363_100512940 3300006048 Bacteria 713
80 Ga0075364_10068343 3300006051 Bacteria 2336
81 Ga0070716_100862254 3300006173 Bacteria 706
82 Ga0075431_100152670 3300006847 Bacteria 2378
83 Ga0075433_10063671 3300006852 Bacteria 3231
84 Ga0075434_100002798 3300006871 Bacteria 15457
85 Ga0068865_100117702 3300006881 Bacteria 1970
86 Ga0075436_100225679 3300006914 Bacteria 1330
87 Ga0097620_100082738 3300006931 Bacteria 3253
88 Ga0075435_100448115 3300007076 Bacteria 1113
89 Ga0111539_10177230 3300009094 Bacteria 2490
90 Ga0105245_10000012 3300009098 Bacteria 267151
91 Ga0105245_10073844 3300009098 Bacteria 3102
92 Ga0105245_11996910 3300009098 Bacteria 633
93 Ga0114129_10003248 3300009147 Bacteria 22815
94 Ga0105243_10005188 3300009148 Bacteria 10198
95 Ga0105243_10022821 3300009148 Bacteria 4758
96 Ga0105249_10000039 3300009553 Bacteria 196325
97 Ga0105249_10054170 3300009553 Bacteria 3667
98 Ga0105239_10090385 3300010375 Bacteria 3378
99 Ga0105239_10312019 3300010375 Bacteria 1773
100 Ga0157372_10097670 3300013307 Bacteria 3350
101 Ga0157372_10359094 3300013307 Bacteria 1697
102 Ga0157372_10426601 3300013307 Bacteria 1545
103 Ga0157375_10077397 3300013308 Bacteria 3356
104 Ga0163163_10078229 3300014325 Bacteria 3304
105 Ga0163163_10844670 3300014325 Bacteria 979
106 Ga0157380_10000009 3300014326 Bacteria 142155
107 Ga0157380_10000277 3300014326 Bacteria 30723
108 Ga0157380_10017839 3300014326 Bacteria 5260
109 Ga0157377_10021854 3300014745 Bacteria 3371
110 Ga0157379_10069180 3300014968 Bacteria 3157
111 Ga0157379_10776417 3300014968 Bacteria 903
112 Ga0157376_10014432 3300014969 Bacteria 5932
113 Ga0157376_10020413 3300014969 Bacteria 5124
114 Ga0207682_10000007 3300025893 Bacteria 88967
115 Ga0207692_10189824 3300025898 Bacteria 1202
116 Ga0207692_10368722 3300025898 Bacteria 889
117 Ga0207642_10199028 3300025899 Bacteria 1105
118 Ga0207710_10000365 3300025900 Bacteria 31650
119 Ga0207688_10019077 3300025901 Bacteria 3733
120 Ga0207680_10129382 3300025903 Bacteria 1662
121 Ga0207643_10081993 3300025908 Bacteria 1870
122 Ga0207705_10016873 3300025909 Bacteria 5230
123 Ga0207671_10203968 3300025914 Bacteria 1545
124 Ga0207657_10003009 3300025919 Bacteria 18060
125 Ga0207649_10236085 3300025920 Bacteria 1310
126 Ga0207659_10079939 3300025926 Bacteria 2414
127 Ga0207687_10000011 3300025927 Bacteria 388349
128 Ga0207687_10031499 3300025927 Bacteria 3584
129 Ga0207687_10105065 3300025927 Bacteria 2086
130 Ga0207700_10000016 3300025928 Bacteria 202434
131 Ga0207664_10002111 3300025929 Bacteria 13080
132 Ga0207690_10004245 3300025932 Bacteria 8465
133 Ga0207690_10022473 3300025932 Bacteria 3925
134 Ga0207690_10126999 3300025932 Bacteria 1861
135 Ga0207706_10000302 3300025933 Bacteria 53541
136 Ga0207706_10012441 3300025933 Bacteria 7753
137 Ga0207686_10003881 3300025934 Bacteria 8020
138 Ga0207709_10024049 3300025935 Bacteria 3474
139 Ga0207709_10028292 3300025935 Bacteria 3240
140 Ga0207669_10097214 3300025937 Bacteria 1935
141 Ga0207704_10000009 3300025938 Bacteria 198266
142 Ga0207704_10133003 3300025938 Bacteria 1726
143 Ga0207665_10197650 3300025939 Bacteria 1464
144 Ga0207691_10000121 3300025940 Bacteria 70558
145 Ga0207691_10005127 3300025940 Bacteria 12642
146 Ga0207689_10252786 3300025942 Bacteria 1457
147 Ga0207661_10000275 3300025944 Bacteria 33001
148 Ga0207661_10007508 3300025944 Bacteria 7753
149 Ga0207661_10074623 3300025944 Bacteria 2780
150 Ga0207661_10681030 3300025944 Bacteria 945
151 Ga0207679_10017962 3300025945 Bacteria 4727
152 Ga0207712_10000003 3300025961 Bacteria 615314
153 Ga0207712_10066444 3300025961 Bacteria 2578
154 Ga0207668_10106674 3300025972 Bacteria 2093
155 Ga0207640_10010938 3300025981 Bacteria 5121
156 Ga0207658_11040058 3300025986 Bacteria 747
157 Ga0207677_10000218 3300026023 Bacteria 45820
158 Ga0207677_10003912 3300026023 Bacteria 7930
159 Ga0207677_10101584 3300026023 Bacteria 2118
160 Ga0207703_10000381 3300026035 Bacteria 47426
161 Ga0207703_10565401 3300026035 Bacteria 1073
162 Ga0207639_10085502 3300026041 Bacteria 2508
163 Ga0207639_10452360 3300026041 Bacteria 1166
164 Ga0207678_10004621 3300026067 Bacteria 12368
165 Ga0207708_10004311 3300026075 Bacteria 10472
166 Ga0207702_11601522 3300026078 Bacteria 644
167 Ga0207648_10071665 3300026089 Bacteria 3020
168 Ga0207428_10652817 3300027907 Bacteria 755
169 Ga0265337_1000074 3300028556 Bacteria 46897
170 Ga0265326_10000035 3300028558 Bacteria 89561
171 Ga0265323_10094192 3300028653 Bacteria 997
172 Ga0265322_10000009 3300028654 Bacteria 170768
173 Ga0265336_10109224 3300028666 Bacteria 824
174 Ga0265324_10000168 3300029957 Bacteria 50622
175 Ga0265328_10000939 3300031239 Bacteria 13426
176 Ga0265320_10000024 3300031240 Bacteria 170768
177 Ga0265329_10004276 3300031242 Bacteria 5988
178 Ga0265339_10011049 3300031249 Bacteria 5578
179 Ga0265331_10005065 3300031250 Bacteria 8052
180 Ga0265327_10000227 3300031251 Bacteria 114777
181 Ga0265316_10018834 3300031344 Bacteria 5927
182 Ga0265314_10000647 3300031711 Bacteria 42707
183 Ga0265342_10138236 3300031712 Bacteria 1360
184 Ga0316576_10149306 3300031727 Bacteria 1761
185 Ga0316578_10075298 3300031728 Bacteria 2002
186 Ga0307410_10771122 3300031852 Bacteria 816
187 Ga0307410_11235118 3300031852 Bacteria 652
188 Ga0307406_10035028 3300031901 Bacteria 3084
189 Ga0307406_10793594 3300031901 Bacteria 798
190 Ga0307409_101384881 3300031995 Bacteria 729
191 Ga0307416_100348316 3300032002 Bacteria 1498
192 Ga0307415_100079329 3300032126 Bacteria 2338
193 Ga0316583_10108680 3300032133 Bacteria 967
194 Ga0316585_10053823 3300032137 Bacteria 1294
195 Ga0316580_10069223 3300032139 Bacteria 1081
196 Ga0316574_0033156 3300035398 Bacteria 3143
197 Ga0373937_1651679 3300036401 Bacteria 588
198 Ga0316582_0005652 3300036647 Bacteria 6471
199 Ga0395905_0026420 3300037471 Bacteria 5474
200 Ga0395901_0763342 3300038443 Bacteria 959
201 Ga0466957_0561130 3300044842 Bacteria 796
202 Ga0466967_0081203 3300045976 Bacteria 2928
203 Ga0495603_0000054 3300046455 Bacteria 49027
204 Ga0495653_0715024 3300046463 Bacteria 607
205 Ga0495662_0004031 3300046476 Bacteria 7400
206 Ga0495594_0000007 3300046499 Bacteria 160047
207 Ga0495596_0274175 3300046500 Bacteria 655
208 Ga0495608_0102509 3300046511 Bacteria 1844
209 Ga0495608_0772730 3300046511 Bacteria 568
210 Ga0495618_0630975 3300046514 Bacteria 635
211 Ga0495640_0436369 3300046533 Bacteria 801
212 Ga0495587_0129099 3300046536 Bacteria 1445
213 Ga0495598_0003049 3300046537 Bacteria 3518
214 Ga0495645_0484763 3300046543 Bacteria 775
215 Ga0495622_0000437 3300046557 Bacteria 27136
216 Ga0495656_0034656 3300046615 Bacteria 2068
217 Ga0495668_0306469 3300046616 Bacteria 871
218 Ga0495635_0036986 3300046663 Bacteria 3380
219 Ga0495635_0759371 3300046663 Bacteria 626
220 Ga0495588_0000278 3300046674 Bacteria 38709
221 Ga0495613_0018352 3300046689 Bacteria 5218
222 Ga0495624_0003396 3300046690 Bacteria 11814
223 Ga0495600_0009512 3300046809 Bacteria 6008
224 Ga0495604_0000078 3300047317 Bacteria 83632
225 Ga0495674_0001786 3300047319 Bacteria 21206
226 Ga0496100_0000004 3300048903 Bacteria 321778
227 Ga0496100_0359315 3300048903 Bacteria 1102
228 Ga0496101_0000007 3300048904 Bacteria 321778
229 Ga0496102_0161367 3300048905 Bacteria 2109
230 Ga0496102_0243689 3300048905 Bacteria 1695
231 Ga0496103_0299680 3300048906 Bacteria 1034
232 Ga0496103_0816650 3300048906 Bacteria 587
233 Ga0496104_0000003 3300048907 Bacteria 669219
234 Ga0496104_0000307 3300048907 Bacteria 43626
235 Ga0496105_0000003 3300048908 Bacteria 713251
236 Ga0496105_0000070 3300048908 Bacteria 80117
237 Ga0496106_0000004 3300048909 Bacteria 279896
238 Ga0496107_0000001 3300048910 Bacteria 321778
239 Ga0496107_0849986 3300048910 Bacteria 667
240 Ga0496108_0000002 3300048911 Bacteria 700890
241 Ga0496108_0000202 3300048911 Bacteria 55115
242 Ga0496108_0047000 3300048911 Bacteria 3607
243 Ga0496109_0000001 3300048912 Bacteria 700852
244 Ga0496109_0000106 3300048912 Bacteria 86550
245 Ga0496109_0000131 3300048912 Bacteria 76860
246 Ga0496109_0038060 3300048912 Bacteria 4348
247 Ga0496109_0248293 3300048912 Bacteria 1676
248 Ga0496110_0098235 3300048913 Bacteria 2623
249 Ga0496111_0003706 3300048914 Bacteria 9504
250 Ga0496113_0023287 3300048916 Bacteria 4391
251 Ga0496113_1297707 3300048916 Bacteria 566
252 Ga0496115_0024022 3300048918 Bacteria 4735
253 Ga0496118_0279205 3300048921 Bacteria 931
254 Ga0496121_0289667 3300048924 Bacteria 1116
255 Ga0496125_0460075 3300048928 Bacteria 726
256 Ga0501031_0002389 3300049568 Bacteria 11926
257 Ga0501032_0002564 3300049569 Bacteria 14222
258 Ga0501033_0085780 3300049570 Bacteria 2305
259 Ga0501034_0019089 3300049571 Bacteria 7019
260 Ga0501036_0006591 3300049572 Bacteria 9431
261 Ga0501037_0003409 3300049573 Bacteria 11558
262 Ga0501038_0109525 3300049574 Bacteria 2288
263 Ga0501039_0092234 3300049575 Bacteria 2361
264 Ga0501042_0080329 3300049578 Bacteria 2336
265 Ga0501042_0145106 3300049578 Bacteria 1711
266 Ga0501043_0085553 3300049579 Bacteria 2477
267 Ga0501046_0002906 3300049580 Bacteria 15882
268 Ga0501047_0004514 3300049581 Bacteria 13090
269 Ga0501048_0002887 3300049582 Bacteria 13115
270 Ga0501067_0039235 3300049583 Bacteria 2630
271 Ga0501068_0030303 3300049584 Bacteria 3208
272 Ga0501068_0091630 3300049584 Bacteria 1876
273 Ga0501068_0094640 3300049584 Bacteria 1846
274 Ga0501069_0052689 3300049585 Bacteria 2266
275 Ga0501069_0126089 3300049585 Bacteria 1464
276 Ga0501069_0459380 3300049585 Bacteria 757
277 Ga0501070_0004138 3300049586 Bacteria 12491
278 Ga0501071_0091086 3300049587 Bacteria 2240
279 Ga0501073_0064789 3300049589 Bacteria 2548
280 Ga0501074_0010118 3300049590 Bacteria 6847
281 Ga0501075_0016038 3300049591 Bacteria 5390
282 Ga0501209_003280 3300049656 Bacteria 2644
283 Ga0501242_000255 3300049674 Bacteria 4268
284 Ga0501243_001894 3300049675 Bacteria 3048
285 Ga0501249_016928 3300049679 Bacteria 1568
286 Ga0501252_007315 3300049682 Bacteria 1248
287 Ga0501257_017893 3300049686 Bacteria 1650
288 Ga0501259_002665 3300049688 Bacteria 2875
289 Ga0501261_009299 3300049690 Bacteria 1280
290 Ga0501245_003636 3300049708 Bacteria 2100
291 Ga0501079_0099701 3300049741 Bacteria 2251
292 Ga0501080_0025145 3300049742 Bacteria 5526
293 Ga0501083_0062460 3300049744 Bacteria 2485
294 Ga0501264_006065 3300049761 Bacteria 1110
295 Ga0501266_000639 3300049763 Bacteria 4564
296 Ga0501267_024515 3300049764 Bacteria 682
297 Ga0501268_009947 3300049765 Bacteria 1471
298 Ga0501035_0006173 3300049822 Bacteria 11279
299 Ga0501044_0007279 3300049823 Bacteria 12161
300 Ga0501204_054821 3300049850 Bacteria 620
301 Ga0501212_021593 3300049851 Bacteria 999
302 nmdc:mga05p37_12316_c1 3300050507 Bacteria 10215
303 nmdc:mga06r32_299352_c1 3300050510 Bacteria 1595
304 nmdc:mga08y16_1173157_c1 3300050511 Bacteria 740
305 nmdc:mga0n895_13573_c1 3300050512 Bacteria 7359
306 nmdc:mga08x19_355995_c1 3300050514 Bacteria 1022
307 nmdc:mga0a205_67610_c1 3300050515 Bacteria 3452
308 Ga0495601_0007034 3300053077 Bacteria 6593
309 Ga0495601_0024999 3300053077 Bacteria 3680
310 Ga0495601_0051753 3300053077 Bacteria 2592
311 Ga0495655_0105694 3300053083 Bacteria 839
312 Ga0495619_0000060 3300053085 Bacteria 89377
313 Ga0495619_0002877 3300053085 Bacteria 11194
314 Ga0495619_0006523 3300053085 Bacteria 7387
315 Ga0501082_0110822 3300060353 Bacteria 2375
316 Ga0316574_0259341
317 JGI24746J21847_1000015
318 Ga0070658_10074234
319 Ga0070676_10891745
320 Ga0070683_100002371
321 Ga0070683_100032357
322 Ga0070683_100084948
323 Ga0070683_100221687
324 Ga0070683_100222135
325 Ga0068869_100363146
326 Ga0070666_10016968
327 Ga0070680_100317630
328 Ga0070682_100010603
329 Ga0070682_100456723
330 Ga0068868_100000314
331 Ga0068868_100009531
332 Ga0068868_100117937
333 Ga0070660_100026522
334 Ga0070691_10239312
335 Ga0070661_100101294
336 Ga0070692_10007304
337 Ga0070668_100045876
338 Ga0070675_100055766
339 Ga0070674_100012881
340 Ga0070673_100317255
341 Ga0070659_100006808
342 Ga0070659_100008246
343 Ga0070659_100026053
344 Ga0070703_10070063
345 Ga0070714_100007897
346 Ga0070713_100000061
347 Ga0070710_10391836
348 Ga0070700_100026747
349 Ga0070663_100020966
350 Ga0070663_100034273
351 Ga0070663_100071918
352 Ga0070678_100123282
353 Ga0070662_100000079
354 Ga0070662_100104982
355 Ga0068867_100049641
356 Ga0070679_100073737
357 Ga0070679_100237933
358 Ga0070684_100017290
359 Ga0070684_100025825
360 Ga0070684_100051265
361 Ga0070684_100068139
362 Ga0070684_100432266
363 Ga0068853_100071480
364 Ga0068853_100484249
365 Ga0070672_100000018
366 Ga0070672_100052463
367 Ga0070686_100208873
368 Ga0070693_100002093
369 Ga0070693_100081036
370 Ga0070665_100110065
371 Ga0070704_100461701
372 Ga0070664_100022138
373 Ga0070664_101103575
374 Ga0068857_100298840
375 Ga0068857_100335098
376 Ga0068854_100050001
377 Ga0068856_101368186
378 Ga0070702_100175445
379 Ga0070702_100603920
380 Ga0068852_100002716
381 Ga0068859_100082740
382 Ga0068864_100162143
383 Ga0068866_10233675
384 Ga0068870_10099162
385 Ga0068858_100000178
386 Ga0068858_100106051
387 Ga0081455_10022386
388 Ga0081455_10474385
389 Ga0081540_1000503
390 Ga0081539_10063061
391 Ga0075365_10018953
392 Ga0075363_100067463
393 Ga0075363_100177568
394 Ga0075363_100512940
395 Ga0075364_10068343
396 Ga0070716_100862254
397 Ga0075431_100152670
398 Ga0075433_10063671
399 Ga0075434_100002798
400 Ga0068865_100117702
401 Ga0075436_100225679
402 Ga0097620_100082738
403 Ga0075435_100448115
404 Ga0111539_10177230
405 Ga0105245_10000012
406 Ga0105245_10073844
407 Ga0105245_11996910
408 Ga0114129_10003248
409 Ga0105243_10005188
410 Ga0105243_10022821
411 Ga0105249_10000039
412 Ga0105249_10054170
413 Ga0105239_10090385
414 Ga0105239_10312019
415 Ga0157372_10097670
416 Ga0157372_10359094
417 Ga0157372_10426601
418 Ga0157375_10077397
419 Ga0163163_10078229
420 Ga0163163_10844670
421 Ga0157380_10000009
422 Ga0157380_10000277
423 Ga0157380_10017839
424 Ga0157377_10021854
425 Ga0157379_10069180
426 Ga0157379_10776417
427 Ga0157376_10014432
428 Ga0157376_10020413
429 Ga0207682_10000007
430 Ga0207692_10189824
431 Ga0207692_10368722
432 Ga0207642_10199028
433 Ga0207710_10000365
434 Ga0207688_10019077
435 Ga0207680_10129382
436 Ga0207643_10081993
437 Ga0207705_10016873
438 Ga0207671_10203968
439 Ga0207657_10003009
440 Ga0207649_10236085
441 Ga0207659_10079939
442 Ga0207687_10000011
443 Ga0207687_10031499
444 Ga0207687_10105065
445 Ga0207700_10000016
446 Ga0207664_10002111
447 Ga0207690_10004245
448 Ga0207690_10022473
449 Ga0207690_10126999
450 Ga0207706_10000302
451 Ga0207706_10012441
452 Ga0207686_10003881
453 Ga0207709_10024049
454 Ga0207709_10028292
455 Ga0207669_10097214
456 Ga0207704_10000009
457 Ga0207704_10133003
458 Ga0207665_10197650
459 Ga0207691_10000121
460 Ga0207691_10005127
461 Ga0207689_10252786
462 Ga0207661_10000275
463 Ga0207661_10007508
464 Ga0207661_10074623
465 Ga0207661_10681030
466 Ga0207679_10017962
467 Ga0207712_10000003
468 Ga0207712_10066444
469 Ga0207668_10106674
470 Ga0207640_10010938
471 Ga0207658_11040058
472 Ga0207677_10000218
473 Ga0207677_10003912
474 Ga0207677_10101584
475 Ga0207703_10000381
476 Ga0207703_10565401
477 Ga0207639_10085502
478 Ga0207639_10452360
479 Ga0207678_10004621
480 Ga0207708_10004311
481 Ga0207702_11601522
482 Ga0207648_10071665
483 Ga0207428_10652817
484 Ga0265337_1000074
485 Ga0265326_10000035
486 Ga0265323_10094192
487 Ga0265322_10000009
488 Ga0265336_10109224
489 Ga0265324_10000168
490 Ga0265328_10000939
491 Ga0265320_10000024
492 Ga0265329_10004276
493 Ga0265339_10011049
494 Ga0265331_10005065
495 Ga0265327_10000227
496 Ga0265316_10018834
497 Ga0265314_10000647
498 Ga0265342_10138236
499 Ga0316576_10149306
500 Ga0316578_10075298
501 Ga0307410_10771122
502 Ga0307410_11235118
503 Ga0307406_10035028
504 Ga0307406_10793594
505 Ga0307409_101384881
506 Ga0307416_100348316
507 Ga0307415_100079329
508 Ga0316583_10108680
509 Ga0316585_10053823
510 Ga0316580_10069223
511 Ga0316574_0033156
512 Ga0373937_1651679
513 Ga0316582_0005652
514 Ga0395905_0026420
515 Ga0395901_0763342
516 Ga0466957_0561130
517 Ga0466967_0081203
518 Ga0495603_0000054
519 Ga0495653_0715024
520 Ga0495662_0004031
521 Ga0495594_0000007
522 Ga0495596_0274175
523 Ga0495608_0102509
524 Ga0495608_0772730
525 Ga0495618_0630975
526 Ga0495640_0436369
527 Ga0495587_0129099
528 Ga0495598_0003049
529 Ga0495645_0484763
530 Ga0495622_0000437
531 Ga0495656_0034656
532 Ga0495668_0306469
533 Ga0495635_0036986
534 Ga0495635_0759371
535 Ga0495588_0000278
536 Ga0495613_0018352
537 Ga0495624_0003396
538 Ga0495600_0009512
539 Ga0495604_0000078
540 Ga0495674_0001786
541 Ga0496100_0000004
542 Ga0496100_0359315
543 Ga0496101_0000007
544 Ga0496102_0161367
545 Ga0496102_0243689
546 Ga0496103_0299680
547 Ga0496103_0816650
548 Ga0496104_0000003
549 Ga0496104_0000307
550 Ga0496105_0000003
551 Ga0496105_0000070
552 Ga0496106_0000004
553 Ga0496107_0000001
554 Ga0496107_0849986
555 Ga0496108_0000002
556 Ga0496108_0000202
557 Ga0496108_0047000
558 Ga0496109_0000001
559 Ga0496109_0000106
560 Ga0496109_0000131
561 Ga0496109_0038060
562 Ga0496109_0248293
563 Ga0496110_0098235
564 Ga0496111_0003706
565 Ga0496113_0023287
566 Ga0496113_1297707
567 Ga0496115_0024022
568 Ga0496118_0279205
569 Ga0496121_0289667
570 Ga0496125_0460075
571 Ga0501031_0002389
572 Ga0501032_0002564
573 Ga0501033_0085780
574 Ga0501034_0019089
575 Ga0501036_0006591
576 Ga0501037_0003409
577 Ga0501038_0109525
578 Ga0501039_0092234
579 Ga0501042_0080329
580 Ga0501042_0145106
581 Ga0501043_0085553
582 Ga0501046_0002906
583 Ga0501047_0004514
584 Ga0501048_0002887
585 Ga0501067_0039235
586 Ga0501068_0030303
587 Ga0501068_0091630
588 Ga0501068_0094640
589 Ga0501069_0052689
590 Ga0501069_0126089
591 Ga0501069_0459380
592 Ga0501070_0004138
593 Ga0501071_0091086
594 Ga0501073_0064789
595 Ga0501074_0010118
596 Ga0501075_0016038
597 Ga0501209_003280
598 Ga0501242_000255
599 Ga0501243_001894
600 Ga0501249_016928
601 Ga0501252_007315
602 Ga0501257_017893
603 Ga0501259_002665
604 Ga0501261_009299
605 Ga0501245_003636
606 Ga0501079_0099701
607 Ga0501080_0025145
608 Ga0501083_0062460
609 Ga0501264_006065
610 Ga0501266_000639
611 Ga0501267_024515
612 Ga0501268_009947
613 Ga0501035_0006173
614 Ga0501044_0007279
615 Ga0501204_054821
616 Ga0501212_021593
617 nmdc:mga05p37_12316_c1
618 nmdc:mga06r32_299352_c1
619 nmdc:mga08y16_1173157_c1
620 nmdc:mga0n895_13573_c1
621 nmdc:mga08x19_355995_c1
622 nmdc:mga0a205_67610_c1
623 Ga0495601_0007034
624 Ga0495601_0024999
625 Ga0495601_0051753
626 Ga0495655_0105694
627 Ga0495619_0000060
628 Ga0495619_0002877
629 Ga0495619_0006523
630 Ga0501082_0110822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14437

MafB19-deam

MafB19-like deaminase

25

172

0.98

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

24

125

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xpw-assembly1.cif.gz_A-2 structure of amphioxus igvj-c2 molecule 0.9893 32 45
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9801 10 147
5xpv-assembly1.cif.gz_B structure of the v domain of amphioxus igvj-c2 0.9797 32 45
1z3a-assembly1.cif.gz_B crystal structure of trna adenosine deaminase tada from escherichia coli 0.9792 10 147
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.9791 10 147
ID Description Score Start End Superfamily
af_A0A1D6PV52_1_75_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.986 50 107 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9806 8 147 3.40.140.10
1z3aA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9787 10 147 3.40.140.10
2nx8A00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9764 7 147 3.40.140.10
1wwrD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9738 10 147 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A838V119-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9866 7 148 GO:0002100
GO:0008270
GO:0052717
AF-A0A2V8QMJ3-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9836 10 147 GO:0002100
GO:0008270
GO:0052717
AF-A0A2N6EV60-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9831 9 147 GO:0002100
GO:0008270
GO:0052717
AF-A0A2Z5U1G1-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9831 7 147 GO:0002100
GO:0008270
GO:0052717
AF-A8AUL4-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9828 7 147 GO:0002100
GO:0008270
GO:0052717

Map