F403377

General Info

Members Datasets Scaffolds Average Seq Length
315 222 313 203

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0003773|Ga0501046_0003773_5320_6033
Length 237
Sequence MKPTLIFWYEFASTYSYLTAMRIDAEGARAGVAIEWRPFLLGPIFKSQGWTTSPFNVYPAKGRYMVRDITRIASERGLPFRMPETFPANGLKAARLAIAARGWGATAAFSRAVFEAQFAGGEDISDDDVLAACLTRVGLDPASVWPRIMDDSVKAALKRNTEMAQGLGIFGAPSFTTADNELFWGDDRLAEALRWASAPMALPNSADSPGSALIDSIAFKFRAFEPRRIGFRSASIP

Samples

Sample ID Description Type Environment
1 2821131069 Duganella sp. 1224 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
106 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
107 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
108 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 7.62
Rhizosphere 86.03
Stem 0
Stem Tuber 0
Unclassified 4.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10094954 3300003320 Bacteria 1447
2 rootL2_10033366 3300003322 Bacteria 2539
3 Ga0070683_100678956 3300005329 Bacteria 986
4 Ga0070670_100004565 3300005331 Bacteria 11615
5 Ga0070677_10276574 3300005333 Bacteria 844
6 Ga0070666_10272663 3300005335 Bacteria 1201
7 Ga0070680_100134119 3300005336 Bacteria 2073
8 Ga0070682_100067328 3300005337 Bacteria 2280
9 Ga0070689_100343253 3300005340 Bacteria 1251
10 Ga0070691_10032221 3300005341 Bacteria 2462
11 Ga0070687_100548689 3300005343 Unclassified 786
12 Ga0070661_100613917 3300005344 Bacteria 880
13 Ga0070692_10287328 3300005345 Bacteria 999
14 Ga0070668_100331253 3300005347 Bacteria 1284
15 Ga0070673_100156928 3300005364 Bacteria 1932
16 Ga0070688_100398452 3300005365 Bacteria 1018
17 Ga0070667_100082688 3300005367 Bacteria 2750
18 Ga0070709_10067503 3300005434 Bacteria 2296
19 Ga0070711_100465922 3300005439 Bacteria 1036
20 Ga0070705_100035546 3300005440 Bacteria 2794
21 Ga0070663_100003136 3300005455 Bacteria 9473
22 Ga0070678_100434114 3300005456 Unclassified 1147
23 Ga0070662_100622425 3300005457 Bacteria 909
24 Ga0070681_10130645 3300005458 Bacteria 2444
25 Ga0070698_100084035 3300005471 Bacteria 3172
26 Ga0070679_100172168 3300005530 Bacteria 2138
27 Ga0070697_100259103 3300005536 Bacteria 1489
28 Ga0068853_100002522 3300005539 Bacteria 13742
29 Ga0070696_100016468 3300005546 Bacteria 4979
30 Ga0070696_100082908 3300005546 Bacteria 2273
31 Ga0070693_100641290 3300005547 Unclassified 771
32 Ga0070665_100668532 3300005548 Bacteria 1052
33 Ga0070704_100436050 3300005549 Bacteria 1125
34 Ga0068855_100237545 3300005563 Bacteria 2037
35 Ga0070664_100246525 3300005564 Bacteria 1605
36 Ga0068857_100041868 3300005577 Bacteria 4062
37 Ga0068854_100078310 3300005578 Bacteria 2435
38 Ga0068854_100947887 3300005578 Bacteria 759
39 Ga0068856_100203774 3300005614 Bacteria 1993
40 Ga0070702_100052285 3300005615 Bacteria 2342
41 Ga0068852_100113225 3300005616 Bacteria 2470
42 Ga0068859_100144985 3300005617 Bacteria 2449
43 Ga0068861_100376434 3300005719 Bacteria 1253
44 Ga0068858_100251739 3300005842 Bacteria 1678
45 Ga0068862_100703761 3300005844 Bacteria 979
46 Ga0081540_1003306 3300005983 Bacteria 12790
47 Ga0070717_10089874 3300006028 Bacteria 2591
48 Ga0070715_10034265 3300006163 Bacteria 2080
49 Ga0075428_100907313 3300006844 Bacteria 934
50 Ga0075431_100604653 3300006847 Bacteria 1080
51 Ga0075433_10343504 3300006852 Bacteria 1319
52 Ga0097620_100144979 3300006931 Bacteria 2449
53 Ga0075435_100753898 3300007076 Bacteria 847
54 Ga0099795_10154077 3300007788 Bacteria 943
55 Ga0111539_10041494 3300009094 Bacteria 5532
56 Ga0105245_10041156 3300009098 Bacteria 4119
57 Ga0105245_10098281 3300009098 Bacteria 2705
58 Ga0114129_10035879 3300009147 Bacteria 7002
59 Ga0114129_10212920 3300009147 Bacteria 2611
60 Ga0114129_12021828 3300009147 Bacteria 696
61 Ga0105243_10023527 3300009148 Bacteria 4692
62 Ga0105237_10162026 3300009545 Bacteria 2235
63 Ga0105238_10007426 3300009551 Bacteria 10978
64 Ga0105239_10131957 3300010375 Bacteria 2779
65 Ga0105239_10992872 3300010375 Bacteria 965
66 Ga0105246_10009245 3300011119 Bacteria 6070
67 Ga0157373_10270964 3300013100 Bacteria 1202
68 Ga0157371_10000161 3300013102 Bacteria 98412
69 Ga0157370_10154977 3300013104 Bacteria 2131
70 Ga0157374_10496064 3300013296 Bacteria 1225
71 Ga0157378_10158446 3300013297 Bacteria 2115
72 Ga0163162_10900605 3300013306 Unclassified 998
73 Ga0157375_10119432 3300013308 Bacteria 2744
74 Ga0157375_10211565 3300013308 Bacteria 2097
75 Ga0163163_10009138 3300014325 Bacteria 8833
76 Ga0157380_10324102 3300014326 Bacteria 1430
77 Ga0157380_10360047 3300014326 Bacteria 1364
78 Ga0157379_10042595 3300014968 Bacteria 4054
79 Ga0157379_10068063 3300014968 Bacteria 3183
80 Ga0213872_10000001 3300021361 Bacteria 662532
81 Ga0213872_10036546 3300021361 Bacteria 2245
82 Ga0207680_10355994 3300025903 Bacteria 1029
83 Ga0207705_10384318 3300025909 Bacteria 1084
84 Ga0207654_10031487 3300025911 Bacteria 2922
85 Ga0207707_10135676 3300025912 Bacteria 2152
86 Ga0207693_10028242 3300025915 Bacteria 4432
87 Ga0207660_10072075 3300025917 Bacteria 2515
88 Ga0207652_10347798 3300025921 Bacteria 1338
89 Ga0207650_10006857 3300025925 Bacteria 7767
90 Ga0207687_10102508 3300025927 Bacteria 2108
91 Ga0207700_10165243 3300025928 Bacteria 1841
92 Ga0207644_10551755 3300025931 Bacteria 954
93 Ga0207690_10086288 3300025932 Bacteria 2205
94 Ga0207706_10670243 3300025933 Bacteria 887
95 Ga0207709_10087118 3300025935 Bacteria 2029
96 Ga0207665_10011235 3300025939 Bacteria 5875
97 Ga0207661_10327222 3300025944 Bacteria 1379
98 Ga0207667_10357435 3300025949 Bacteria 1489
99 Ga0207651_10680091 3300025960 Bacteria 905
100 Ga0207668_10188656 3300025972 Bacteria 1632
101 Ga0207640_10087720 3300025981 Bacteria 2146
102 Ga0207658_10282268 3300025986 Bacteria 1424
103 Ga0207703_10145601 3300026035 Bacteria 2060
104 Ga0207703_10797328 3300026035 Bacteria 902
105 Ga0207678_10000231 3300026067 Bacteria 49870
106 Ga0207702_10271470 3300026078 Bacteria 1600
107 Ga0207641_10540475 3300026088 Bacteria 1135
108 Ga0207674_10079554 3300026116 Bacteria 3282
109 Ga0207675_100215513 3300026118 Unclassified 1848
110 Ga0209179_1051643 3300027512 Bacteria 882
111 Ga0207428_10026521 3300027907 Bacteria 4837
112 Ga0268266_10213469 3300028379 Bacteria 1771
113 Ga0268266_10398673 3300028379 Bacteria 1301
114 Ga0265337_1004357 3300028556 Bacteria 5886
115 Ga0265338_10203699 3300028800 Bacteria 1490
116 Ga0316177_1136365 3300030731 Bacteria 7091
117 Ga0314311_1044667 3300030733 Bacteria 945
118 Ga0316180_1015248 3300030736 Bacteria 2911
119 Ga0316182_1130770 3300030745 Bacteria 12095
120 Ga0265332_10113423 3300031238 Bacteria 1140
121 Ga0265320_10002442 3300031240 Bacteria 12946
122 Ga0307409_100686190 3300031995 Unclassified 1022
123 Ga0373927_0097990 3300035695 Bacteria 1906
124 Ga0395898_0052904 3300037466 Bacteria 3966
125 Ga0395898_0745004 3300037466 Unclassified 921
126 Ga0395905_0274607 3300037471 Unclassified 1571
127 Ga0395905_0280073 3300037471 Bacteria 1554
128 Ga0395901_0129430 3300038443 Bacteria 2653
129 Ga0395901_0486027 3300038443 Bacteria 1259
130 Ga0400483_087171 3300039062 Bacteria 1211
131 Ga0436361_0401187 3300039447 Bacteria 5204
132 Ga0436361_0404657 3300039447 Bacteria 144351
133 Ga0439448_0056001 3300042005 Bacteria 1297
134 Ga0439458_0039785 3300042157 Bacteria 1138
135 Ga0466972_0005337 3300044658 Bacteria 6438
136 Ga0466965_0011873 3300044683 Bacteria 4089
137 Ga0466966_0055330 3300044684 Bacteria 2511
138 Ga0466966_0094532 3300044684 Bacteria 1853
139 Ga0466966_0098309 3300044684 Bacteria 1812
140 Ga0466964_0001175 3300044706 Bacteria 8845
141 Ga0466968_0002338 3300044735 Bacteria 6934
142 Ga0466970_0114940 3300044765 Bacteria 1471
143 Ga0495590_0041780 3300046457 Bacteria 1599
144 Ga0495629_0050819 3300046459 Bacteria 2902
145 Ga0495638_0071295 3300046460 Bacteria 2126
146 Ga0495653_0000397 3300046463 Bacteria 34937
147 Ga0495653_0142588 3300046463 Bacteria 1683
148 Ga0495650_0002402 3300046471 Bacteria 15281
149 Ga0495582_0003085 3300046473 Bacteria 9340
150 Ga0495605_0000160 3300046474 Bacteria 86202
151 Ga0495605_0030762 3300046474 Bacteria 2749
152 Ga0495605_0054629 3300046474 Bacteria 1933
153 Ga0495584_0000390 3300046491 Bacteria 30206
154 Ga0495584_0002379 3300046491 Bacteria 10693
155 Ga0495584_0004006 3300046491 Bacteria 7949
156 Ga0495584_0201567 3300046491 Bacteria 1011
157 Ga0495596_0012251 3300046500 Bacteria 3677
158 Ga0495596_0017320 3300046500 Bacteria 2985
159 Ga0495596_0026190 3300046500 Bacteria 2351
160 Ga0495607_0010437 3300046501 Bacteria 6244
161 Ga0495607_0011676 3300046501 Bacteria 5833
162 Ga0495607_0078884 3300046501 Bacteria 1815
163 Ga0495583_0000890 3300046506 Bacteria 35810
164 Ga0495583_0015101 3300046506 Bacteria 4217
165 Ga0495583_0035296 3300046506 Bacteria 2387
166 Ga0495606_0000169 3300046507 Bacteria 115434
167 Ga0495606_0002709 3300046507 Bacteria 19972
168 Ga0495606_0120924 3300046507 Bacteria 1568
169 Ga0495616_0000170 3300046513 Bacteria 56058
170 Ga0495616_0001444 3300046513 Bacteria 16538
171 Ga0495616_0232778 3300046513 Bacteria 798
172 Ga0495631_0004269 3300046518 Bacteria 7637
173 Ga0495631_0124652 3300046518 Bacteria 1107
174 Ga0495631_0253816 3300046518 Bacteria 749
175 Ga0495637_0000439 3300046520 Bacteria 30319
176 Ga0495637_0095188 3300046520 Bacteria 1169
177 Ga0495643_0000171 3300046522 Bacteria 103167
178 Ga0495643_0000552 3300046522 Bacteria 46298
179 Ga0495643_0008044 3300046522 Bacteria 6722
180 Ga0495643_0127495 3300046522 Bacteria 1280
181 Ga0495648_0001544 3300046524 Bacteria 22488
182 Ga0495648_0007512 3300046524 Bacteria 8718
183 Ga0495642_0001094 3300046528 Bacteria 12522
184 Ga0495642_0001857 3300046528 Bacteria 9016
185 Ga0495642_0042998 3300046528 Bacteria 1842
186 Ga0495654_0000025 3300046530 Bacteria 236572
187 Ga0495654_0007685 3300046530 Bacteria 5999
188 Ga0495640_0065580 3300046533 Bacteria 2451
189 Ga0495609_0034043 3300046538 Bacteria 2311
190 Ga0495609_0267652 3300046538 Bacteria 701
191 Ga0495597_0002475 3300046542 Bacteria 11661
192 Ga0495597_0007079 3300046542 Bacteria 5741
193 Ga0495597_0208780 3300046542 Bacteria 779
194 Ga0495656_0407117 3300046615 Bacteria 712
195 Ga0495668_0015668 3300046616 Bacteria 4420
196 Ga0495668_0037858 3300046616 Bacteria 2697
197 Ga0495668_0262634 3300046616 Bacteria 945
198 Ga0495625_0003503 3300046660 Bacteria 15554
199 Ga0495625_0178069 3300046660 Bacteria 1416
200 Ga0495661_0001236 3300046665 Bacteria 22115
201 Ga0495661_0003616 3300046665 Bacteria 11388
202 Ga0495661_0009183 3300046665 Bacteria 6793
203 Ga0495661_0041547 3300046665 Bacteria 2844
204 Ga0495661_0129197 3300046665 Bacteria 1386
205 Ga0495588_0000052 3300046674 Bacteria 304493
206 Ga0495588_0072780 3300046674 Bacteria 1788
207 Ga0495669_0000092 3300046684 Bacteria 59765
208 Ga0495613_0072166 3300046689 Bacteria 2516
209 Ga0495671_0068190 3300046692 Bacteria 1749
210 Ga0495671_0206432 3300046692 Bacteria 952
211 Ga0495649_0028201 3300046694 Bacteria 3112
212 Ga0495589_0000058 3300046794 Bacteria 107640
213 Ga0495589_0021249 3300046794 Bacteria 3316
214 Ga0495589_0084493 3300046794 Bacteria 1543
215 Ga0495660_0000050 3300046810 Bacteria 140329
216 Ga0495660_0008871 3300046810 Bacteria 5874
217 Ga0495672_0006470 3300047320 Bacteria 9062
218 Ga0495672_0011075 3300047320 Bacteria 6384
219 Ga0495676_0362968 3300047321 Bacteria 967
220 Ga0495683_0009591 3300047323 Bacteria 5154
221 Ga0495683_0095753 3300047323 Bacteria 1433
222 Ga0495683_0221153 3300047323 Bacteria 844
223 Ga0495687_000073 3300047443 Bacteria 155429
224 Ga0495687_000103 3300047443 Bacteria 128840
225 Ga0495687_000489 3300047443 Bacteria 47669
226 Ga0495687_193527 3300047443 Bacteria 652
227 Ga0495677_0006075 3300047445 Bacteria 4564
228 Ga0495677_0006784 3300047445 Bacteria 4307
229 Ga0495677_0017091 3300047445 Bacteria 2630
230 Ga0495677_0026476 3300047445 Bacteria 2104
231 Ga0495681_0043617 3300047470 Bacteria 2161
232 Ga0495681_0044676 3300047470 Bacteria 2126
233 Ga0495684_0339830 3300047471 Bacteria 1069
234 Ga0495614_0014723 3300048089 Bacteria 3421
235 Ga0495626_0000145 3300048091 Bacteria 89603
236 Ga0495626_0008221 3300048091 Bacteria 5745
237 Ga0495626_0039872 3300048091 Bacteria 2220
238 Ga0496100_0024071 3300048903 Bacteria 3709
239 Ga0496100_0081723 3300048903 Bacteria 2183
240 Ga0496101_0094623 3300048904 Bacteria 2227
241 Ga0496101_0140383 3300048904 Bacteria 1841
242 Ga0496102_0030165 3300048905 Bacteria 4853
243 Ga0496102_0161117 3300048905 Bacteria 2110
244 Ga0496103_0014278 3300048906 Bacteria 4716
245 Ga0496104_0101437 3300048907 Bacteria 2755
246 Ga0496104_0112482 3300048907 Bacteria 2611
247 Ga0496105_0002468 3300048908 Bacteria 13388
248 Ga0496106_0010982 3300048909 Bacteria 6696
249 Ga0496106_0105395 3300048909 Bacteria 2191
250 Ga0496107_0052725 3300048910 Bacteria 2933
251 Ga0496109_0003965 3300048912 Bacteria 12359
252 Ga0496109_0455187 3300048912 Bacteria 1209
253 Ga0496110_0042046 3300048913 Bacteria 3989
254 Ga0496110_0061581 3300048913 Bacteria 3312
255 Ga0496111_0006988 3300048914 Bacteria 7369
256 Ga0496111_0404584 3300048914 Bacteria 1008
257 Ga0496112_0000845 3300048915 Bacteria 21851
258 Ga0496113_0000630 3300048916 Bacteria 17715
259 Ga0496113_0347734 3300048916 Bacteria 1189
260 Ga0496115_0003958 3300048918 Bacteria 10687
261 Ga0496115_0351479 3300048918 Bacteria 1202
262 Ga0496119_0116474 3300048922 Bacteria 1475
263 Ga0496122_0005248 3300048925 Bacteria 15531
264 Ga0496123_0010462 3300048926 Bacteria 8197
265 Ga0496123_0022828 3300048926 Bacteria 4807
266 Ga0496124_0000479 3300048927 Bacteria 68855
267 Ga0496124_0125639 3300048927 Bacteria 2044
268 Ga0496124_0134658 3300048927 Bacteria 1958
269 Ga0496125_0008556 3300048928 Bacteria 10690
270 Ga0496126_0179060 3300048929 Bacteria 1802
271 Ga0495678_000232 3300049459 Bacteria 63796
272 Ga0495682_0000210 3300049460 Bacteria 47048
273 Ga0501032_0006465 3300049569 Bacteria 8617
274 Ga0501032_0421918 3300049569 Bacteria 856
275 Ga0501034_0000166 3300049571 Bacteria 122782
276 Ga0501034_0104974 3300049571 Bacteria 2819
277 Ga0501034_0710856 3300049571 Unclassified 903
278 Ga0501036_0020796 3300049572 Bacteria 5512
279 Ga0501037_0002056 3300049573 Bacteria 14595
280 Ga0501038_0069334 3300049574 Bacteria 2995
281 Ga0501039_0000554 3300049575 Bacteria 27105
282 Ga0501043_0021245 3300049579 Bacteria 5089
283 Ga0501046_0003773 3300049580 Bacteria 13874
284 Ga0501046_0441828 3300049580 Bacteria 936
285 Ga0501047_0001189 3300049581 Bacteria 25783
286 Ga0501048_0004019 3300049582 Bacteria 11180
287 Ga0501067_0000576 3300049583 Bacteria 19849
288 Ga0501070_0013716 3300049586 Bacteria 6824
289 Ga0501073_0030561 3300049589 Bacteria 3845
290 Ga0501077_0167873 3300049593 Bacteria 1394
291 Ga0501080_0000075 3300049742 Bacteria 66767
292 Ga0501081_0597967 3300049743 Bacteria 826
293 Ga0501035_0000084 3300049822 Bacteria 116222
294 Ga0501044_0000073 3300049823 Bacteria 122507
295 nmdc:mga05p37_11562_c1 3300050507 Bacteria 10515
296 nmdc:mga05p37_524333_c1 3300050507 Bacteria 1354
297 nmdc:mga05p37_668037_c1 3300050507 Bacteria 1160
298 nmdc:mga09592_122144_c1 3300050508 Bacteria 2238
299 nmdc:mga08y16_71088_c1 3300050511 Bacteria 3627
300 nmdc:mga0n895_599241_c1 3300050512 Bacteria 1104
301 nmdc:mga0n895_77979_c1 3300050512 Bacteria 3296
302 nmdc:mga0rr50_11785_c1 3300050513 Bacteria 5613
303 nmdc:mga0a205_248068_c1 3300050515 Bacteria 1660
304 Ga0495595_0152554 3300053084 Bacteria 1137
305 Ga0495619_0298252 3300053085 Bacteria 1117
306 Ga0500644_0002262 3300053088 Bacteria 4856
307 Ga0500651_0005518 3300053093 Bacteria 7227
308 Ga0500595_000001 3300053119 Bacteria 1088438
309 Ga0500595_051681 3300053119 Bacteria 1272
310 Ga0500577_0119762 3300053142 Bacteria 1095
311 Ga0500616_0000001 3300053153 Bacteria 1986011
312 Ga0500616_0096527 3300053153 Unclassified 1452
313 Ga0501082_0125497 3300060353 Bacteria 2226

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0232778 Ga0495616_0232778_25_663 181
2 3300044765 Ga0466970_0114940 Ga0466970_0114940_885_1454 183
3 iso_pu_bacteria 2821131069 2821136162 192
4 iso_pu_bacteria 8047673197 8047674918 192
5 3300046463 Ga0495653_0142588 Ga0495653_0142588_577_1158 193
6 3300021361 Ga0213872_10000001 Ga0213872_10000001110 194
7 3300039447 Ga0436361_0404657 Ga0436361_0404657_115603_116190 194
8 3300048926 Ga0496123_0010462 Ga0496123_0010462_20_607 194
9 3300046460 Ga0495638_0071295 Ga0495638_0071295_993_1583 195
10 3300046463 Ga0495653_0000397 Ga0495653_0000397_27234_27824 195
11 3300046471 Ga0495650_0002402 Ga0495650_0002402_9239_9829 195
12 3300046507 Ga0495606_0000169 Ga0495606_0000169_36940_37530 195
13 3300046520 Ga0495637_0000439 Ga0495637_0000439_6176_6763 195
14 3300046522 Ga0495643_0127495 Ga0495643_0127495_663_1253 195
15 3300046524 Ga0495648_0007512 Ga0495648_0007512_2124_2714 195
16 3300046530 Ga0495654_0000025 Ga0495654_0000025_64775_65362 195
17 3300046660 Ga0495625_0003503 Ga0495625_0003503_12428_13018 195
18 3300046692 Ga0495671_0206432 Ga0495671_0206432_249_839 195
19 3300025909 Ga0207705_10384318 Ga0207705_103843181 196
20 3300037471 Ga0395905_0280073 Ga0395905_0280073_71_661 196
21 3300038443 Ga0395901_0129430 Ga0395901_0129430_1588_2181 196
22 3300038443 Ga0395901_0486027 Ga0395901_0486027_338_937 196
23 3300042005 Ga0439448_0056001 Ga0439448_0056001_609_1199 196
24 3300042157 Ga0439458_0039785 Ga0439458_0039785_22_612 196
25 3300046457 Ga0495590_0041780 Ga0495590_0041780_649_1239 196
26 3300046474 Ga0495605_0000160 Ga0495605_0000160_62546_63136 196
27 3300046501 Ga0495607_0010437 Ga0495607_0010437_4329_4919 196
28 3300046501 Ga0495607_0011676 Ga0495607_0011676_3932_4522 196
29 3300046522 Ga0495643_0000552 Ga0495643_0000552_35566_36156 196
30 3300046522 Ga0495643_0008044 Ga0495643_0008044_835_1425 196
31 3300046524 Ga0495648_0001544 Ga0495648_0001544_9012_9602 196
32 3300046528 Ga0495642_0001857 Ga0495642_0001857_3060_3650 196
33 3300046542 Ga0495597_0208780 Ga0495597_0208780_134_724 196
34 3300046665 Ga0495661_0001236 Ga0495661_0001236_1861_2451 196
35 3300046665 Ga0495661_0003616 Ga0495661_0003616_2202_2801 196
36 3300046665 Ga0495661_0009183 Ga0495661_0009183_6082_6672 196
37 3300046794 Ga0495589_0000058 Ga0495589_0000058_66187_66777 196
38 3300046810 Ga0495660_0000050 Ga0495660_0000050_107168_107758 196
39 3300047320 Ga0495672_0006470 Ga0495672_0006470_3575_4165 196
40 3300047323 Ga0495683_0095753 Ga0495683_0095753_134_724 196
41 3300047443 Ga0495687_000489 Ga0495687_000489_22919_23509 196
42 3300047445 Ga0495677_0006075 Ga0495677_0006075_152_742 196
43 3300047445 Ga0495677_0017091 Ga0495677_0017091_754_1344 196
44 3300047445 Ga0495677_0026476 Ga0495677_0026476_376_966 196
45 3300048091 Ga0495626_0000145 Ga0495626_0000145_66187_66777 196
46 3300048927 Ga0496124_0125639 Ga0496124_0125639_900_1490 196
47 3300013102 Ga0157371_10000161 Ga0157371_1000016130 197
48 3300030731 Ga0316177_1136365 Ga0316177_11363654 197
49 3300030733 Ga0314311_1044667 Ga0314311_10446672 197
50 3300030736 Ga0316180_1015248 Ga0316180_10152484 197
51 3300039062 Ga0400483_087171 Ga0400483_087171_342_944 197
52 3300044658 Ga0466972_0005337 Ga0466972_0005337_5121_5720 197
53 3300044683 Ga0466965_0011873 Ga0466965_0011873_1942_2541 197
54 3300044706 Ga0466964_0001175 Ga0466964_0001175_3318_3917 197
55 3300044735 Ga0466968_0002338 Ga0466968_0002338_5487_6086 197
56 3300046507 Ga0495606_0002709 Ga0495606_0002709_4301_4903 197
57 3300046507 Ga0495606_0120924 Ga0495606_0120924_754_1347 197
58 3300046810 Ga0495660_0008871 Ga0495660_0008871_1744_2337 197
59 3300047443 Ga0495687_000073 Ga0495687_000073_136214_136816 197
60 3300047443 Ga0495687_193527 Ga0495687_193527_42_641 197
61 3300048916 Ga0496113_0347734 Ga0496113_0347734_184_780 197
62 3300048925 Ga0496122_0005248 Ga0496122_0005248_6140_6733 197
63 3300048926 Ga0496123_0022828 Ga0496123_0022828_864_1457 197
64 3300048927 Ga0496124_0134658 Ga0496124_0134658_974_1570 197
65 3300005343 Ga0070687_100548689 Ga0070687_1005486891 198
66 3300005364 Ga0070673_100156928 Ga0070673_1001569283 198
67 3300005365 Ga0070688_100398452 Ga0070688_1003984521 198
68 3300005457 Ga0070662_100622425 Ga0070662_1006224251 198
69 3300005549 Ga0070704_100436050 Ga0070704_1004360502 198
70 3300005578 Ga0068854_100947887 Ga0068854_1009478871 198
71 3300005719 Ga0068861_100376434 Ga0068861_1003764342 198
72 3300006844 Ga0075428_100907313 Ga0075428_1009073131 198
73 3300006847 Ga0075431_100604653 Ga0075431_1006046532 198
74 3300009094 Ga0111539_10041494 Ga0111539_100414944 198
75 3300009098 Ga0105245_10041156 Ga0105245_100411562 198
76 3300009147 Ga0114129_10035879 Ga0114129_100358793 198
77 3300013306 Ga0163162_10900605 Ga0163162_109006052 198
78 3300013308 Ga0157375_10211565 Ga0157375_102115652 198
79 3300014326 Ga0157380_10360047 Ga0157380_103600472 198
80 3300014968 Ga0157379_10068063 Ga0157379_100680632 198
81 3300025927 Ga0207687_10102508 Ga0207687_101025082 198
82 3300025931 Ga0207644_10551755 Ga0207644_105517552 198
83 3300025960 Ga0207651_10680091 Ga0207651_106800912 198
84 3300026088 Ga0207641_10540475 Ga0207641_105404752 198
85 3300026118 Ga0207675_100215513 Ga0207675_1002155133 198
86 3300037471 Ga0395905_0274607 Ga0395905_0274607_504_1118 198
87 3300048913 Ga0496110_0042046 Ga0496110_0042046_821_1426 198
88 3300048914 Ga0496111_0404584 Ga0496111_0404584_317_922 198
89 3300048927 Ga0496124_0000479 Ga0496124_0000479_32449_33054 198
90 3300048928 Ga0496125_0008556 Ga0496125_0008556_3436_4041 198
91 3300050507 nmdc:mga05p37_668037_c1 nmdc:mga05p37_668037_c1_344_940 198
92 3300050508 nmdc:mga09592_122144_c1 nmdc:mga09592_122144_c1_660_1265 198
93 3300050511 nmdc:mga08y16_71088_c1 nmdc:mga08y16_71088_c1_1504_2109 198
94 3300003322 rootL2_10033366 rootL2_100333663 199
95 3300005333 Ga0070677_10276574 Ga0070677_102765741 199
96 3300005347 Ga0070668_100331253 Ga0070668_1003312531 199
97 3300005536 Ga0070697_100259103 Ga0070697_1002591032 199
98 3300005548 Ga0070665_100668532 Ga0070665_1006685322 199
99 3300005844 Ga0068862_100703761 Ga0068862_1007037612 199
100 3300005983 Ga0081540_1003306 Ga0081540_10033066 199
101 3300021361 Ga0213872_10036546 Ga0213872_100365462 199
102 3300025933 Ga0207706_10670243 Ga0207706_106702432 199
103 3300025972 Ga0207668_10188656 Ga0207668_101886563 199
104 3300028379 Ga0268266_10213469 Ga0268266_102134692 199
105 3300028379 Ga0268266_10398673 Ga0268266_103986732 199
106 3300028556 Ga0265337_1004357 Ga0265337_10043573 199
107 3300031238 Ga0265332_10113423 Ga0265332_101134232 199
108 3300031240 Ga0265320_10002442 Ga0265320_1000244212 199
109 3300037466 Ga0395898_0052904 Ga0395898_0052904_2641_3249 199
110 3300039447 Ga0436361_0401187 Ga0436361_0401187_3173_3790 199
111 3300044684 Ga0466966_0098309 Ga0466966_0098309_848_1447 199
112 3300046474 Ga0495605_0054629 Ga0495605_0054629_849_1448 199
113 3300046491 Ga0495584_0002379 Ga0495584_0002379_5075_5674 199
114 3300046528 Ga0495642_0042998 Ga0495642_0042998_395_994 199
115 3300046530 Ga0495654_0007685 Ga0495654_0007685_3094_3693 199
116 3300046538 Ga0495609_0034043 Ga0495609_0034043_109_708 199
117 3300046542 Ga0495597_0002475 Ga0495597_0002475_3393_3992 199
118 3300046616 Ga0495668_0037858 Ga0495668_0037858_1384_1983 199
119 3300046794 Ga0495589_0084493 Ga0495589_0084493_757_1356 199
120 3300047320 Ga0495672_0011075 Ga0495672_0011075_3999_4598 199
121 3300049593 Ga0501077_0167873 Ga0501077_0167873_344_946 199
122 3300053088 Ga0500644_0002262 Ga0500644_0002262_1887_2525 199
123 3300053093 Ga0500651_0005518 Ga0500651_0005518_3698_4336 199
124 3300053119 Ga0500595_000001 Ga0500595_000001_642691_643329 199
125 3300053142 Ga0500577_0119762 Ga0500577_0119762_268_906 199
126 3300053153 Ga0500616_0000001 Ga0500616_0000001_1344847_1345485 199
127 3300053153 Ga0500616_0096527 Ga0500616_0096527_418_1056 199
128 3300005471 Ga0070698_100084035 Ga0070698_1000840352 200
129 3300025944 Ga0207661_10327222 Ga0207661_103272222 200
130 3300028800 Ga0265338_10203699 Ga0265338_102036992 200
131 3300031995 Ga0307409_100686190 Ga0307409_1006861902 200
132 3300035695 Ga0373927_0097990 Ga0373927_0097990_1103_1714 200
133 3300046491 Ga0495584_0000390 Ga0495584_0000390_7656_8267 200
134 3300046500 Ga0495596_0026190 Ga0495596_0026190_192_806 200
135 3300046506 Ga0495583_0015101 Ga0495583_0015101_3551_4153 200
136 3300046513 Ga0495616_0001444 Ga0495616_0001444_8003_8617 200
137 3300046518 Ga0495631_0004269 Ga0495631_0004269_3556_4170 200
138 3300046528 Ga0495642_0001094 Ga0495642_0001094_9192_9806 200
139 3300046660 Ga0495625_0178069 Ga0495625_0178069_431_1033 200
140 3300046665 Ga0495661_0129197 Ga0495661_0129197_509_1120 200
141 3300046674 Ga0495588_0000052 Ga0495588_0000052_17493_18104 200
142 3300046694 Ga0495649_0028201 Ga0495649_0028201_568_1182 200
143 3300047323 Ga0495683_0009591 Ga0495683_0009591_751_1365 200
144 3300047470 Ga0495681_0044676 Ga0495681_0044676_820_1422 200
145 3300048091 Ga0495626_0039872 Ga0495626_0039872_1315_1929 200
146 3300048909 Ga0496106_0105395 Ga0496106_0105395_982_1593 200
147 3300048912 Ga0496109_0455187 Ga0496109_0455187_234_839 200
148 3300049459 Ga0495678_000232 Ga0495678_000232_41094_41708 200
149 3300049460 Ga0495682_0000210 Ga0495682_0000210_37846_38460 200
150 3300049580 Ga0501046_0441828 Ga0501046_0441828_140_745 200
151 3300005434 Ga0070709_10067503 Ga0070709_100675033 201
152 3300005546 Ga0070696_100082908 Ga0070696_1000829081 201
153 3300006028 Ga0070717_10089874 Ga0070717_100898741 201
154 3300006163 Ga0070715_10034265 Ga0070715_100342652 201
155 3300007788 Ga0099795_10154077 Ga0099795_101540771 201
156 3300009147 Ga0114129_12021828 Ga0114129_120218281 201
157 3300025915 Ga0207693_10028242 Ga0207693_100282425 201
158 3300025939 Ga0207665_10011235 Ga0207665_100112355 201
159 3300027512 Ga0209179_1051643 Ga0209179_10516431 201
160 3300044684 Ga0466966_0055330 Ga0466966_0055330_1009_1632 201
161 3300046474 Ga0495605_0030762 Ga0495605_0030762_1319_1957 201
162 3300046500 Ga0495596_0017320 Ga0495596_0017320_1525_2130 201
163 3300046506 Ga0495583_0000890 Ga0495583_0000890_32563_33186 201
164 3300046513 Ga0495616_0000170 Ga0495616_0000170_5589_6212 201
165 3300046520 Ga0495637_0095188 Ga0495637_0095188_453_1076 201
166 3300046522 Ga0495643_0000171 Ga0495643_0000171_97663_98301 201
167 3300046615 Ga0495656_0407117 Ga0495656_0407117_38_661 201
168 3300048904 Ga0496101_0140383 Ga0496101_0140383_198_806 201
169 3300048910 Ga0496107_0052725 Ga0496107_0052725_639_1247 201
170 3300048918 Ga0496115_0351479 Ga0496115_0351479_566_1174 201
171 3300049743 Ga0501081_0597967 Ga0501081_0597967_85_693 201
172 3300009098 Ga0105245_10098281 Ga0105245_100982812 202
173 3300010375 Ga0105239_10992872 Ga0105239_109928721 202
174 3300030745 Ga0316182_1130770 Ga0316182_113077010 202
175 3300044684 Ga0466966_0094532 Ga0466966_0094532_33_680 202
176 3300046459 Ga0495629_0050819 Ga0495629_0050819_1426_2037 202
177 3300046473 Ga0495582_0003085 Ga0495582_0003085_4471_5082 202
178 3300046491 Ga0495584_0004006 Ga0495584_0004006_3038_3649 202
179 3300046491 Ga0495584_0201567 Ga0495584_0201567_238_849 202
180 3300046500 Ga0495596_0012251 Ga0495596_0012251_269_880 202
181 3300046501 Ga0495607_0078884 Ga0495607_0078884_659_1270 202
182 3300046506 Ga0495583_0035296 Ga0495583_0035296_360_971 202
183 3300046518 Ga0495631_0124652 Ga0495631_0124652_104_715 202
184 3300046518 Ga0495631_0253816 Ga0495631_0253816_39_650 202
185 3300046538 Ga0495609_0267652 Ga0495609_0267652_47_658 202
186 3300046542 Ga0495597_0007079 Ga0495597_0007079_2616_3227 202
187 3300046616 Ga0495668_0015668 Ga0495668_0015668_900_1511 202
188 3300046616 Ga0495668_0262634 Ga0495668_0262634_204_815 202
189 3300046665 Ga0495661_0041547 Ga0495661_0041547_1695_2342 202
190 3300046674 Ga0495588_0072780 Ga0495588_0072780_919_1530 202
191 3300046684 Ga0495669_0000092 Ga0495669_0000092_43332_43943 202
192 3300046689 Ga0495613_0072166 Ga0495613_0072166_386_997 202
193 3300046794 Ga0495589_0021249 Ga0495589_0021249_1606_2244 202
194 3300047443 Ga0495687_000103 Ga0495687_000103_43242_43880 202
195 3300047445 Ga0495677_0006784 Ga0495677_0006784_381_992 202
196 3300047470 Ga0495681_0043617 Ga0495681_0043617_386_997 202
197 3300048089 Ga0495614_0014723 Ga0495614_0014723_2523_3134 202
198 3300048091 Ga0495626_0008221 Ga0495626_0008221_280_891 202
199 3300006852 Ga0075433_10343504 Ga0075433_103435042 203
200 3300048929 Ga0496126_0179060 Ga0496126_0179060_772_1383 203
201 3300050515 nmdc:mga0a205_248068_c1 nmdc:mga0a205_248068_c1_88_702 203
202 3300003320 rootH2_10094954 rootH2_100949541 204
203 3300005329 Ga0070683_100678956 Ga0070683_1006789561 204
204 3300005331 Ga0070670_100004565 Ga0070670_1000045658 204
205 3300005335 Ga0070666_10272663 Ga0070666_102726631 204
206 3300005336 Ga0070680_100134119 Ga0070680_1001341192 204
207 3300005337 Ga0070682_100067328 Ga0070682_1000673282 204
208 3300005340 Ga0070689_100343253 Ga0070689_1003432531 204
209 3300005341 Ga0070691_10032221 Ga0070691_100322212 204
210 3300005344 Ga0070661_100613917 Ga0070661_1006139171 204
211 3300005345 Ga0070692_10287328 Ga0070692_102873281 204
212 3300005367 Ga0070667_100082688 Ga0070667_1000826884 204
213 3300005439 Ga0070711_100465922 Ga0070711_1004659221 204
214 3300005440 Ga0070705_100035546 Ga0070705_1000355461 204
215 3300005455 Ga0070663_100003136 Ga0070663_1000031365 204
216 3300005456 Ga0070678_100434114 Ga0070678_1004341142 204
217 3300005458 Ga0070681_10130645 Ga0070681_101306452 204
218 3300005530 Ga0070679_100172168 Ga0070679_1001721682 204
219 3300005539 Ga0068853_100002522 Ga0068853_1000025228 204
220 3300005546 Ga0070696_100016468 Ga0070696_1000164685 204
221 3300005547 Ga0070693_100641290 Ga0070693_1006412901 204
222 3300005563 Ga0068855_100237545 Ga0068855_1002375452 204
223 3300005564 Ga0070664_100246525 Ga0070664_1002465251 204
224 3300005577 Ga0068857_100041868 Ga0068857_1000418684 204
225 3300005578 Ga0068854_100078310 Ga0068854_1000783102 204
226 3300005614 Ga0068856_100203774 Ga0068856_1002037742 204
227 3300005615 Ga0070702_100052285 Ga0070702_1000522852 204
228 3300005616 Ga0068852_100113225 Ga0068852_1001132252 204
229 3300005617 Ga0068859_100144985 Ga0068859_1001449852 204
230 3300005842 Ga0068858_100251739 Ga0068858_1002517392 204
231 3300006931 Ga0097620_100144979 Ga0097620_1001449792 204
232 3300007076 Ga0075435_100753898 Ga0075435_1007538981 204
233 3300009147 Ga0114129_10212920 Ga0114129_102129202 204
234 3300009148 Ga0105243_10023527 Ga0105243_100235273 204
235 3300009545 Ga0105237_10162026 Ga0105237_101620262 204
236 3300009551 Ga0105238_10007426 Ga0105238_100074267 204
237 3300010375 Ga0105239_10131957 Ga0105239_101319574 204
238 3300011119 Ga0105246_10009245 Ga0105246_100092456 204
239 3300013100 Ga0157373_10270964 Ga0157373_102709642 204
240 3300013104 Ga0157370_10154977 Ga0157370_101549772 204
241 3300013296 Ga0157374_10496064 Ga0157374_104960641 204
242 3300013297 Ga0157378_10158446 Ga0157378_101584463 204
243 3300013308 Ga0157375_10119432 Ga0157375_101194323 204
244 3300014325 Ga0163163_10009138 Ga0163163_100091383 204
245 3300014326 Ga0157380_10324102 Ga0157380_103241022 204
246 3300014968 Ga0157379_10042595 Ga0157379_100425955 204
247 3300025903 Ga0207680_10355994 Ga0207680_103559942 204
248 3300025911 Ga0207654_10031487 Ga0207654_100314872 204
249 3300025912 Ga0207707_10135676 Ga0207707_101356762 204
250 3300025917 Ga0207660_10072075 Ga0207660_100720751 204
251 3300025921 Ga0207652_10347798 Ga0207652_103477982 204
252 3300025925 Ga0207650_10006857 Ga0207650_100068575 204
253 3300025928 Ga0207700_10165243 Ga0207700_101652433 204
254 3300025932 Ga0207690_10086288 Ga0207690_100862882 204
255 3300025935 Ga0207709_10087118 Ga0207709_100871182 204
256 3300025949 Ga0207667_10357435 Ga0207667_103574351 204
257 3300025981 Ga0207640_10087720 Ga0207640_100877202 204
258 3300025986 Ga0207658_10282268 Ga0207658_102822682 204
259 3300026035 Ga0207703_10145601 Ga0207703_101456012 204
260 3300026035 Ga0207703_10797328 Ga0207703_107973281 204
261 3300026067 Ga0207678_10000231 Ga0207678_100002317 204
262 3300026078 Ga0207702_10271470 Ga0207702_102714702 204
263 3300026116 Ga0207674_10079554 Ga0207674_100795543 204
264 3300027907 Ga0207428_10026521 Ga0207428_100265216 204
265 3300037466 Ga0395898_0745004 Ga0395898_0745004_47_670 204
266 3300046533 Ga0495640_0065580 Ga0495640_0065580_424_1041 204
267 3300046692 Ga0495671_0068190 Ga0495671_0068190_643_1260 204
268 3300047321 Ga0495676_0362968 Ga0495676_0362968_64_681 204
269 3300047323 Ga0495683_0221153 Ga0495683_0221153_22_639 204
270 3300047471 Ga0495684_0339830 Ga0495684_0339830_200_817 204
271 3300048903 Ga0496100_0024071 Ga0496100_0024071_1518_2144 204
272 3300048903 Ga0496100_0081723 Ga0496100_0081723_1529_2146 204
273 3300048904 Ga0496101_0094623 Ga0496101_0094623_1404_2030 204
274 3300048905 Ga0496102_0030165 Ga0496102_0030165_1313_1930 204
275 3300048905 Ga0496102_0161117 Ga0496102_0161117_1397_2023 204
276 3300048906 Ga0496103_0014278 Ga0496103_0014278_663_1289 204
277 3300048907 Ga0496104_0101437 Ga0496104_0101437_1622_2239 204
278 3300048907 Ga0496104_0112482 Ga0496104_0112482_674_1300 204
279 3300048908 Ga0496105_0002468 Ga0496105_0002468_11225_11842 204
280 3300048909 Ga0496106_0010982 Ga0496106_0010982_4087_4713 204
281 3300048912 Ga0496109_0003965 Ga0496109_0003965_4771_5388 204
282 3300048913 Ga0496110_0061581 Ga0496110_0061581_1333_1950 204
283 3300048914 Ga0496111_0006988 Ga0496111_0006988_3562_4179 204
284 3300048915 Ga0496112_0000845 Ga0496112_0000845_9151_9768 204
285 3300048916 Ga0496113_0000630 Ga0496113_0000630_10812_11429 204
286 3300048918 Ga0496115_0003958 Ga0496115_0003958_6231_6857 204
287 3300048922 Ga0496119_0116474 Ga0496119_0116474_600_1220 204
288 3300049569 Ga0501032_0006465 Ga0501032_0006465_974_1606 204
289 3300049569 Ga0501032_0421918 Ga0501032_0421918_121_756 204
290 3300049571 Ga0501034_0000166 Ga0501034_0000166_87081_87713 204
291 3300049571 Ga0501034_0104974 Ga0501034_0104974_1221_1835 204
292 3300049571 Ga0501034_0710856 Ga0501034_0710856_225_860 204
293 3300049572 Ga0501036_0020796 Ga0501036_0020796_3460_4092 204
294 3300049573 Ga0501037_0002056 Ga0501037_0002056_5260_5892 204
295 3300049574 Ga0501038_0069334 Ga0501038_0069334_2315_2947 204
296 3300049575 Ga0501039_0000554 Ga0501039_0000554_13344_13976 204
297 3300049579 Ga0501043_0021245 Ga0501043_0021245_1395_2027 204
298 3300049580 Ga0501046_0003773 Ga0501046_0003773_5320_6033 204
299 3300049581 Ga0501047_0001189 Ga0501047_0001189_19984_20616 204
300 3300049582 Ga0501048_0004019 Ga0501048_0004019_9005_9619 204
301 3300049583 Ga0501067_0000576 Ga0501067_0000576_18202_18834 204
302 3300049586 Ga0501070_0013716 Ga0501070_0013716_3036_3668 204
303 3300049589 Ga0501073_0030561 Ga0501073_0030561_1783_2415 204
304 3300049742 Ga0501080_0000075 Ga0501080_0000075_50148_50780 204
305 3300049822 Ga0501035_0000084 Ga0501035_0000084_80764_81396 204
306 3300049823 Ga0501044_0000073 Ga0501044_0000073_34795_35427 204
307 3300050507 nmdc:mga05p37_11562_c1 nmdc:mga05p37_11562_c1_6934_7551 204
308 3300050507 nmdc:mga05p37_524333_c1 nmdc:mga05p37_524333_c1_21_647 204
309 3300050512 nmdc:mga0n895_599241_c1 nmdc:mga0n895_599241_c1_237_857 204
310 3300050512 nmdc:mga0n895_77979_c1 nmdc:mga0n895_77979_c1_1747_2373 204
311 3300050513 nmdc:mga0rr50_11785_c1 nmdc:mga0rr50_11785_c1_13_630 204
312 3300053084 Ga0495595_0152554 Ga0495595_0152554_40_663 204
313 3300053085 Ga0495619_0298252 Ga0495619_0298252_297_920 204
314 3300053119 Ga0500595_051681 Ga0500595_051681_475_1095 204
315 3300060353 Ga0501082_0125497 Ga0501082_0125497_1512_2144 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

4

194

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fz5-assembly2.cif.gz_D crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.8858 3 199
3rpn-assembly3.cif.gz_F crystal structure of human kappa class glutathione transferase in complex with s-hexylglutathione 0.8773 4 196
1r4w-assembly2.cif.gz_D crystal structure of mitochondrial class kappa glutathione transferase 0.8746 2 198
3fz5-assembly1.cif.gz_A crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.8698 1 199
3fz5-assembly2.cif.gz_D crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.8682 3 199
ID Description Score Start End Superfamily
af_Q09652_5_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9098 3 191 3.40.30.10
af_Q18973_4_212_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8965 4 196 3.40.30.10
3fz5D00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8821 4 199 3.40.30.10
3fz5D00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.864 4 199 3.40.30.10
3rppC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8555 4 196 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1E1UYL2-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.989 1 197 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0018845
GO:1901170
AF-A0A5C8CZV1-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9884 1 197 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0018845
GO:1901170
AF-W3RLB5-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9875 3 198 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0018845
GO:1901170
AF-A0A1E3GWM7-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9867 5 198 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0018845
GO:1901170
AF-A0A2W4RQN2-F1-model_v4 Disulfide bond formation protein DsbA 0.9858 3 192 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0018845
GO:1901170

Feature Viewer

pLDDT pTM Quality
95.21 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map