F403377
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 315 | 222 | 313 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300049580|Ga0501046_0003773|Ga0501046_0003773_5320_6033 |
| Length | 237 |
| Sequence | MKPTLIFWYEFASTYSYLTAMRIDAEGARAGVAIEWRPFLLGPIFKSQGWTTSPFNVYPAKGRYMVRDITRIASERGLPFRMPETFPANGLKAARLAIAARGWGATAAFSRAVFEAQFAGGEDISDDDVLAACLTRVGLDPASVWPRIMDDSVKAALKRNTEMAQGLGIFGAPSFTTADNELFWGDDRLAEALRWASAPMALPNSADSPGSALIDSIAFKFRAFEPRRIGFRSASIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 106 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 107 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 108 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 109 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 112 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 113 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 114 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 115 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 116 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 117 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 118 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 119 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 120 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 121 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 122 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 123 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 124 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 125 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 126 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 171 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 175 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 176 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 178 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 179 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 180 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 183 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 184 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 185 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 186 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 187 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 188 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 217 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 218 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 219 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 220 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 221 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.37 |
| Metatranscriptomes | 0 |
| Isolates | 0.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.22 |
| Nodule | 0 |
| Rhizoplane | 7.62 |
| Rhizosphere | 86.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10094954 | 3300003320 | Bacteria | 1447 |
| 2 | rootL2_10033366 | 3300003322 | Bacteria | 2539 |
| 3 | Ga0070683_100678956 | 3300005329 | Bacteria | 986 |
| 4 | Ga0070670_100004565 | 3300005331 | Bacteria | 11615 |
| 5 | Ga0070677_10276574 | 3300005333 | Bacteria | 844 |
| 6 | Ga0070666_10272663 | 3300005335 | Bacteria | 1201 |
| 7 | Ga0070680_100134119 | 3300005336 | Bacteria | 2073 |
| 8 | Ga0070682_100067328 | 3300005337 | Bacteria | 2280 |
| 9 | Ga0070689_100343253 | 3300005340 | Bacteria | 1251 |
| 10 | Ga0070691_10032221 | 3300005341 | Bacteria | 2462 |
| 11 | Ga0070687_100548689 | 3300005343 | Unclassified | 786 |
| 12 | Ga0070661_100613917 | 3300005344 | Bacteria | 880 |
| 13 | Ga0070692_10287328 | 3300005345 | Bacteria | 999 |
| 14 | Ga0070668_100331253 | 3300005347 | Bacteria | 1284 |
| 15 | Ga0070673_100156928 | 3300005364 | Bacteria | 1932 |
| 16 | Ga0070688_100398452 | 3300005365 | Bacteria | 1018 |
| 17 | Ga0070667_100082688 | 3300005367 | Bacteria | 2750 |
| 18 | Ga0070709_10067503 | 3300005434 | Bacteria | 2296 |
| 19 | Ga0070711_100465922 | 3300005439 | Bacteria | 1036 |
| 20 | Ga0070705_100035546 | 3300005440 | Bacteria | 2794 |
| 21 | Ga0070663_100003136 | 3300005455 | Bacteria | 9473 |
| 22 | Ga0070678_100434114 | 3300005456 | Unclassified | 1147 |
| 23 | Ga0070662_100622425 | 3300005457 | Bacteria | 909 |
| 24 | Ga0070681_10130645 | 3300005458 | Bacteria | 2444 |
| 25 | Ga0070698_100084035 | 3300005471 | Bacteria | 3172 |
| 26 | Ga0070679_100172168 | 3300005530 | Bacteria | 2138 |
| 27 | Ga0070697_100259103 | 3300005536 | Bacteria | 1489 |
| 28 | Ga0068853_100002522 | 3300005539 | Bacteria | 13742 |
| 29 | Ga0070696_100016468 | 3300005546 | Bacteria | 4979 |
| 30 | Ga0070696_100082908 | 3300005546 | Bacteria | 2273 |
| 31 | Ga0070693_100641290 | 3300005547 | Unclassified | 771 |
| 32 | Ga0070665_100668532 | 3300005548 | Bacteria | 1052 |
| 33 | Ga0070704_100436050 | 3300005549 | Bacteria | 1125 |
| 34 | Ga0068855_100237545 | 3300005563 | Bacteria | 2037 |
| 35 | Ga0070664_100246525 | 3300005564 | Bacteria | 1605 |
| 36 | Ga0068857_100041868 | 3300005577 | Bacteria | 4062 |
| 37 | Ga0068854_100078310 | 3300005578 | Bacteria | 2435 |
| 38 | Ga0068854_100947887 | 3300005578 | Bacteria | 759 |
| 39 | Ga0068856_100203774 | 3300005614 | Bacteria | 1993 |
| 40 | Ga0070702_100052285 | 3300005615 | Bacteria | 2342 |
| 41 | Ga0068852_100113225 | 3300005616 | Bacteria | 2470 |
| 42 | Ga0068859_100144985 | 3300005617 | Bacteria | 2449 |
| 43 | Ga0068861_100376434 | 3300005719 | Bacteria | 1253 |
| 44 | Ga0068858_100251739 | 3300005842 | Bacteria | 1678 |
| 45 | Ga0068862_100703761 | 3300005844 | Bacteria | 979 |
| 46 | Ga0081540_1003306 | 3300005983 | Bacteria | 12790 |
| 47 | Ga0070717_10089874 | 3300006028 | Bacteria | 2591 |
| 48 | Ga0070715_10034265 | 3300006163 | Bacteria | 2080 |
| 49 | Ga0075428_100907313 | 3300006844 | Bacteria | 934 |
| 50 | Ga0075431_100604653 | 3300006847 | Bacteria | 1080 |
| 51 | Ga0075433_10343504 | 3300006852 | Bacteria | 1319 |
| 52 | Ga0097620_100144979 | 3300006931 | Bacteria | 2449 |
| 53 | Ga0075435_100753898 | 3300007076 | Bacteria | 847 |
| 54 | Ga0099795_10154077 | 3300007788 | Bacteria | 943 |
| 55 | Ga0111539_10041494 | 3300009094 | Bacteria | 5532 |
| 56 | Ga0105245_10041156 | 3300009098 | Bacteria | 4119 |
| 57 | Ga0105245_10098281 | 3300009098 | Bacteria | 2705 |
| 58 | Ga0114129_10035879 | 3300009147 | Bacteria | 7002 |
| 59 | Ga0114129_10212920 | 3300009147 | Bacteria | 2611 |
| 60 | Ga0114129_12021828 | 3300009147 | Bacteria | 696 |
| 61 | Ga0105243_10023527 | 3300009148 | Bacteria | 4692 |
| 62 | Ga0105237_10162026 | 3300009545 | Bacteria | 2235 |
| 63 | Ga0105238_10007426 | 3300009551 | Bacteria | 10978 |
| 64 | Ga0105239_10131957 | 3300010375 | Bacteria | 2779 |
| 65 | Ga0105239_10992872 | 3300010375 | Bacteria | 965 |
| 66 | Ga0105246_10009245 | 3300011119 | Bacteria | 6070 |
| 67 | Ga0157373_10270964 | 3300013100 | Bacteria | 1202 |
| 68 | Ga0157371_10000161 | 3300013102 | Bacteria | 98412 |
| 69 | Ga0157370_10154977 | 3300013104 | Bacteria | 2131 |
| 70 | Ga0157374_10496064 | 3300013296 | Bacteria | 1225 |
| 71 | Ga0157378_10158446 | 3300013297 | Bacteria | 2115 |
| 72 | Ga0163162_10900605 | 3300013306 | Unclassified | 998 |
| 73 | Ga0157375_10119432 | 3300013308 | Bacteria | 2744 |
| 74 | Ga0157375_10211565 | 3300013308 | Bacteria | 2097 |
| 75 | Ga0163163_10009138 | 3300014325 | Bacteria | 8833 |
| 76 | Ga0157380_10324102 | 3300014326 | Bacteria | 1430 |
| 77 | Ga0157380_10360047 | 3300014326 | Bacteria | 1364 |
| 78 | Ga0157379_10042595 | 3300014968 | Bacteria | 4054 |
| 79 | Ga0157379_10068063 | 3300014968 | Bacteria | 3183 |
| 80 | Ga0213872_10000001 | 3300021361 | Bacteria | 662532 |
| 81 | Ga0213872_10036546 | 3300021361 | Bacteria | 2245 |
| 82 | Ga0207680_10355994 | 3300025903 | Bacteria | 1029 |
| 83 | Ga0207705_10384318 | 3300025909 | Bacteria | 1084 |
| 84 | Ga0207654_10031487 | 3300025911 | Bacteria | 2922 |
| 85 | Ga0207707_10135676 | 3300025912 | Bacteria | 2152 |
| 86 | Ga0207693_10028242 | 3300025915 | Bacteria | 4432 |
| 87 | Ga0207660_10072075 | 3300025917 | Bacteria | 2515 |
| 88 | Ga0207652_10347798 | 3300025921 | Bacteria | 1338 |
| 89 | Ga0207650_10006857 | 3300025925 | Bacteria | 7767 |
| 90 | Ga0207687_10102508 | 3300025927 | Bacteria | 2108 |
| 91 | Ga0207700_10165243 | 3300025928 | Bacteria | 1841 |
| 92 | Ga0207644_10551755 | 3300025931 | Bacteria | 954 |
| 93 | Ga0207690_10086288 | 3300025932 | Bacteria | 2205 |
| 94 | Ga0207706_10670243 | 3300025933 | Bacteria | 887 |
| 95 | Ga0207709_10087118 | 3300025935 | Bacteria | 2029 |
| 96 | Ga0207665_10011235 | 3300025939 | Bacteria | 5875 |
| 97 | Ga0207661_10327222 | 3300025944 | Bacteria | 1379 |
| 98 | Ga0207667_10357435 | 3300025949 | Bacteria | 1489 |
| 99 | Ga0207651_10680091 | 3300025960 | Bacteria | 905 |
| 100 | Ga0207668_10188656 | 3300025972 | Bacteria | 1632 |
| 101 | Ga0207640_10087720 | 3300025981 | Bacteria | 2146 |
| 102 | Ga0207658_10282268 | 3300025986 | Bacteria | 1424 |
| 103 | Ga0207703_10145601 | 3300026035 | Bacteria | 2060 |
| 104 | Ga0207703_10797328 | 3300026035 | Bacteria | 902 |
| 105 | Ga0207678_10000231 | 3300026067 | Bacteria | 49870 |
| 106 | Ga0207702_10271470 | 3300026078 | Bacteria | 1600 |
| 107 | Ga0207641_10540475 | 3300026088 | Bacteria | 1135 |
| 108 | Ga0207674_10079554 | 3300026116 | Bacteria | 3282 |
| 109 | Ga0207675_100215513 | 3300026118 | Unclassified | 1848 |
| 110 | Ga0209179_1051643 | 3300027512 | Bacteria | 882 |
| 111 | Ga0207428_10026521 | 3300027907 | Bacteria | 4837 |
| 112 | Ga0268266_10213469 | 3300028379 | Bacteria | 1771 |
| 113 | Ga0268266_10398673 | 3300028379 | Bacteria | 1301 |
| 114 | Ga0265337_1004357 | 3300028556 | Bacteria | 5886 |
| 115 | Ga0265338_10203699 | 3300028800 | Bacteria | 1490 |
| 116 | Ga0316177_1136365 | 3300030731 | Bacteria | 7091 |
| 117 | Ga0314311_1044667 | 3300030733 | Bacteria | 945 |
| 118 | Ga0316180_1015248 | 3300030736 | Bacteria | 2911 |
| 119 | Ga0316182_1130770 | 3300030745 | Bacteria | 12095 |
| 120 | Ga0265332_10113423 | 3300031238 | Bacteria | 1140 |
| 121 | Ga0265320_10002442 | 3300031240 | Bacteria | 12946 |
| 122 | Ga0307409_100686190 | 3300031995 | Unclassified | 1022 |
| 123 | Ga0373927_0097990 | 3300035695 | Bacteria | 1906 |
| 124 | Ga0395898_0052904 | 3300037466 | Bacteria | 3966 |
| 125 | Ga0395898_0745004 | 3300037466 | Unclassified | 921 |
| 126 | Ga0395905_0274607 | 3300037471 | Unclassified | 1571 |
| 127 | Ga0395905_0280073 | 3300037471 | Bacteria | 1554 |
| 128 | Ga0395901_0129430 | 3300038443 | Bacteria | 2653 |
| 129 | Ga0395901_0486027 | 3300038443 | Bacteria | 1259 |
| 130 | Ga0400483_087171 | 3300039062 | Bacteria | 1211 |
| 131 | Ga0436361_0401187 | 3300039447 | Bacteria | 5204 |
| 132 | Ga0436361_0404657 | 3300039447 | Bacteria | 144351 |
| 133 | Ga0439448_0056001 | 3300042005 | Bacteria | 1297 |
| 134 | Ga0439458_0039785 | 3300042157 | Bacteria | 1138 |
| 135 | Ga0466972_0005337 | 3300044658 | Bacteria | 6438 |
| 136 | Ga0466965_0011873 | 3300044683 | Bacteria | 4089 |
| 137 | Ga0466966_0055330 | 3300044684 | Bacteria | 2511 |
| 138 | Ga0466966_0094532 | 3300044684 | Bacteria | 1853 |
| 139 | Ga0466966_0098309 | 3300044684 | Bacteria | 1812 |
| 140 | Ga0466964_0001175 | 3300044706 | Bacteria | 8845 |
| 141 | Ga0466968_0002338 | 3300044735 | Bacteria | 6934 |
| 142 | Ga0466970_0114940 | 3300044765 | Bacteria | 1471 |
| 143 | Ga0495590_0041780 | 3300046457 | Bacteria | 1599 |
| 144 | Ga0495629_0050819 | 3300046459 | Bacteria | 2902 |
| 145 | Ga0495638_0071295 | 3300046460 | Bacteria | 2126 |
| 146 | Ga0495653_0000397 | 3300046463 | Bacteria | 34937 |
| 147 | Ga0495653_0142588 | 3300046463 | Bacteria | 1683 |
| 148 | Ga0495650_0002402 | 3300046471 | Bacteria | 15281 |
| 149 | Ga0495582_0003085 | 3300046473 | Bacteria | 9340 |
| 150 | Ga0495605_0000160 | 3300046474 | Bacteria | 86202 |
| 151 | Ga0495605_0030762 | 3300046474 | Bacteria | 2749 |
| 152 | Ga0495605_0054629 | 3300046474 | Bacteria | 1933 |
| 153 | Ga0495584_0000390 | 3300046491 | Bacteria | 30206 |
| 154 | Ga0495584_0002379 | 3300046491 | Bacteria | 10693 |
| 155 | Ga0495584_0004006 | 3300046491 | Bacteria | 7949 |
| 156 | Ga0495584_0201567 | 3300046491 | Bacteria | 1011 |
| 157 | Ga0495596_0012251 | 3300046500 | Bacteria | 3677 |
| 158 | Ga0495596_0017320 | 3300046500 | Bacteria | 2985 |
| 159 | Ga0495596_0026190 | 3300046500 | Bacteria | 2351 |
| 160 | Ga0495607_0010437 | 3300046501 | Bacteria | 6244 |
| 161 | Ga0495607_0011676 | 3300046501 | Bacteria | 5833 |
| 162 | Ga0495607_0078884 | 3300046501 | Bacteria | 1815 |
| 163 | Ga0495583_0000890 | 3300046506 | Bacteria | 35810 |
| 164 | Ga0495583_0015101 | 3300046506 | Bacteria | 4217 |
| 165 | Ga0495583_0035296 | 3300046506 | Bacteria | 2387 |
| 166 | Ga0495606_0000169 | 3300046507 | Bacteria | 115434 |
| 167 | Ga0495606_0002709 | 3300046507 | Bacteria | 19972 |
| 168 | Ga0495606_0120924 | 3300046507 | Bacteria | 1568 |
| 169 | Ga0495616_0000170 | 3300046513 | Bacteria | 56058 |
| 170 | Ga0495616_0001444 | 3300046513 | Bacteria | 16538 |
| 171 | Ga0495616_0232778 | 3300046513 | Bacteria | 798 |
| 172 | Ga0495631_0004269 | 3300046518 | Bacteria | 7637 |
| 173 | Ga0495631_0124652 | 3300046518 | Bacteria | 1107 |
| 174 | Ga0495631_0253816 | 3300046518 | Bacteria | 749 |
| 175 | Ga0495637_0000439 | 3300046520 | Bacteria | 30319 |
| 176 | Ga0495637_0095188 | 3300046520 | Bacteria | 1169 |
| 177 | Ga0495643_0000171 | 3300046522 | Bacteria | 103167 |
| 178 | Ga0495643_0000552 | 3300046522 | Bacteria | 46298 |
| 179 | Ga0495643_0008044 | 3300046522 | Bacteria | 6722 |
| 180 | Ga0495643_0127495 | 3300046522 | Bacteria | 1280 |
| 181 | Ga0495648_0001544 | 3300046524 | Bacteria | 22488 |
| 182 | Ga0495648_0007512 | 3300046524 | Bacteria | 8718 |
| 183 | Ga0495642_0001094 | 3300046528 | Bacteria | 12522 |
| 184 | Ga0495642_0001857 | 3300046528 | Bacteria | 9016 |
| 185 | Ga0495642_0042998 | 3300046528 | Bacteria | 1842 |
| 186 | Ga0495654_0000025 | 3300046530 | Bacteria | 236572 |
| 187 | Ga0495654_0007685 | 3300046530 | Bacteria | 5999 |
| 188 | Ga0495640_0065580 | 3300046533 | Bacteria | 2451 |
| 189 | Ga0495609_0034043 | 3300046538 | Bacteria | 2311 |
| 190 | Ga0495609_0267652 | 3300046538 | Bacteria | 701 |
| 191 | Ga0495597_0002475 | 3300046542 | Bacteria | 11661 |
| 192 | Ga0495597_0007079 | 3300046542 | Bacteria | 5741 |
| 193 | Ga0495597_0208780 | 3300046542 | Bacteria | 779 |
| 194 | Ga0495656_0407117 | 3300046615 | Bacteria | 712 |
| 195 | Ga0495668_0015668 | 3300046616 | Bacteria | 4420 |
| 196 | Ga0495668_0037858 | 3300046616 | Bacteria | 2697 |
| 197 | Ga0495668_0262634 | 3300046616 | Bacteria | 945 |
| 198 | Ga0495625_0003503 | 3300046660 | Bacteria | 15554 |
| 199 | Ga0495625_0178069 | 3300046660 | Bacteria | 1416 |
| 200 | Ga0495661_0001236 | 3300046665 | Bacteria | 22115 |
| 201 | Ga0495661_0003616 | 3300046665 | Bacteria | 11388 |
| 202 | Ga0495661_0009183 | 3300046665 | Bacteria | 6793 |
| 203 | Ga0495661_0041547 | 3300046665 | Bacteria | 2844 |
| 204 | Ga0495661_0129197 | 3300046665 | Bacteria | 1386 |
| 205 | Ga0495588_0000052 | 3300046674 | Bacteria | 304493 |
| 206 | Ga0495588_0072780 | 3300046674 | Bacteria | 1788 |
| 207 | Ga0495669_0000092 | 3300046684 | Bacteria | 59765 |
| 208 | Ga0495613_0072166 | 3300046689 | Bacteria | 2516 |
| 209 | Ga0495671_0068190 | 3300046692 | Bacteria | 1749 |
| 210 | Ga0495671_0206432 | 3300046692 | Bacteria | 952 |
| 211 | Ga0495649_0028201 | 3300046694 | Bacteria | 3112 |
| 212 | Ga0495589_0000058 | 3300046794 | Bacteria | 107640 |
| 213 | Ga0495589_0021249 | 3300046794 | Bacteria | 3316 |
| 214 | Ga0495589_0084493 | 3300046794 | Bacteria | 1543 |
| 215 | Ga0495660_0000050 | 3300046810 | Bacteria | 140329 |
| 216 | Ga0495660_0008871 | 3300046810 | Bacteria | 5874 |
| 217 | Ga0495672_0006470 | 3300047320 | Bacteria | 9062 |
| 218 | Ga0495672_0011075 | 3300047320 | Bacteria | 6384 |
| 219 | Ga0495676_0362968 | 3300047321 | Bacteria | 967 |
| 220 | Ga0495683_0009591 | 3300047323 | Bacteria | 5154 |
| 221 | Ga0495683_0095753 | 3300047323 | Bacteria | 1433 |
| 222 | Ga0495683_0221153 | 3300047323 | Bacteria | 844 |
| 223 | Ga0495687_000073 | 3300047443 | Bacteria | 155429 |
| 224 | Ga0495687_000103 | 3300047443 | Bacteria | 128840 |
| 225 | Ga0495687_000489 | 3300047443 | Bacteria | 47669 |
| 226 | Ga0495687_193527 | 3300047443 | Bacteria | 652 |
| 227 | Ga0495677_0006075 | 3300047445 | Bacteria | 4564 |
| 228 | Ga0495677_0006784 | 3300047445 | Bacteria | 4307 |
| 229 | Ga0495677_0017091 | 3300047445 | Bacteria | 2630 |
| 230 | Ga0495677_0026476 | 3300047445 | Bacteria | 2104 |
| 231 | Ga0495681_0043617 | 3300047470 | Bacteria | 2161 |
| 232 | Ga0495681_0044676 | 3300047470 | Bacteria | 2126 |
| 233 | Ga0495684_0339830 | 3300047471 | Bacteria | 1069 |
| 234 | Ga0495614_0014723 | 3300048089 | Bacteria | 3421 |
| 235 | Ga0495626_0000145 | 3300048091 | Bacteria | 89603 |
| 236 | Ga0495626_0008221 | 3300048091 | Bacteria | 5745 |
| 237 | Ga0495626_0039872 | 3300048091 | Bacteria | 2220 |
| 238 | Ga0496100_0024071 | 3300048903 | Bacteria | 3709 |
| 239 | Ga0496100_0081723 | 3300048903 | Bacteria | 2183 |
| 240 | Ga0496101_0094623 | 3300048904 | Bacteria | 2227 |
| 241 | Ga0496101_0140383 | 3300048904 | Bacteria | 1841 |
| 242 | Ga0496102_0030165 | 3300048905 | Bacteria | 4853 |
| 243 | Ga0496102_0161117 | 3300048905 | Bacteria | 2110 |
| 244 | Ga0496103_0014278 | 3300048906 | Bacteria | 4716 |
| 245 | Ga0496104_0101437 | 3300048907 | Bacteria | 2755 |
| 246 | Ga0496104_0112482 | 3300048907 | Bacteria | 2611 |
| 247 | Ga0496105_0002468 | 3300048908 | Bacteria | 13388 |
| 248 | Ga0496106_0010982 | 3300048909 | Bacteria | 6696 |
| 249 | Ga0496106_0105395 | 3300048909 | Bacteria | 2191 |
| 250 | Ga0496107_0052725 | 3300048910 | Bacteria | 2933 |
| 251 | Ga0496109_0003965 | 3300048912 | Bacteria | 12359 |
| 252 | Ga0496109_0455187 | 3300048912 | Bacteria | 1209 |
| 253 | Ga0496110_0042046 | 3300048913 | Bacteria | 3989 |
| 254 | Ga0496110_0061581 | 3300048913 | Bacteria | 3312 |
| 255 | Ga0496111_0006988 | 3300048914 | Bacteria | 7369 |
| 256 | Ga0496111_0404584 | 3300048914 | Bacteria | 1008 |
| 257 | Ga0496112_0000845 | 3300048915 | Bacteria | 21851 |
| 258 | Ga0496113_0000630 | 3300048916 | Bacteria | 17715 |
| 259 | Ga0496113_0347734 | 3300048916 | Bacteria | 1189 |
| 260 | Ga0496115_0003958 | 3300048918 | Bacteria | 10687 |
| 261 | Ga0496115_0351479 | 3300048918 | Bacteria | 1202 |
| 262 | Ga0496119_0116474 | 3300048922 | Bacteria | 1475 |
| 263 | Ga0496122_0005248 | 3300048925 | Bacteria | 15531 |
| 264 | Ga0496123_0010462 | 3300048926 | Bacteria | 8197 |
| 265 | Ga0496123_0022828 | 3300048926 | Bacteria | 4807 |
| 266 | Ga0496124_0000479 | 3300048927 | Bacteria | 68855 |
| 267 | Ga0496124_0125639 | 3300048927 | Bacteria | 2044 |
| 268 | Ga0496124_0134658 | 3300048927 | Bacteria | 1958 |
| 269 | Ga0496125_0008556 | 3300048928 | Bacteria | 10690 |
| 270 | Ga0496126_0179060 | 3300048929 | Bacteria | 1802 |
| 271 | Ga0495678_000232 | 3300049459 | Bacteria | 63796 |
| 272 | Ga0495682_0000210 | 3300049460 | Bacteria | 47048 |
| 273 | Ga0501032_0006465 | 3300049569 | Bacteria | 8617 |
| 274 | Ga0501032_0421918 | 3300049569 | Bacteria | 856 |
| 275 | Ga0501034_0000166 | 3300049571 | Bacteria | 122782 |
| 276 | Ga0501034_0104974 | 3300049571 | Bacteria | 2819 |
| 277 | Ga0501034_0710856 | 3300049571 | Unclassified | 903 |
| 278 | Ga0501036_0020796 | 3300049572 | Bacteria | 5512 |
| 279 | Ga0501037_0002056 | 3300049573 | Bacteria | 14595 |
| 280 | Ga0501038_0069334 | 3300049574 | Bacteria | 2995 |
| 281 | Ga0501039_0000554 | 3300049575 | Bacteria | 27105 |
| 282 | Ga0501043_0021245 | 3300049579 | Bacteria | 5089 |
| 283 | Ga0501046_0003773 | 3300049580 | Bacteria | 13874 |
| 284 | Ga0501046_0441828 | 3300049580 | Bacteria | 936 |
| 285 | Ga0501047_0001189 | 3300049581 | Bacteria | 25783 |
| 286 | Ga0501048_0004019 | 3300049582 | Bacteria | 11180 |
| 287 | Ga0501067_0000576 | 3300049583 | Bacteria | 19849 |
| 288 | Ga0501070_0013716 | 3300049586 | Bacteria | 6824 |
| 289 | Ga0501073_0030561 | 3300049589 | Bacteria | 3845 |
| 290 | Ga0501077_0167873 | 3300049593 | Bacteria | 1394 |
| 291 | Ga0501080_0000075 | 3300049742 | Bacteria | 66767 |
| 292 | Ga0501081_0597967 | 3300049743 | Bacteria | 826 |
| 293 | Ga0501035_0000084 | 3300049822 | Bacteria | 116222 |
| 294 | Ga0501044_0000073 | 3300049823 | Bacteria | 122507 |
| 295 | nmdc:mga05p37_11562_c1 | 3300050507 | Bacteria | 10515 |
| 296 | nmdc:mga05p37_524333_c1 | 3300050507 | Bacteria | 1354 |
| 297 | nmdc:mga05p37_668037_c1 | 3300050507 | Bacteria | 1160 |
| 298 | nmdc:mga09592_122144_c1 | 3300050508 | Bacteria | 2238 |
| 299 | nmdc:mga08y16_71088_c1 | 3300050511 | Bacteria | 3627 |
| 300 | nmdc:mga0n895_599241_c1 | 3300050512 | Bacteria | 1104 |
| 301 | nmdc:mga0n895_77979_c1 | 3300050512 | Bacteria | 3296 |
| 302 | nmdc:mga0rr50_11785_c1 | 3300050513 | Bacteria | 5613 |
| 303 | nmdc:mga0a205_248068_c1 | 3300050515 | Bacteria | 1660 |
| 304 | Ga0495595_0152554 | 3300053084 | Bacteria | 1137 |
| 305 | Ga0495619_0298252 | 3300053085 | Bacteria | 1117 |
| 306 | Ga0500644_0002262 | 3300053088 | Bacteria | 4856 |
| 307 | Ga0500651_0005518 | 3300053093 | Bacteria | 7227 |
| 308 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 309 | Ga0500595_051681 | 3300053119 | Bacteria | 1272 |
| 310 | Ga0500577_0119762 | 3300053142 | Bacteria | 1095 |
| 311 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 312 | Ga0500616_0096527 | 3300053153 | Unclassified | 1452 |
| 313 | Ga0501082_0125497 | 3300060353 | Bacteria | 2226 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046513 | Ga0495616_0232778 | Ga0495616_0232778_25_663 | 181 |
| 2 | 3300044765 | Ga0466970_0114940 | Ga0466970_0114940_885_1454 | 183 |
| 3 | iso_pu_bacteria | 2821131069 | 2821136162 | 192 |
| 4 | iso_pu_bacteria | 8047673197 | 8047674918 | 192 |
| 5 | 3300046463 | Ga0495653_0142588 | Ga0495653_0142588_577_1158 | 193 |
| 6 | 3300021361 | Ga0213872_10000001 | Ga0213872_10000001110 | 194 |
| 7 | 3300039447 | Ga0436361_0404657 | Ga0436361_0404657_115603_116190 | 194 |
| 8 | 3300048926 | Ga0496123_0010462 | Ga0496123_0010462_20_607 | 194 |
| 9 | 3300046460 | Ga0495638_0071295 | Ga0495638_0071295_993_1583 | 195 |
| 10 | 3300046463 | Ga0495653_0000397 | Ga0495653_0000397_27234_27824 | 195 |
| 11 | 3300046471 | Ga0495650_0002402 | Ga0495650_0002402_9239_9829 | 195 |
| 12 | 3300046507 | Ga0495606_0000169 | Ga0495606_0000169_36940_37530 | 195 |
| 13 | 3300046520 | Ga0495637_0000439 | Ga0495637_0000439_6176_6763 | 195 |
| 14 | 3300046522 | Ga0495643_0127495 | Ga0495643_0127495_663_1253 | 195 |
| 15 | 3300046524 | Ga0495648_0007512 | Ga0495648_0007512_2124_2714 | 195 |
| 16 | 3300046530 | Ga0495654_0000025 | Ga0495654_0000025_64775_65362 | 195 |
| 17 | 3300046660 | Ga0495625_0003503 | Ga0495625_0003503_12428_13018 | 195 |
| 18 | 3300046692 | Ga0495671_0206432 | Ga0495671_0206432_249_839 | 195 |
| 19 | 3300025909 | Ga0207705_10384318 | Ga0207705_103843181 | 196 |
| 20 | 3300037471 | Ga0395905_0280073 | Ga0395905_0280073_71_661 | 196 |
| 21 | 3300038443 | Ga0395901_0129430 | Ga0395901_0129430_1588_2181 | 196 |
| 22 | 3300038443 | Ga0395901_0486027 | Ga0395901_0486027_338_937 | 196 |
| 23 | 3300042005 | Ga0439448_0056001 | Ga0439448_0056001_609_1199 | 196 |
| 24 | 3300042157 | Ga0439458_0039785 | Ga0439458_0039785_22_612 | 196 |
| 25 | 3300046457 | Ga0495590_0041780 | Ga0495590_0041780_649_1239 | 196 |
| 26 | 3300046474 | Ga0495605_0000160 | Ga0495605_0000160_62546_63136 | 196 |
| 27 | 3300046501 | Ga0495607_0010437 | Ga0495607_0010437_4329_4919 | 196 |
| 28 | 3300046501 | Ga0495607_0011676 | Ga0495607_0011676_3932_4522 | 196 |
| 29 | 3300046522 | Ga0495643_0000552 | Ga0495643_0000552_35566_36156 | 196 |
| 30 | 3300046522 | Ga0495643_0008044 | Ga0495643_0008044_835_1425 | 196 |
| 31 | 3300046524 | Ga0495648_0001544 | Ga0495648_0001544_9012_9602 | 196 |
| 32 | 3300046528 | Ga0495642_0001857 | Ga0495642_0001857_3060_3650 | 196 |
| 33 | 3300046542 | Ga0495597_0208780 | Ga0495597_0208780_134_724 | 196 |
| 34 | 3300046665 | Ga0495661_0001236 | Ga0495661_0001236_1861_2451 | 196 |
| 35 | 3300046665 | Ga0495661_0003616 | Ga0495661_0003616_2202_2801 | 196 |
| 36 | 3300046665 | Ga0495661_0009183 | Ga0495661_0009183_6082_6672 | 196 |
| 37 | 3300046794 | Ga0495589_0000058 | Ga0495589_0000058_66187_66777 | 196 |
| 38 | 3300046810 | Ga0495660_0000050 | Ga0495660_0000050_107168_107758 | 196 |
| 39 | 3300047320 | Ga0495672_0006470 | Ga0495672_0006470_3575_4165 | 196 |
| 40 | 3300047323 | Ga0495683_0095753 | Ga0495683_0095753_134_724 | 196 |
| 41 | 3300047443 | Ga0495687_000489 | Ga0495687_000489_22919_23509 | 196 |
| 42 | 3300047445 | Ga0495677_0006075 | Ga0495677_0006075_152_742 | 196 |
| 43 | 3300047445 | Ga0495677_0017091 | Ga0495677_0017091_754_1344 | 196 |
| 44 | 3300047445 | Ga0495677_0026476 | Ga0495677_0026476_376_966 | 196 |
| 45 | 3300048091 | Ga0495626_0000145 | Ga0495626_0000145_66187_66777 | 196 |
| 46 | 3300048927 | Ga0496124_0125639 | Ga0496124_0125639_900_1490 | 196 |
| 47 | 3300013102 | Ga0157371_10000161 | Ga0157371_1000016130 | 197 |
| 48 | 3300030731 | Ga0316177_1136365 | Ga0316177_11363654 | 197 |
| 49 | 3300030733 | Ga0314311_1044667 | Ga0314311_10446672 | 197 |
| 50 | 3300030736 | Ga0316180_1015248 | Ga0316180_10152484 | 197 |
| 51 | 3300039062 | Ga0400483_087171 | Ga0400483_087171_342_944 | 197 |
| 52 | 3300044658 | Ga0466972_0005337 | Ga0466972_0005337_5121_5720 | 197 |
| 53 | 3300044683 | Ga0466965_0011873 | Ga0466965_0011873_1942_2541 | 197 |
| 54 | 3300044706 | Ga0466964_0001175 | Ga0466964_0001175_3318_3917 | 197 |
| 55 | 3300044735 | Ga0466968_0002338 | Ga0466968_0002338_5487_6086 | 197 |
| 56 | 3300046507 | Ga0495606_0002709 | Ga0495606_0002709_4301_4903 | 197 |
| 57 | 3300046507 | Ga0495606_0120924 | Ga0495606_0120924_754_1347 | 197 |
| 58 | 3300046810 | Ga0495660_0008871 | Ga0495660_0008871_1744_2337 | 197 |
| 59 | 3300047443 | Ga0495687_000073 | Ga0495687_000073_136214_136816 | 197 |
| 60 | 3300047443 | Ga0495687_193527 | Ga0495687_193527_42_641 | 197 |
| 61 | 3300048916 | Ga0496113_0347734 | Ga0496113_0347734_184_780 | 197 |
| 62 | 3300048925 | Ga0496122_0005248 | Ga0496122_0005248_6140_6733 | 197 |
| 63 | 3300048926 | Ga0496123_0022828 | Ga0496123_0022828_864_1457 | 197 |
| 64 | 3300048927 | Ga0496124_0134658 | Ga0496124_0134658_974_1570 | 197 |
| 65 | 3300005343 | Ga0070687_100548689 | Ga0070687_1005486891 | 198 |
| 66 | 3300005364 | Ga0070673_100156928 | Ga0070673_1001569283 | 198 |
| 67 | 3300005365 | Ga0070688_100398452 | Ga0070688_1003984521 | 198 |
| 68 | 3300005457 | Ga0070662_100622425 | Ga0070662_1006224251 | 198 |
| 69 | 3300005549 | Ga0070704_100436050 | Ga0070704_1004360502 | 198 |
| 70 | 3300005578 | Ga0068854_100947887 | Ga0068854_1009478871 | 198 |
| 71 | 3300005719 | Ga0068861_100376434 | Ga0068861_1003764342 | 198 |
| 72 | 3300006844 | Ga0075428_100907313 | Ga0075428_1009073131 | 198 |
| 73 | 3300006847 | Ga0075431_100604653 | Ga0075431_1006046532 | 198 |
| 74 | 3300009094 | Ga0111539_10041494 | Ga0111539_100414944 | 198 |
| 75 | 3300009098 | Ga0105245_10041156 | Ga0105245_100411562 | 198 |
| 76 | 3300009147 | Ga0114129_10035879 | Ga0114129_100358793 | 198 |
| 77 | 3300013306 | Ga0163162_10900605 | Ga0163162_109006052 | 198 |
| 78 | 3300013308 | Ga0157375_10211565 | Ga0157375_102115652 | 198 |
| 79 | 3300014326 | Ga0157380_10360047 | Ga0157380_103600472 | 198 |
| 80 | 3300014968 | Ga0157379_10068063 | Ga0157379_100680632 | 198 |
| 81 | 3300025927 | Ga0207687_10102508 | Ga0207687_101025082 | 198 |
| 82 | 3300025931 | Ga0207644_10551755 | Ga0207644_105517552 | 198 |
| 83 | 3300025960 | Ga0207651_10680091 | Ga0207651_106800912 | 198 |
| 84 | 3300026088 | Ga0207641_10540475 | Ga0207641_105404752 | 198 |
| 85 | 3300026118 | Ga0207675_100215513 | Ga0207675_1002155133 | 198 |
| 86 | 3300037471 | Ga0395905_0274607 | Ga0395905_0274607_504_1118 | 198 |
| 87 | 3300048913 | Ga0496110_0042046 | Ga0496110_0042046_821_1426 | 198 |
| 88 | 3300048914 | Ga0496111_0404584 | Ga0496111_0404584_317_922 | 198 |
| 89 | 3300048927 | Ga0496124_0000479 | Ga0496124_0000479_32449_33054 | 198 |
| 90 | 3300048928 | Ga0496125_0008556 | Ga0496125_0008556_3436_4041 | 198 |
| 91 | 3300050507 | nmdc:mga05p37_668037_c1 | nmdc:mga05p37_668037_c1_344_940 | 198 |
| 92 | 3300050508 | nmdc:mga09592_122144_c1 | nmdc:mga09592_122144_c1_660_1265 | 198 |
| 93 | 3300050511 | nmdc:mga08y16_71088_c1 | nmdc:mga08y16_71088_c1_1504_2109 | 198 |
| 94 | 3300003322 | rootL2_10033366 | rootL2_100333663 | 199 |
| 95 | 3300005333 | Ga0070677_10276574 | Ga0070677_102765741 | 199 |
| 96 | 3300005347 | Ga0070668_100331253 | Ga0070668_1003312531 | 199 |
| 97 | 3300005536 | Ga0070697_100259103 | Ga0070697_1002591032 | 199 |
| 98 | 3300005548 | Ga0070665_100668532 | Ga0070665_1006685322 | 199 |
| 99 | 3300005844 | Ga0068862_100703761 | Ga0068862_1007037612 | 199 |
| 100 | 3300005983 | Ga0081540_1003306 | Ga0081540_10033066 | 199 |
| 101 | 3300021361 | Ga0213872_10036546 | Ga0213872_100365462 | 199 |
| 102 | 3300025933 | Ga0207706_10670243 | Ga0207706_106702432 | 199 |
| 103 | 3300025972 | Ga0207668_10188656 | Ga0207668_101886563 | 199 |
| 104 | 3300028379 | Ga0268266_10213469 | Ga0268266_102134692 | 199 |
| 105 | 3300028379 | Ga0268266_10398673 | Ga0268266_103986732 | 199 |
| 106 | 3300028556 | Ga0265337_1004357 | Ga0265337_10043573 | 199 |
| 107 | 3300031238 | Ga0265332_10113423 | Ga0265332_101134232 | 199 |
| 108 | 3300031240 | Ga0265320_10002442 | Ga0265320_1000244212 | 199 |
| 109 | 3300037466 | Ga0395898_0052904 | Ga0395898_0052904_2641_3249 | 199 |
| 110 | 3300039447 | Ga0436361_0401187 | Ga0436361_0401187_3173_3790 | 199 |
| 111 | 3300044684 | Ga0466966_0098309 | Ga0466966_0098309_848_1447 | 199 |
| 112 | 3300046474 | Ga0495605_0054629 | Ga0495605_0054629_849_1448 | 199 |
| 113 | 3300046491 | Ga0495584_0002379 | Ga0495584_0002379_5075_5674 | 199 |
| 114 | 3300046528 | Ga0495642_0042998 | Ga0495642_0042998_395_994 | 199 |
| 115 | 3300046530 | Ga0495654_0007685 | Ga0495654_0007685_3094_3693 | 199 |
| 116 | 3300046538 | Ga0495609_0034043 | Ga0495609_0034043_109_708 | 199 |
| 117 | 3300046542 | Ga0495597_0002475 | Ga0495597_0002475_3393_3992 | 199 |
| 118 | 3300046616 | Ga0495668_0037858 | Ga0495668_0037858_1384_1983 | 199 |
| 119 | 3300046794 | Ga0495589_0084493 | Ga0495589_0084493_757_1356 | 199 |
| 120 | 3300047320 | Ga0495672_0011075 | Ga0495672_0011075_3999_4598 | 199 |
| 121 | 3300049593 | Ga0501077_0167873 | Ga0501077_0167873_344_946 | 199 |
| 122 | 3300053088 | Ga0500644_0002262 | Ga0500644_0002262_1887_2525 | 199 |
| 123 | 3300053093 | Ga0500651_0005518 | Ga0500651_0005518_3698_4336 | 199 |
| 124 | 3300053119 | Ga0500595_000001 | Ga0500595_000001_642691_643329 | 199 |
| 125 | 3300053142 | Ga0500577_0119762 | Ga0500577_0119762_268_906 | 199 |
| 126 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_1344847_1345485 | 199 |
| 127 | 3300053153 | Ga0500616_0096527 | Ga0500616_0096527_418_1056 | 199 |
| 128 | 3300005471 | Ga0070698_100084035 | Ga0070698_1000840352 | 200 |
| 129 | 3300025944 | Ga0207661_10327222 | Ga0207661_103272222 | 200 |
| 130 | 3300028800 | Ga0265338_10203699 | Ga0265338_102036992 | 200 |
| 131 | 3300031995 | Ga0307409_100686190 | Ga0307409_1006861902 | 200 |
| 132 | 3300035695 | Ga0373927_0097990 | Ga0373927_0097990_1103_1714 | 200 |
| 133 | 3300046491 | Ga0495584_0000390 | Ga0495584_0000390_7656_8267 | 200 |
| 134 | 3300046500 | Ga0495596_0026190 | Ga0495596_0026190_192_806 | 200 |
| 135 | 3300046506 | Ga0495583_0015101 | Ga0495583_0015101_3551_4153 | 200 |
| 136 | 3300046513 | Ga0495616_0001444 | Ga0495616_0001444_8003_8617 | 200 |
| 137 | 3300046518 | Ga0495631_0004269 | Ga0495631_0004269_3556_4170 | 200 |
| 138 | 3300046528 | Ga0495642_0001094 | Ga0495642_0001094_9192_9806 | 200 |
| 139 | 3300046660 | Ga0495625_0178069 | Ga0495625_0178069_431_1033 | 200 |
| 140 | 3300046665 | Ga0495661_0129197 | Ga0495661_0129197_509_1120 | 200 |
| 141 | 3300046674 | Ga0495588_0000052 | Ga0495588_0000052_17493_18104 | 200 |
| 142 | 3300046694 | Ga0495649_0028201 | Ga0495649_0028201_568_1182 | 200 |
| 143 | 3300047323 | Ga0495683_0009591 | Ga0495683_0009591_751_1365 | 200 |
| 144 | 3300047470 | Ga0495681_0044676 | Ga0495681_0044676_820_1422 | 200 |
| 145 | 3300048091 | Ga0495626_0039872 | Ga0495626_0039872_1315_1929 | 200 |
| 146 | 3300048909 | Ga0496106_0105395 | Ga0496106_0105395_982_1593 | 200 |
| 147 | 3300048912 | Ga0496109_0455187 | Ga0496109_0455187_234_839 | 200 |
| 148 | 3300049459 | Ga0495678_000232 | Ga0495678_000232_41094_41708 | 200 |
| 149 | 3300049460 | Ga0495682_0000210 | Ga0495682_0000210_37846_38460 | 200 |
| 150 | 3300049580 | Ga0501046_0441828 | Ga0501046_0441828_140_745 | 200 |
| 151 | 3300005434 | Ga0070709_10067503 | Ga0070709_100675033 | 201 |
| 152 | 3300005546 | Ga0070696_100082908 | Ga0070696_1000829081 | 201 |
| 153 | 3300006028 | Ga0070717_10089874 | Ga0070717_100898741 | 201 |
| 154 | 3300006163 | Ga0070715_10034265 | Ga0070715_100342652 | 201 |
| 155 | 3300007788 | Ga0099795_10154077 | Ga0099795_101540771 | 201 |
| 156 | 3300009147 | Ga0114129_12021828 | Ga0114129_120218281 | 201 |
| 157 | 3300025915 | Ga0207693_10028242 | Ga0207693_100282425 | 201 |
| 158 | 3300025939 | Ga0207665_10011235 | Ga0207665_100112355 | 201 |
| 159 | 3300027512 | Ga0209179_1051643 | Ga0209179_10516431 | 201 |
| 160 | 3300044684 | Ga0466966_0055330 | Ga0466966_0055330_1009_1632 | 201 |
| 161 | 3300046474 | Ga0495605_0030762 | Ga0495605_0030762_1319_1957 | 201 |
| 162 | 3300046500 | Ga0495596_0017320 | Ga0495596_0017320_1525_2130 | 201 |
| 163 | 3300046506 | Ga0495583_0000890 | Ga0495583_0000890_32563_33186 | 201 |
| 164 | 3300046513 | Ga0495616_0000170 | Ga0495616_0000170_5589_6212 | 201 |
| 165 | 3300046520 | Ga0495637_0095188 | Ga0495637_0095188_453_1076 | 201 |
| 166 | 3300046522 | Ga0495643_0000171 | Ga0495643_0000171_97663_98301 | 201 |
| 167 | 3300046615 | Ga0495656_0407117 | Ga0495656_0407117_38_661 | 201 |
| 168 | 3300048904 | Ga0496101_0140383 | Ga0496101_0140383_198_806 | 201 |
| 169 | 3300048910 | Ga0496107_0052725 | Ga0496107_0052725_639_1247 | 201 |
| 170 | 3300048918 | Ga0496115_0351479 | Ga0496115_0351479_566_1174 | 201 |
| 171 | 3300049743 | Ga0501081_0597967 | Ga0501081_0597967_85_693 | 201 |
| 172 | 3300009098 | Ga0105245_10098281 | Ga0105245_100982812 | 202 |
| 173 | 3300010375 | Ga0105239_10992872 | Ga0105239_109928721 | 202 |
| 174 | 3300030745 | Ga0316182_1130770 | Ga0316182_113077010 | 202 |
| 175 | 3300044684 | Ga0466966_0094532 | Ga0466966_0094532_33_680 | 202 |
| 176 | 3300046459 | Ga0495629_0050819 | Ga0495629_0050819_1426_2037 | 202 |
| 177 | 3300046473 | Ga0495582_0003085 | Ga0495582_0003085_4471_5082 | 202 |
| 178 | 3300046491 | Ga0495584_0004006 | Ga0495584_0004006_3038_3649 | 202 |
| 179 | 3300046491 | Ga0495584_0201567 | Ga0495584_0201567_238_849 | 202 |
| 180 | 3300046500 | Ga0495596_0012251 | Ga0495596_0012251_269_880 | 202 |
| 181 | 3300046501 | Ga0495607_0078884 | Ga0495607_0078884_659_1270 | 202 |
| 182 | 3300046506 | Ga0495583_0035296 | Ga0495583_0035296_360_971 | 202 |
| 183 | 3300046518 | Ga0495631_0124652 | Ga0495631_0124652_104_715 | 202 |
| 184 | 3300046518 | Ga0495631_0253816 | Ga0495631_0253816_39_650 | 202 |
| 185 | 3300046538 | Ga0495609_0267652 | Ga0495609_0267652_47_658 | 202 |
| 186 | 3300046542 | Ga0495597_0007079 | Ga0495597_0007079_2616_3227 | 202 |
| 187 | 3300046616 | Ga0495668_0015668 | Ga0495668_0015668_900_1511 | 202 |
| 188 | 3300046616 | Ga0495668_0262634 | Ga0495668_0262634_204_815 | 202 |
| 189 | 3300046665 | Ga0495661_0041547 | Ga0495661_0041547_1695_2342 | 202 |
| 190 | 3300046674 | Ga0495588_0072780 | Ga0495588_0072780_919_1530 | 202 |
| 191 | 3300046684 | Ga0495669_0000092 | Ga0495669_0000092_43332_43943 | 202 |
| 192 | 3300046689 | Ga0495613_0072166 | Ga0495613_0072166_386_997 | 202 |
| 193 | 3300046794 | Ga0495589_0021249 | Ga0495589_0021249_1606_2244 | 202 |
| 194 | 3300047443 | Ga0495687_000103 | Ga0495687_000103_43242_43880 | 202 |
| 195 | 3300047445 | Ga0495677_0006784 | Ga0495677_0006784_381_992 | 202 |
| 196 | 3300047470 | Ga0495681_0043617 | Ga0495681_0043617_386_997 | 202 |
| 197 | 3300048089 | Ga0495614_0014723 | Ga0495614_0014723_2523_3134 | 202 |
| 198 | 3300048091 | Ga0495626_0008221 | Ga0495626_0008221_280_891 | 202 |
| 199 | 3300006852 | Ga0075433_10343504 | Ga0075433_103435042 | 203 |
| 200 | 3300048929 | Ga0496126_0179060 | Ga0496126_0179060_772_1383 | 203 |
| 201 | 3300050515 | nmdc:mga0a205_248068_c1 | nmdc:mga0a205_248068_c1_88_702 | 203 |
| 202 | 3300003320 | rootH2_10094954 | rootH2_100949541 | 204 |
| 203 | 3300005329 | Ga0070683_100678956 | Ga0070683_1006789561 | 204 |
| 204 | 3300005331 | Ga0070670_100004565 | Ga0070670_1000045658 | 204 |
| 205 | 3300005335 | Ga0070666_10272663 | Ga0070666_102726631 | 204 |
| 206 | 3300005336 | Ga0070680_100134119 | Ga0070680_1001341192 | 204 |
| 207 | 3300005337 | Ga0070682_100067328 | Ga0070682_1000673282 | 204 |
| 208 | 3300005340 | Ga0070689_100343253 | Ga0070689_1003432531 | 204 |
| 209 | 3300005341 | Ga0070691_10032221 | Ga0070691_100322212 | 204 |
| 210 | 3300005344 | Ga0070661_100613917 | Ga0070661_1006139171 | 204 |
| 211 | 3300005345 | Ga0070692_10287328 | Ga0070692_102873281 | 204 |
| 212 | 3300005367 | Ga0070667_100082688 | Ga0070667_1000826884 | 204 |
| 213 | 3300005439 | Ga0070711_100465922 | Ga0070711_1004659221 | 204 |
| 214 | 3300005440 | Ga0070705_100035546 | Ga0070705_1000355461 | 204 |
| 215 | 3300005455 | Ga0070663_100003136 | Ga0070663_1000031365 | 204 |
| 216 | 3300005456 | Ga0070678_100434114 | Ga0070678_1004341142 | 204 |
| 217 | 3300005458 | Ga0070681_10130645 | Ga0070681_101306452 | 204 |
| 218 | 3300005530 | Ga0070679_100172168 | Ga0070679_1001721682 | 204 |
| 219 | 3300005539 | Ga0068853_100002522 | Ga0068853_1000025228 | 204 |
| 220 | 3300005546 | Ga0070696_100016468 | Ga0070696_1000164685 | 204 |
| 221 | 3300005547 | Ga0070693_100641290 | Ga0070693_1006412901 | 204 |
| 222 | 3300005563 | Ga0068855_100237545 | Ga0068855_1002375452 | 204 |
| 223 | 3300005564 | Ga0070664_100246525 | Ga0070664_1002465251 | 204 |
| 224 | 3300005577 | Ga0068857_100041868 | Ga0068857_1000418684 | 204 |
| 225 | 3300005578 | Ga0068854_100078310 | Ga0068854_1000783102 | 204 |
| 226 | 3300005614 | Ga0068856_100203774 | Ga0068856_1002037742 | 204 |
| 227 | 3300005615 | Ga0070702_100052285 | Ga0070702_1000522852 | 204 |
| 228 | 3300005616 | Ga0068852_100113225 | Ga0068852_1001132252 | 204 |
| 229 | 3300005617 | Ga0068859_100144985 | Ga0068859_1001449852 | 204 |
| 230 | 3300005842 | Ga0068858_100251739 | Ga0068858_1002517392 | 204 |
| 231 | 3300006931 | Ga0097620_100144979 | Ga0097620_1001449792 | 204 |
| 232 | 3300007076 | Ga0075435_100753898 | Ga0075435_1007538981 | 204 |
| 233 | 3300009147 | Ga0114129_10212920 | Ga0114129_102129202 | 204 |
| 234 | 3300009148 | Ga0105243_10023527 | Ga0105243_100235273 | 204 |
| 235 | 3300009545 | Ga0105237_10162026 | Ga0105237_101620262 | 204 |
| 236 | 3300009551 | Ga0105238_10007426 | Ga0105238_100074267 | 204 |
| 237 | 3300010375 | Ga0105239_10131957 | Ga0105239_101319574 | 204 |
| 238 | 3300011119 | Ga0105246_10009245 | Ga0105246_100092456 | 204 |
| 239 | 3300013100 | Ga0157373_10270964 | Ga0157373_102709642 | 204 |
| 240 | 3300013104 | Ga0157370_10154977 | Ga0157370_101549772 | 204 |
| 241 | 3300013296 | Ga0157374_10496064 | Ga0157374_104960641 | 204 |
| 242 | 3300013297 | Ga0157378_10158446 | Ga0157378_101584463 | 204 |
| 243 | 3300013308 | Ga0157375_10119432 | Ga0157375_101194323 | 204 |
| 244 | 3300014325 | Ga0163163_10009138 | Ga0163163_100091383 | 204 |
| 245 | 3300014326 | Ga0157380_10324102 | Ga0157380_103241022 | 204 |
| 246 | 3300014968 | Ga0157379_10042595 | Ga0157379_100425955 | 204 |
| 247 | 3300025903 | Ga0207680_10355994 | Ga0207680_103559942 | 204 |
| 248 | 3300025911 | Ga0207654_10031487 | Ga0207654_100314872 | 204 |
| 249 | 3300025912 | Ga0207707_10135676 | Ga0207707_101356762 | 204 |
| 250 | 3300025917 | Ga0207660_10072075 | Ga0207660_100720751 | 204 |
| 251 | 3300025921 | Ga0207652_10347798 | Ga0207652_103477982 | 204 |
| 252 | 3300025925 | Ga0207650_10006857 | Ga0207650_100068575 | 204 |
| 253 | 3300025928 | Ga0207700_10165243 | Ga0207700_101652433 | 204 |
| 254 | 3300025932 | Ga0207690_10086288 | Ga0207690_100862882 | 204 |
| 255 | 3300025935 | Ga0207709_10087118 | Ga0207709_100871182 | 204 |
| 256 | 3300025949 | Ga0207667_10357435 | Ga0207667_103574351 | 204 |
| 257 | 3300025981 | Ga0207640_10087720 | Ga0207640_100877202 | 204 |
| 258 | 3300025986 | Ga0207658_10282268 | Ga0207658_102822682 | 204 |
| 259 | 3300026035 | Ga0207703_10145601 | Ga0207703_101456012 | 204 |
| 260 | 3300026035 | Ga0207703_10797328 | Ga0207703_107973281 | 204 |
| 261 | 3300026067 | Ga0207678_10000231 | Ga0207678_100002317 | 204 |
| 262 | 3300026078 | Ga0207702_10271470 | Ga0207702_102714702 | 204 |
| 263 | 3300026116 | Ga0207674_10079554 | Ga0207674_100795543 | 204 |
| 264 | 3300027907 | Ga0207428_10026521 | Ga0207428_100265216 | 204 |
| 265 | 3300037466 | Ga0395898_0745004 | Ga0395898_0745004_47_670 | 204 |
| 266 | 3300046533 | Ga0495640_0065580 | Ga0495640_0065580_424_1041 | 204 |
| 267 | 3300046692 | Ga0495671_0068190 | Ga0495671_0068190_643_1260 | 204 |
| 268 | 3300047321 | Ga0495676_0362968 | Ga0495676_0362968_64_681 | 204 |
| 269 | 3300047323 | Ga0495683_0221153 | Ga0495683_0221153_22_639 | 204 |
| 270 | 3300047471 | Ga0495684_0339830 | Ga0495684_0339830_200_817 | 204 |
| 271 | 3300048903 | Ga0496100_0024071 | Ga0496100_0024071_1518_2144 | 204 |
| 272 | 3300048903 | Ga0496100_0081723 | Ga0496100_0081723_1529_2146 | 204 |
| 273 | 3300048904 | Ga0496101_0094623 | Ga0496101_0094623_1404_2030 | 204 |
| 274 | 3300048905 | Ga0496102_0030165 | Ga0496102_0030165_1313_1930 | 204 |
| 275 | 3300048905 | Ga0496102_0161117 | Ga0496102_0161117_1397_2023 | 204 |
| 276 | 3300048906 | Ga0496103_0014278 | Ga0496103_0014278_663_1289 | 204 |
| 277 | 3300048907 | Ga0496104_0101437 | Ga0496104_0101437_1622_2239 | 204 |
| 278 | 3300048907 | Ga0496104_0112482 | Ga0496104_0112482_674_1300 | 204 |
| 279 | 3300048908 | Ga0496105_0002468 | Ga0496105_0002468_11225_11842 | 204 |
| 280 | 3300048909 | Ga0496106_0010982 | Ga0496106_0010982_4087_4713 | 204 |
| 281 | 3300048912 | Ga0496109_0003965 | Ga0496109_0003965_4771_5388 | 204 |
| 282 | 3300048913 | Ga0496110_0061581 | Ga0496110_0061581_1333_1950 | 204 |
| 283 | 3300048914 | Ga0496111_0006988 | Ga0496111_0006988_3562_4179 | 204 |
| 284 | 3300048915 | Ga0496112_0000845 | Ga0496112_0000845_9151_9768 | 204 |
| 285 | 3300048916 | Ga0496113_0000630 | Ga0496113_0000630_10812_11429 | 204 |
| 286 | 3300048918 | Ga0496115_0003958 | Ga0496115_0003958_6231_6857 | 204 |
| 287 | 3300048922 | Ga0496119_0116474 | Ga0496119_0116474_600_1220 | 204 |
| 288 | 3300049569 | Ga0501032_0006465 | Ga0501032_0006465_974_1606 | 204 |
| 289 | 3300049569 | Ga0501032_0421918 | Ga0501032_0421918_121_756 | 204 |
| 290 | 3300049571 | Ga0501034_0000166 | Ga0501034_0000166_87081_87713 | 204 |
| 291 | 3300049571 | Ga0501034_0104974 | Ga0501034_0104974_1221_1835 | 204 |
| 292 | 3300049571 | Ga0501034_0710856 | Ga0501034_0710856_225_860 | 204 |
| 293 | 3300049572 | Ga0501036_0020796 | Ga0501036_0020796_3460_4092 | 204 |
| 294 | 3300049573 | Ga0501037_0002056 | Ga0501037_0002056_5260_5892 | 204 |
| 295 | 3300049574 | Ga0501038_0069334 | Ga0501038_0069334_2315_2947 | 204 |
| 296 | 3300049575 | Ga0501039_0000554 | Ga0501039_0000554_13344_13976 | 204 |
| 297 | 3300049579 | Ga0501043_0021245 | Ga0501043_0021245_1395_2027 | 204 |
| 298 | 3300049580 | Ga0501046_0003773 | Ga0501046_0003773_5320_6033 | 204 |
| 299 | 3300049581 | Ga0501047_0001189 | Ga0501047_0001189_19984_20616 | 204 |
| 300 | 3300049582 | Ga0501048_0004019 | Ga0501048_0004019_9005_9619 | 204 |
| 301 | 3300049583 | Ga0501067_0000576 | Ga0501067_0000576_18202_18834 | 204 |
| 302 | 3300049586 | Ga0501070_0013716 | Ga0501070_0013716_3036_3668 | 204 |
| 303 | 3300049589 | Ga0501073_0030561 | Ga0501073_0030561_1783_2415 | 204 |
| 304 | 3300049742 | Ga0501080_0000075 | Ga0501080_0000075_50148_50780 | 204 |
| 305 | 3300049822 | Ga0501035_0000084 | Ga0501035_0000084_80764_81396 | 204 |
| 306 | 3300049823 | Ga0501044_0000073 | Ga0501044_0000073_34795_35427 | 204 |
| 307 | 3300050507 | nmdc:mga05p37_11562_c1 | nmdc:mga05p37_11562_c1_6934_7551 | 204 |
| 308 | 3300050507 | nmdc:mga05p37_524333_c1 | nmdc:mga05p37_524333_c1_21_647 | 204 |
| 309 | 3300050512 | nmdc:mga0n895_599241_c1 | nmdc:mga0n895_599241_c1_237_857 | 204 |
| 310 | 3300050512 | nmdc:mga0n895_77979_c1 | nmdc:mga0n895_77979_c1_1747_2373 | 204 |
| 311 | 3300050513 | nmdc:mga0rr50_11785_c1 | nmdc:mga0rr50_11785_c1_13_630 | 204 |
| 312 | 3300053084 | Ga0495595_0152554 | Ga0495595_0152554_40_663 | 204 |
| 313 | 3300053085 | Ga0495619_0298252 | Ga0495619_0298252_297_920 | 204 |
| 314 | 3300053119 | Ga0500595_051681 | Ga0500595_051681_475_1095 | 204 |
| 315 | 3300060353 | Ga0501082_0125497 | Ga0501082_0125497_1512_2144 | 204 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fz5-assembly2.cif.gz_D | crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides | 0.8858 | 3 | 199 |
| 3rpn-assembly3.cif.gz_F | crystal structure of human kappa class glutathione transferase in complex with s-hexylglutathione | 0.8773 | 4 | 196 |
| 1r4w-assembly2.cif.gz_D | crystal structure of mitochondrial class kappa glutathione transferase | 0.8746 | 2 | 198 |
| 3fz5-assembly1.cif.gz_A | crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides | 0.8698 | 1 | 199 |
| 3fz5-assembly2.cif.gz_D | crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides | 0.8682 | 3 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q09652_5_211_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9098 | 3 | 191 | 3.40.30.10 |
| af_Q18973_4_212_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8965 | 4 | 196 | 3.40.30.10 |
| 3fz5D00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8821 | 4 | 199 | 3.40.30.10 |
| 3fz5D00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.864 | 4 | 199 | 3.40.30.10 |
| 3rppC01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8555 | 4 | 196 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E1UYL2-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.989 | 1 | 197 |
GO:0004364
GO:0004602 GO:0005777 GO:0006749 GO:0018845 GO:1901170 |
| AF-A0A5C8CZV1-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.9884 | 1 | 197 |
GO:0004364
GO:0004602 GO:0005777 GO:0006749 GO:0018845 GO:1901170 |
| AF-W3RLB5-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.9875 | 3 | 198 |
GO:0004364
GO:0004602 GO:0005777 GO:0006749 GO:0018845 GO:1901170 |
| AF-A0A1E3GWM7-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.9867 | 5 | 198 |
GO:0004364
GO:0004602 GO:0005777 GO:0006749 GO:0018845 GO:1901170 |
| AF-A0A2W4RQN2-F1-model_v4 | Disulfide bond formation protein DsbA | 0.9858 | 3 | 192 |
GO:0004364
GO:0004602 GO:0005777 GO:0006749 GO:0018845 GO:1901170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar