F403447

General Info

Members Datasets Scaffolds Average Seq Length
315 200 311 293

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2896253425|2896253851
Length 310
Sequence PAQYREEWQGRVAFITGAVTGIGLGTAQAFADAGMRVALSYRNEDDRAATEKWFADKGYETPLFCKLDVTNRQRFAQVAEEVVDHFGEVHVLVNNAGVSVFGPTDEASYDDYDWIMGVNFGGVVNGLQSFLPRIKASEGRRHVVNVASMAAFLPGPQAGIYTASKFAVRGLTDSLRYNLAPHGIGCSLCCPALTRTNAWASAQKRPEEFADAGFAPPKEGELEQFGTAFEQFGMDPYEVGAKILRGMSQQDGLILTHPEHAIDFTQEFAKQIAALPVEDCPPGRARIEELRRQAGRDAEAGLSVAMDDLT

Samples

Sample ID Description Type Environment
1 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
2 2818991435 Caulobacter henricii 536 Isolate Unclassified
3 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
4 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
138 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
139 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
140 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
183 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
195 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
196 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.4
Nodule 0
Rhizoplane 1.9
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 2.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000497 3300001979 Bacteria 16878
2 JGI24739J22299_10000214 3300001989 Bacteria 19320
3 JGI24739J22299_10001030 3300001989 Bacteria 10323
4 JGI24737J22298_10000335 3300001990 Bacteria 15729
5 JGI24737J22298_10000367 3300001990 Bacteria 15344
6 JGI24735J21928_10000070 3300002067 Bacteria 42425
7 JGI24735J21928_10001472 3300002067 Bacteria 8324
8 JGI24738J21930_10010240 3300002075 Bacteria 2090
9 rootL2_10026182 3300003322 Bacteria 8823
10 Ga0055531_10003911 3300003794 Bacteria 9298
11 Ga0065165_1000428 3300005262 Bacteria 66075
12 Ga0065165_1017648 3300005262 Bacteria 2619
13 Ga0065715_10198755 3300005293 Bacteria 1373
14 Ga0070658_10000139 3300005327 Bacteria 63781
15 Ga0070658_10032126 3300005327 Bacteria 4220
16 Ga0070683_100005574 3300005329 Bacteria 10513
17 Ga0070677_10011926 3300005333 Bacteria 3007
18 Ga0070680_100024301 3300005336 Bacteria 4839
19 Ga0070680_100202933 3300005336 Bacteria 1672
20 Ga0070680_100486263 3300005336 Bacteria 1055
21 Ga0070682_100065446 3300005337 Bacteria 2310
22 Ga0070660_100052494 3300005339 Bacteria 3143
23 Ga0070660_100294616 3300005339 Bacteria 1329
24 Ga0070691_10025824 3300005341 Bacteria 2737
25 Ga0070669_100098605 3300005353 Bacteria 2201
26 Ga0070674_100503675 3300005356 Bacteria 1009
27 Ga0070659_100043251 3300005366 Bacteria 3523
28 Ga0070659_100081093 3300005366 Bacteria 2591
29 Ga0070709_10003457 3300005434 Bacteria 8476
30 Ga0070709_10023554 3300005434 Unclassified 3618
31 Ga0070714_100019704 3300005435 Bacteria 5500
32 Ga0070713_100458619 3300005436 Bacteria 1198
33 Ga0070681_10007054 3300005458 Bacteria 10939
34 Ga0070681_10008914 3300005458 Bacteria 9859
35 Ga0070681_10052763 3300005458 Unclassified 4056
36 Ga0070681_10556041 3300005458 Unclassified 1061
37 Ga0068867_100093909 3300005459 Bacteria 2280
38 Ga0070679_100027645 3300005530 Bacteria 5584
39 Ga0070684_100145947 3300005535 Bacteria 2142
40 Ga0068853_100011133 3300005539 Bacteria 7297
41 Ga0068853_100121863 3300005539 Bacteria 2327
42 Ga0070665_100005884 3300005548 Bacteria 12563
43 Ga0068855_100004272 3300005563 Bacteria 17445
44 Ga0068855_100008073 3300005563 Bacteria 12719
45 Ga0068855_100009844 3300005563 Bacteria 11532
46 Ga0068855_100021286 3300005563 Bacteria 7775
47 Ga0070664_100028925 3300005564 Bacteria 4616
48 Ga0070664_100031233 3300005564 Bacteria 4449
49 Ga0068857_100018898 3300005577 Bacteria 6047
50 Ga0068857_100019510 3300005577 Bacteria 5955
51 Ga0068854_100000298 3300005578 Bacteria 32863
52 Ga0068854_100085442 3300005578 Bacteria 2337
53 Ga0068856_100002394 3300005614 Bacteria 19290
54 Ga0068856_100003382 3300005614 Bacteria 16154
55 Ga0068856_100017851 3300005614 Bacteria 6883
56 Ga0068856_100149315 3300005614 Bacteria 2346
57 Ga0068856_100330776 3300005614 Bacteria 1541
58 Ga0068856_100391148 3300005614 Bacteria 1410
59 Ga0068852_100000302 3300005616 Bacteria 33181
60 Ga0068852_100000545 3300005616 Bacteria 24656
61 Ga0068852_100018020 3300005616 Bacteria 5554
62 Ga0068861_100000027 3300005719 Bacteria 68738
63 Ga0068851_10002017 3300005834 Bacteria 8951
64 Ga0068858_100000785 3300005842 Bacteria 33219
65 Ga0068862_100014053 3300005844 Bacteria 6641
66 Ga0081455_10000579 3300005937 Bacteria 47717
67 Ga0070712_100227095 3300006175 Bacteria 1481
68 Ga0075369_10093311 3300006186 Bacteria 1345
69 Ga0075428_100041104 3300006844 Bacteria 5086
70 Ga0075428_100098105 3300006844 Bacteria 3194
71 Ga0075430_100034937 3300006846 Bacteria 4268
72 Ga0075431_100011120 3300006847 Bacteria 9060
73 Ga0075431_100144522 3300006847 Bacteria 2451
74 Ga0075431_100461658 3300006847 Bacteria 1264
75 Ga0105240_10002755 3300009093 Bacteria 27775
76 Ga0105240_10010146 3300009093 Bacteria 13262
77 Ga0105240_10043792 3300009093 Bacteria 5692
78 Ga0105240_10087579 3300009093 Unclassified 3813
79 Ga0105240_10105215 3300009093 Unclassified 3426
80 Ga0105240_10117862 3300009093 Unclassified 3201
81 Ga0111539_10025895 3300009094 Bacteria 7181
82 Ga0111539_10052231 3300009094 Bacteria 4866
83 Ga0105241_10029336 3300009174 Bacteria 4104
84 Ga0105241_10224284 3300009174 Bacteria 1581
85 Ga0105237_10026726 3300009545 Bacteria 5898
86 Ga0105237_10032442 3300009545 Bacteria 5288
87 Ga0105237_10126119 3300009545 Unclassified 2554
88 Ga0105238_10021648 3300009551 Bacteria 6549
89 Ga0105238_10036050 3300009551 Bacteria 5028
90 Ga0105238_10110341 3300009551 Bacteria 2731
91 Ga0105249_10361488 3300009553 Unclassified 1473
92 Ga0105239_10012505 3300010375 Bacteria 9453
93 Ga0157373_10016340 3300013100 Bacteria 5414
94 Ga0157371_10003894 3300013102 Bacteria 13298
95 Ga0157371_10037314 3300013102 Bacteria 3478
96 Ga0157370_10025878 3300013104 Bacteria 5802
97 Ga0157369_10008210 3300013105 Bacteria 11974
98 Ga0157372_10000722 3300013307 Bacteria 36035
99 Ga0157372_10044483 3300013307 Bacteria 4920
100 Ga0157375_10214348 3300013308 Bacteria 2083
101 Ga0157380_10059503 3300014326 Bacteria 3049
102 Ga0157379_10158572 3300014968 Bacteria 2042
103 Ga0209674_102507 3300025226 Bacteria 3898
104 Ga0209673_1023330 3300025273 Bacteria 2110
105 Ga0209564_1000461 3300025295 Bacteria 68416
106 Ga0209758_1004692 3300025297 Bacteria 11163
107 Ga0209257_1000159 3300025304 Bacteria 178767
108 Ga0209257_1000402 3300025304 Bacteria 84536
109 Ga0207656_10101384 3300025321 Bacteria 1320
110 Ga0207682_10074085 3300025893 Bacteria 1447
111 Ga0207692_10116978 3300025898 Bacteria 1487
112 Ga0207647_10000516 3300025904 Bacteria 30815
113 Ga0207647_10001684 3300025904 Bacteria 17029
114 Ga0207647_10008642 3300025904 Bacteria 7281
115 Ga0207645_10002198 3300025907 Bacteria 15574
116 Ga0207643_10008979 3300025908 Bacteria 5365
117 Ga0207705_10000009 3300025909 Bacteria 576128
118 Ga0207654_10006855 3300025911 Bacteria 5734
119 Ga0207654_10182596 3300025911 Bacteria 1369
120 Ga0207707_10004036 3300025912 Bacteria 13014
121 Ga0207695_10002649 3300025913 Bacteria 26162
122 Ga0207695_10006300 3300025913 Bacteria 15444
123 Ga0207695_10026430 3300025913 Bacteria 6478
124 Ga0207695_10124954 3300025913 Unclassified 2536
125 Ga0207671_10030964 3300025914 Bacteria 3989
126 Ga0207693_10084783 3300025915 Bacteria 2482
127 Ga0207663_10064269 3300025916 Bacteria 2341
128 Ga0207657_10000281 3300025919 Bacteria 54261
129 Ga0207657_10002697 3300025919 Bacteria 19137
130 Ga0207657_10055094 3300025919 Bacteria 3436
131 Ga0207649_10121811 3300025920 Bacteria 1759
132 Ga0207652_10024547 3300025921 Bacteria 5003
133 Ga0207681_10058830 3300025923 Bacteria 2633
134 Ga0207681_10259146 3300025923 Bacteria 1361
135 Ga0207694_10011952 3300025924 Bacteria 6546
136 Ga0207694_10019838 3300025924 Bacteria 5085
137 Ga0207687_10044391 3300025927 Bacteria 3067
138 Ga0207700_10155843 3300025928 Bacteria 1892
139 Ga0207664_10071196 3300025929 Bacteria 2800
140 Ga0207690_10101969 3300025932 Bacteria 2051
141 Ga0207706_10002294 3300025933 Bacteria 18663
142 Ga0207706_10004216 3300025933 Bacteria 13540
143 Ga0207706_10005611 3300025933 Bacteria 11690
144 Ga0207706_10006033 3300025933 Bacteria 11270
145 Ga0207706_10141762 3300025933 Bacteria 2115
146 Ga0207691_10001861 3300025940 Bacteria 20637
147 Ga0207711_10225721 3300025941 Unclassified 1714
148 Ga0207689_10162203 3300025942 Bacteria 1842
149 Ga0207679_10020348 3300025945 Bacteria 4478
150 Ga0207679_10284331 3300025945 Bacteria 1420
151 Ga0207679_10354240 3300025945 Bacteria 1280
152 Ga0207667_10004412 3300025949 Bacteria 17219
153 Ga0207667_10011377 3300025949 Bacteria 10347
154 Ga0207667_10029717 3300025949 Bacteria 5921
155 Ga0207667_10230213 3300025949 Bacteria 1898
156 Ga0207712_10132081 3300025961 Bacteria 1904
157 Ga0207712_10231218 3300025961 Unclassified 1484
158 Ga0207668_10032672 3300025972 Bacteria 3442
159 Ga0207640_10000193 3300025981 Bacteria 43544
160 Ga0207703_10000439 3300026035 Bacteria 43808
161 Ga0207703_10112612 3300026035 Bacteria 2325
162 Ga0207639_10002633 3300026041 Bacteria 12050
163 Ga0207639_10062952 3300026041 Bacteria 2870
164 Ga0207639_10194017 3300026041 Bacteria 1737
165 Ga0207678_10001522 3300026067 Bacteria 21250
166 Ga0207678_10081597 3300026067 Bacteria 2768
167 Ga0207708_10121773 3300026075 Bacteria 2033
168 Ga0207702_10002821 3300026078 Bacteria 16253
169 Ga0207702_10007861 3300026078 Bacteria 9043
170 Ga0207702_10017481 3300026078 Bacteria 5933
171 Ga0207702_10052738 3300026078 Bacteria 3442
172 Ga0207702_10287706 3300026078 Bacteria 1556
173 Ga0207648_10002196 3300026089 Bacteria 21186
174 Ga0207648_10120783 3300026089 Bacteria 2304
175 Ga0207674_10004762 3300026116 Bacteria 16271
176 Ga0207674_10009638 3300026116 Bacteria 11016
177 Ga0207674_10386907 3300026116 Bacteria 1352
178 Ga0207674_10400939 3300026116 Bacteria 1326
179 Ga0207674_10456270 3300026116 Bacteria 1235
180 Ga0207675_100000018 3300026118 Bacteria 124200
181 Ga0207675_100002471 3300026118 Bacteria 18294
182 Ga0207698_10000320 3300026142 Bacteria 28735
183 Ga0207698_10003047 3300026142 Bacteria 10039
184 Ga0207698_10092625 3300026142 Bacteria 2478
185 Ga0209967_1003592 3300027364 Bacteria 2043
186 Ga0209970_1001512 3300027614 Bacteria 4055
187 Ga0210002_1000799 3300027617 Bacteria 4295
188 Ga0209983_1005352 3300027665 Bacteria 2661
189 Ga0209971_1001050 3300027682 Bacteria 7039
190 Ga0209966_1004450 3300027695 Bacteria 2377
191 Ga0209998_10000895 3300027717 Bacteria 7653
192 Ga0207428_10104934 3300027907 Bacteria 2180
193 Ga0268266_10000058 3300028379 Bacteria 277346
194 Ga0268266_10001861 3300028379 Bacteria 23842
195 Ga0268265_10128620 3300028380 Bacteria 2101
196 Ga0265326_10023032 3300028558 Bacteria 1781
197 Ga0265334_10001387 3300028573 Bacteria 11681
198 Ga0307509_10000002 3300031507 Bacteria 607551
199 Ga0307408_100084410 3300031548 Bacteria 2382
200 Ga0307408_100279153 3300031548 Unclassified 1390
201 Ga0307516_10000305 3300031730 Bacteria 63768
202 Ga0307405_10171137 3300031731 Unclassified 1549
203 Ga0307413_10055144 3300031824 Bacteria 2416
204 Ga0307413_10552527 3300031824 Bacteria 934
205 Ga0307406_10004991 3300031901 Bacteria 7229
206 Ga0307412_10003181 3300031911 Bacteria 9119
207 Ga0307412_10153433 3300031911 Unclassified 1702
208 Ga0307416_100059267 3300032002 Bacteria 3110
209 Ga0307416_100157727 3300032002 Bacteria 2092
210 Ga0307414_10053066 3300032004 Unclassified 2825
211 Ga0307414_10079839 3300032004 Bacteria 2390
212 Ga0307414_10180412 3300032004 Bacteria 1697
213 Ga0307411_10338162 3300032005 Bacteria 1222
214 Ga0316584_0276375 3300036712 Bacteria 1221
215 Ga0395899_0053682 3300037312 Bacteria 2983
216 Ga0395900_0023394 3300037418 Bacteria 6325
217 Ga0395898_0006169 3300037466 Bacteria 12840
218 Ga0439443_004127 3300042003 Bacteria 1875
219 Ga0439445_0020908 3300042004 Bacteria 1641
220 Ga0439462_0000440 3300042015 Bacteria 8124
221 Ga0450912_000003 3300042116 Bacteria 13298
222 Ga0439444_0000531 3300042437 Bacteria 4324
223 Ga0450893_0000082 3300042532 Bacteria 10231
224 Ga0466969_0001802 3300044656 Bacteria 11423
225 Ga0466969_0002943 3300044656 Bacteria 9092
226 Ga0466972_0071275 3300044658 Bacteria 1658
227 Ga0466966_0031590 3300044684 Bacteria 3433
228 Ga0466964_0277145 3300044706 Bacteria 837
229 Ga0466970_0000559 3300044765 Bacteria 18193
230 Ga0466959_0031145 3300045049 Bacteria 3947
231 Ga0466959_0144437 3300045049 Bacteria 1679
232 Ga0466958_0009488 3300045836 Bacteria 5426
233 Ga0466958_0264574 3300045836 Bacteria 1101
234 Ga0496100_0056952 3300048903 Bacteria 2559
235 Ga0496104_0008690 3300048907 Bacteria 9032
236 Ga0496104_0213132 3300048907 Bacteria 1843
237 Ga0496105_0068122 3300048908 Bacteria 2939
238 Ga0496114_0019661 3300048917 Bacteria 5473
239 Ga0496115_0013596 3300048918 Bacteria 6158
240 Ga0496119_0000119 3300048922 Bacteria 110434
241 Ga0496120_0002171 3300048923 Bacteria 20843
242 Ga0496126_0001431 3300048929 Bacteria 37495
243 Ga0501292_000017 3300049515 Bacteria 57254
244 Ga0501033_0043163 3300049570 Bacteria 3359
245 Ga0501033_0051983 3300049570 Bacteria 3037
246 Ga0501036_0000156 3300049572 Bacteria 45001
247 Ga0501036_0597809 3300049572 Bacteria 915
248 Ga0501037_0040355 3300049573 Bacteria 3435
249 Ga0501037_0082006 3300049573 Bacteria 2338
250 Ga0501038_0002624 3300049574 Bacteria 16804
251 Ga0501039_0001593 3300049575 Bacteria 16706
252 Ga0501040_0000799 3300049576 Bacteria 19570
253 Ga0501040_0004734 3300049576 Bacteria 8834
254 Ga0501041_0000362 3300049577 Bacteria 22561
255 Ga0501041_0005775 3300049577 Bacteria 7231
256 Ga0501042_0000430 3300049578 Bacteria 21331
257 Ga0501042_0146207 3300049578 Bacteria 1704
258 Ga0501043_0012186 3300049579 Bacteria 6720
259 Ga0501043_0249967 3300049579 Bacteria 1366
260 Ga0501046_0042317 3300049580 Bacteria 3632
261 Ga0501047_0520789 3300049581 Bacteria 1015
262 Ga0501048_0015561 3300049582 Bacteria 5619
263 Ga0501048_0068190 3300049582 Bacteria 2514
264 Ga0501068_0005114 3300049584 Bacteria 7145
265 Ga0501071_0000586 3300049587 Bacteria 18850
266 Ga0501071_0021658 3300049587 Bacteria 4479
267 Ga0501072_0002410 3300049588 Bacteria 14023
268 Ga0501072_0154784 3300049588 Bacteria 1828
269 Ga0501072_0267806 3300049588 Bacteria 1359
270 Ga0501073_0321866 3300049589 Bacteria 1067
271 Ga0501074_0031083 3300049590 Bacteria 3869
272 Ga0501075_0000191 3300049591 Bacteria 32035
273 Ga0501075_0007232 3300049591 Bacteria 7694
274 Ga0501076_0000170 3300049592 Bacteria 38043
275 Ga0501076_0004840 3300049592 Bacteria 9611
276 Ga0501077_0007608 3300049593 Bacteria 6686
277 Ga0501077_0019804 3300049593 Bacteria 4256
278 Ga0501245_000207 3300049708 Bacteria 6602
279 Ga0501079_0000635 3300049741 Bacteria 23374
280 Ga0501079_0042696 3300049741 Bacteria 3500
281 Ga0501080_0039102 3300049742 Bacteria 4428
282 Ga0501080_0046082 3300049742 Bacteria 4061
283 Ga0501081_0000380 3300049743 Bacteria 24400
284 Ga0501081_0251545 3300049743 Bacteria 1290
285 Ga0501083_0061158 3300049744 Bacteria 2515
286 Ga0501279_000019 3300049775 Bacteria 58746
287 Ga0501282_007309 3300049778 Bacteria 1182
288 Ga0501035_0026754 3300049822 Bacteria 5276
289 Ga0501035_0222315 3300049822 Bacteria 1612
290 Ga0501044_0069977 3300049823 Bacteria 3571
291 Ga0501045_0011381 3300049824 Bacteria 6247
292 Ga0501045_0222511 3300049824 Bacteria 1405
293 nmdc:mga0k408_33404_c1 3300050493 Bacteria 2942
294 nmdc:mga09592_104491_c1 3300050508 Bacteria 2427
295 nmdc:mga09592_22166_c1 3300050508 Bacteria 5241
296 nmdc:mga06r32_343616_c1 3300050510 Bacteria 1477
297 nmdc:mga08y16_30506_c1 3300050511 Bacteria 5674
298 nmdc:mga0sz30_372_c1 3300050516 Bacteria 17105
299 Ga0500583_0082808 3300053092 Bacteria 1552
300 Ga0500641_0022314 3300053096 Bacteria 2423
301 Ga0500658_0107953 3300053134 Bacteria 1222
302 Ga0500637_0110131 3300053178 Bacteria 1597
303 Ga0500587_004480 3300053739 Bacteria 1916
304 Ga0501084_0000851 3300054114 Bacteria 23584
305 Ga0501084_0010587 3300054114 Bacteria 7630
306 Ga0501084_0226770 3300054114 Bacteria 1577
307 Ga0501082_0008050 3300060353 Bacteria 9093
308 Ga0501082_0130534 3300060353 Bacteria 2180
309 Ga0466962_0037080 3300061719 Bacteria 2333
310 Ga0530510_0000156 3300061734 Bacteria 40875
311 Ga0530510_0002939 3300061734 Bacteria 11689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044706 Ga0466964_0277145 Ga0466964_0277145_86_817 235
2 3300026035 Ga0207703_10112612 Ga0207703_101126122 253
3 3300045836 Ga0466958_0264574 Ga0466958_0264574_120_1037 271
4 3300049570 Ga0501033_0043163 Ga0501033_0043163_714_1583 272
5 3300049572 Ga0501036_0597809 Ga0501036_0597809_28_849 272
6 3300049573 Ga0501037_0082006 Ga0501037_0082006_825_1694 272
7 3300049576 Ga0501040_0004734 Ga0501040_0004734_7543_8412 272
8 3300049577 Ga0501041_0005775 Ga0501041_0005775_1164_2033 272
9 3300049578 Ga0501042_0146207 Ga0501042_0146207_227_1096 272
10 3300049579 Ga0501043_0249967 Ga0501043_0249967_110_979 272
11 3300049582 Ga0501048_0015561 Ga0501048_0015561_1101_1970 272
12 3300049587 Ga0501071_0021658 Ga0501071_0021658_267_1136 272
13 3300049588 Ga0501072_0267806 Ga0501072_0267806_33_902 272
14 3300049591 Ga0501075_0007232 Ga0501075_0007232_2899_3768 272
15 3300049592 Ga0501076_0004840 Ga0501076_0004840_4823_5692 272
16 3300049593 Ga0501077_0019804 Ga0501077_0019804_926_1795 272
17 3300049741 Ga0501079_0042696 Ga0501079_0042696_1353_2222 272
18 3300049742 Ga0501080_0046082 Ga0501080_0046082_1757_2626 272
19 3300049744 Ga0501083_0061158 Ga0501083_0061158_1374_2243 272
20 3300054114 Ga0501084_0010587 Ga0501084_0010587_4572_5441 272
21 3300060353 Ga0501082_0130534 Ga0501082_0130534_1094_1963 272
22 3300061734 Ga0530510_0002939 Ga0530510_0002939_6156_7025 272
23 3300005366 Ga0070659_100043251 Ga0070659_1000432512 277
24 3300009551 Ga0105238_10110341 Ga0105238_101103412 277
25 3300048922 Ga0496119_0000119 Ga0496119_0000119_20434_21306 277
26 3300049572 Ga0501036_0000156 Ga0501036_0000156_10110_10979 277
27 3300049573 Ga0501037_0040355 Ga0501037_0040355_365_1234 277
28 3300049574 Ga0501038_0002624 Ga0501038_0002624_10335_11204 277
29 3300049575 Ga0501039_0001593 Ga0501039_0001593_5411_6280 277
30 3300049576 Ga0501040_0000799 Ga0501040_0000799_5651_6520 277
31 3300049577 Ga0501041_0000362 Ga0501041_0000362_16636_17505 277
32 3300049578 Ga0501042_0000430 Ga0501042_0000430_11792_12661 277
33 3300049579 Ga0501043_0012186 Ga0501043_0012186_2507_3376 277
34 3300049580 Ga0501046_0042317 Ga0501046_0042317_1556_2425 277
35 3300049582 Ga0501048_0068190 Ga0501048_0068190_148_1017 277
36 3300049584 Ga0501068_0005114 Ga0501068_0005114_3566_4435 277
37 3300049587 Ga0501071_0000586 Ga0501071_0000586_7429_8298 277
38 3300049588 Ga0501072_0002410 Ga0501072_0002410_174_1043 277
39 3300049589 Ga0501073_0321866 Ga0501073_0321866_71_940 277
40 3300049590 Ga0501074_0031083 Ga0501074_0031083_438_1307 277
41 3300049591 Ga0501075_0000191 Ga0501075_0000191_10462_11331 277
42 3300049592 Ga0501076_0000170 Ga0501076_0000170_24428_25297 277
43 3300049593 Ga0501077_0007608 Ga0501077_0007608_5763_6632 277
44 3300049741 Ga0501079_0000635 Ga0501079_0000635_9176_10045 277
45 3300049742 Ga0501080_0039102 Ga0501080_0039102_1716_2585 277
46 3300049743 Ga0501081_0000380 Ga0501081_0000380_10478_11347 277
47 3300049822 Ga0501035_0026754 Ga0501035_0026754_964_1833 277
48 3300049824 Ga0501045_0011381 Ga0501045_0011381_4230_5099 277
49 3300054114 Ga0501084_0000851 Ga0501084_0000851_5666_6535 277
50 3300060353 Ga0501082_0008050 Ga0501082_0008050_2595_3464 277
51 3300061734 Ga0530510_0000156 Ga0530510_0000156_31081_31950 277
52 3300025893 Ga0207682_10074085 Ga0207682_100740852 278
53 3300005434 Ga0070709_10003457 Ga0070709_100034571 280
54 3300005435 Ga0070714_100019704 Ga0070714_1000197045 280
55 3300005614 Ga0068856_100149315 Ga0068856_1001493152 280
56 3300006175 Ga0070712_100227095 Ga0070712_1002270952 280
57 3300025898 Ga0207692_10116978 Ga0207692_101169782 280
58 3300025915 Ga0207693_10084783 Ga0207693_100847833 280
59 3300025928 Ga0207700_10155843 Ga0207700_101558432 280
60 3300025929 Ga0207664_10071196 Ga0207664_100711961 280
61 3300048903 Ga0496100_0056952 Ga0496100_0056952_331_1191 280
62 3300048907 Ga0496104_0213132 Ga0496104_0213132_856_1716 280
63 3300005548 Ga0070665_100005884 Ga0070665_1000058846 281
64 3300005937 Ga0081455_10000579 Ga0081455_1000057939 281
65 3300009093 Ga0105240_10105215 Ga0105240_101052152 281
66 3300009093 Ga0105240_10117862 Ga0105240_101178623 281
67 3300009545 Ga0105237_10026726 Ga0105237_100267262 281
68 3300014326 Ga0157380_10059503 Ga0157380_100595032 281
69 3300025913 Ga0207695_10026430 Ga0207695_100264302 281
70 3300025923 Ga0207681_10259146 Ga0207681_102591462 281
71 3300025927 Ga0207687_10044391 Ga0207687_100443912 281
72 3300026075 Ga0207708_10121773 Ga0207708_101217732 281
73 3300028379 Ga0268266_10000058 Ga0268266_1000005864 281
74 3300028379 Ga0268266_10001861 Ga0268266_1000186111 281
75 3300031730 Ga0307516_10000305 Ga0307516_1000030547 281
76 3300042003 Ga0439443_004127 Ga0439443_004127_717_1589 281
77 3300048929 Ga0496126_0001431 Ga0496126_0001431_11783_12646 281
78 3300053178 Ga0500637_0110131 Ga0500637_0110131_618_1481 281
79 3300053739 Ga0500587_004480 Ga0500587_004480_485_1342 281
80 3300005329 Ga0070683_100005574 Ga0070683_1000055742 282
81 3300005434 Ga0070709_10023554 Ga0070709_100235543 282
82 3300005436 Ga0070713_100458619 Ga0070713_1004586191 282
83 3300005458 Ga0070681_10052763 Ga0070681_100527633 282
84 3300009093 Ga0105240_10087579 Ga0105240_100875794 282
85 3300009545 Ga0105237_10126119 Ga0105237_101261192 282
86 3300025913 Ga0207695_10124954 Ga0207695_101249542 282
87 3300045049 Ga0466959_0144437 Ga0466959_0144437_389_1255 282
88 3300049588 Ga0501072_0154784 Ga0501072_0154784_179_1045 282
89 3300049743 Ga0501081_0251545 Ga0501081_0251545_339_1205 282
90 3300049824 Ga0501045_0222511 Ga0501045_0222511_17_883 282
91 3300005336 Ga0070680_100486263 Ga0070680_1004862631 284
92 3300005458 Ga0070681_10008914 Ga0070681_100089142 284
93 3300005614 Ga0068856_100330776 Ga0068856_1003307762 284
94 3300025912 Ga0207707_10004036 Ga0207707_100040365 284
95 3300025916 Ga0207663_10064269 Ga0207663_100642692 284
96 3300025921 Ga0207652_10024547 Ga0207652_100245473 284
97 3300026078 Ga0207702_10287706 Ga0207702_102877062 284
98 3300048907 Ga0496104_0008690 Ga0496104_0008690_6471_7385 284
99 3300048908 Ga0496105_0068122 Ga0496105_0068122_35_949 284
100 3300048917 Ga0496114_0019661 Ga0496114_0019661_377_1291 284
101 3300048918 Ga0496115_0013596 Ga0496115_0013596_145_1059 284
102 3300006844 Ga0075428_100041104 Ga0075428_1000411043 285
103 3300006847 Ga0075431_100011120 Ga0075431_1000111207 285
104 3300009094 Ga0111539_10052231 Ga0111539_100522314 285
105 3300048923 Ga0496120_0002171 Ga0496120_0002171_7649_8530 285
106 3300050508 nmdc:mga09592_104491_c1 nmdc:mga09592_104491_c1_463_1338 285
107 3300050510 nmdc:mga06r32_343616_c1 nmdc:mga06r32_343616_c1_10_885 285
108 3300042437 Ga0439444_0000531 Ga0439444_0000531_1353_2234 287
109 3300005333 Ga0070677_10011926 Ga0070677_100119262 288
110 3300005336 Ga0070680_100024301 Ga0070680_1000243012 288
111 3300005341 Ga0070691_10025824 Ga0070691_100258243 288
112 3300005353 Ga0070669_100098605 Ga0070669_1000986053 288
113 3300005356 Ga0070674_100503675 Ga0070674_1005036751 288
114 3300005459 Ga0068867_100093909 Ga0068867_1000939093 288
115 3300005563 Ga0068855_100009844 Ga0068855_1000098443 288
116 3300005578 Ga0068854_100085442 Ga0068854_1000854423 288
117 3300005844 Ga0068862_100014053 Ga0068862_1000140532 288
118 3300006847 Ga0075431_100461658 Ga0075431_1004616582 288
119 3300009093 Ga0105240_10043792 Ga0105240_100437923 288
120 3300009094 Ga0111539_10025895 Ga0111539_100258952 288
121 3300009545 Ga0105237_10032442 Ga0105237_100324425 288
122 3300025907 Ga0207645_10002198 Ga0207645_1000219814 288
123 3300025908 Ga0207643_10008979 Ga0207643_100089794 288
124 3300025914 Ga0207671_10030964 Ga0207671_100309643 288
125 3300025923 Ga0207681_10058830 Ga0207681_100588302 288
126 3300025933 Ga0207706_10002294 Ga0207706_1000229418 288
127 3300025933 Ga0207706_10141762 Ga0207706_101417622 288
128 3300025940 Ga0207691_10001861 Ga0207691_1000186115 288
129 3300025942 Ga0207689_10162203 Ga0207689_101622032 288
130 3300025949 Ga0207667_10011377 Ga0207667_100113776 288
131 3300025961 Ga0207712_10132081 Ga0207712_101320811 288
132 3300025972 Ga0207668_10032672 Ga0207668_100326723 288
133 3300026089 Ga0207648_10002196 Ga0207648_1000219613 288
134 3300026089 Ga0207648_10120783 Ga0207648_101207832 288
135 3300026116 Ga0207674_10386907 Ga0207674_103869072 288
136 3300026118 Ga0207675_100002471 Ga0207675_10000247111 288
137 3300027364 Ga0209967_1003592 Ga0209967_10035922 288
138 3300027614 Ga0209970_1001512 Ga0209970_10015123 288
139 3300027617 Ga0210002_1000799 Ga0210002_10007993 288
140 3300027665 Ga0209983_1005352 Ga0209983_10053523 288
141 3300027682 Ga0209971_1001050 Ga0209971_10010506 288
142 3300027695 Ga0209966_1004450 Ga0209966_10044503 288
143 3300027717 Ga0209998_10000895 Ga0209998_100008954 288
144 3300027907 Ga0207428_10104934 Ga0207428_101049343 288
145 3300028380 Ga0268265_10128620 Ga0268265_101286203 288
146 3300031507 Ga0307509_10000002 Ga0307509_10000002230 288
147 3300044656 Ga0466969_0001802 Ga0466969_0001802_9255_10154 288
148 3300050511 nmdc:mga08y16_30506_c1 nmdc:mga08y16_30506_c1_276_1160 288
149 3300053092 Ga0500583_0082808 Ga0500583_0082808_513_1397 288
150 3300053134 Ga0500658_0107953 Ga0500658_0107953_194_1078 288
151 3300054114 Ga0501084_0226770 Ga0501084_0226770_394_1278 288
152 iso_pu_bacteria 2818991435 2819538834 288
153 iso_pu_bacteria 2728369276 2729905308 289
154 3300006844 Ga0075428_100098105 Ga0075428_1000981053 290
155 3300006846 Ga0075430_100034937 Ga0075430_1000349373 290
156 3300006847 Ga0075431_100144522 Ga0075431_1001445223 290
157 3300025941 Ga0207711_10225721 Ga0207711_102257212 290
158 3300050508 nmdc:mga09592_22166_c1 nmdc:mga09592_22166_c1_2092_2982 290
159 3300003322 rootL2_10026182 rootL2_100261824 292
160 3300003794 Ga0055531_10003911 Ga0055531_100039118 292
161 3300005262 Ga0065165_1000428 Ga0065165_100042836 292
162 3300005262 Ga0065165_1017648 Ga0065165_10176482 292
163 3300006186 Ga0075369_10093311 Ga0075369_100933111 292
164 3300025273 Ga0209673_1023330 Ga0209673_10233302 292
165 3300025295 Ga0209564_1000461 Ga0209564_100046134 292
166 3300025297 Ga0209758_1004692 Ga0209758_10046926 292
167 3300025304 Ga0209257_1000159 Ga0209257_100015928 292
168 3300025304 Ga0209257_1000402 Ga0209257_100040248 292
169 3300036712 Ga0316584_0276375 Ga0316584_0276375_215_1105 292
170 3300050493 nmdc:mga0k408_33404_c1 nmdc:mga0k408_33404_c1_534_1433 292
171 3300050516 nmdc:mga0sz30_372_c1 nmdc:mga0sz30_372_c1_10831_11730 292
172 3300001989 JGI24739J22299_10001030 JGI24739J22299_100010302 293
173 3300001990 JGI24737J22298_10000335 JGI24737J22298_100003357 293
174 3300002067 JGI24735J21928_10000070 JGI24735J21928_1000007010 293
175 3300005293 Ga0065715_10198755 Ga0065715_101987551 293
176 3300005327 Ga0070658_10032126 Ga0070658_100321263 293
177 3300005336 Ga0070680_100202933 Ga0070680_1002029331 293
178 3300005337 Ga0070682_100065446 Ga0070682_1000654463 293
179 3300005339 Ga0070660_100294616 Ga0070660_1002946161 293
180 3300005366 Ga0070659_100081093 Ga0070659_1000810932 293
181 3300005458 Ga0070681_10007054 Ga0070681_100070548 293
182 3300005530 Ga0070679_100027645 Ga0070679_1000276456 293
183 3300005535 Ga0070684_100145947 Ga0070684_1001459471 293
184 3300005539 Ga0068853_100011133 Ga0068853_1000111335 293
185 3300005539 Ga0068853_100121863 Ga0068853_1001218633 293
186 3300005563 Ga0068855_100008073 Ga0068855_1000080734 293
187 3300005564 Ga0070664_100028925 Ga0070664_1000289254 293
188 3300005564 Ga0070664_100031233 Ga0070664_1000312332 293
189 3300005577 Ga0068857_100018898 Ga0068857_1000188982 293
190 3300005614 Ga0068856_100002394 Ga0068856_1000023949 293
191 3300005614 Ga0068856_100017851 Ga0068856_1000178514 293
192 3300005614 Ga0068856_100391148 Ga0068856_1003911482 293
193 3300005616 Ga0068852_100000302 Ga0068852_10000030210 293
194 3300005719 Ga0068861_100000027 Ga0068861_10000002730 293
195 3300005842 Ga0068858_100000785 Ga0068858_10000078512 293
196 3300009093 Ga0105240_10010146 Ga0105240_1001014611 293
197 3300013102 Ga0157371_10037314 Ga0157371_100373143 293
198 3300013104 Ga0157370_10025878 Ga0157370_100258786 293
199 3300013105 Ga0157369_10008210 Ga0157369_100082109 293
200 3300013307 Ga0157372_10044483 Ga0157372_100444833 293
201 3300013308 Ga0157375_10214348 Ga0157375_102143483 293
202 3300014968 Ga0157379_10158572 Ga0157379_101585722 293
203 3300025226 Ga0209674_102507 Ga0209674_1025072 293
204 3300025904 Ga0207647_10000516 Ga0207647_1000051621 293
205 3300025919 Ga0207657_10000281 Ga0207657_1000028152 293
206 3300025919 Ga0207657_10055094 Ga0207657_100550943 293
207 3300025920 Ga0207649_10121811 Ga0207649_101218112 293
208 3300025932 Ga0207690_10101969 Ga0207690_101019692 293
209 3300025933 Ga0207706_10004216 Ga0207706_100042162 293
210 3300025933 Ga0207706_10005611 Ga0207706_1000561112 293
211 3300025945 Ga0207679_10020348 Ga0207679_100203483 293
212 3300025945 Ga0207679_10284331 Ga0207679_102843311 293
213 3300025949 Ga0207667_10029717 Ga0207667_100297175 293
214 3300025949 Ga0207667_10230213 Ga0207667_102302132 293
215 3300026035 Ga0207703_10000439 Ga0207703_1000043941 293
216 3300026041 Ga0207639_10002633 Ga0207639_100026337 293
217 3300026041 Ga0207639_10062952 Ga0207639_100629522 293
218 3300026041 Ga0207639_10194017 Ga0207639_101940172 293
219 3300026067 Ga0207678_10081597 Ga0207678_100815971 293
220 3300026078 Ga0207702_10002821 Ga0207702_100028216 293
221 3300026078 Ga0207702_10052738 Ga0207702_100527385 293
222 3300026116 Ga0207674_10009638 Ga0207674_1000963812 293
223 3300026116 Ga0207674_10400939 Ga0207674_104009392 293
224 3300026116 Ga0207674_10456270 Ga0207674_104562702 293
225 3300026118 Ga0207675_100000018 Ga0207675_10000001849 293
226 3300026142 Ga0207698_10003047 Ga0207698_100030479 293
227 3300028558 Ga0265326_10023032 Ga0265326_100230322 293
228 3300028573 Ga0265334_10001387 Ga0265334_1000138710 293
229 3300037312 Ga0395899_0053682 Ga0395899_0053682_1480_2382 293
230 3300037418 Ga0395900_0023394 Ga0395900_0023394_1508_2410 293
231 3300037466 Ga0395898_0006169 Ga0395898_0006169_3085_3987 293
232 3300044656 Ga0466969_0002943 Ga0466969_0002943_5533_6450 293
233 3300044658 Ga0466972_0071275 Ga0466972_0071275_380_1276 293
234 3300044684 Ga0466966_0031590 Ga0466966_0031590_1270_2187 293
235 3300044765 Ga0466970_0000559 Ga0466970_0000559_2677_3594 293
236 3300045049 Ga0466959_0031145 Ga0466959_0031145_944_1861 293
237 3300045836 Ga0466958_0009488 Ga0466958_0009488_88_990 293
238 3300049570 Ga0501033_0051983 Ga0501033_0051983_1432_2328 293
239 3300049581 Ga0501047_0520789 Ga0501047_0520789_109_993 293
240 3300049822 Ga0501035_0222315 Ga0501035_0222315_32_916 293
241 3300049823 Ga0501044_0069977 Ga0501044_0069977_135_1019 293
242 3300061719 Ga0466962_0037080 Ga0466962_0037080_1129_2046 293
243 3300042015 Ga0439462_0000440 Ga0439462_0000440_798_1721 294
244 3300053096 Ga0500641_0022314 Ga0500641_0022314_1434_2375 294
245 iso_pu_bacteria 2896184354 2896186533 294
246 iso_pu_bacteria 2896253425 2896253851 294
247 3300009553 Ga0105249_10361488 Ga0105249_103614882 295
248 3300025961 Ga0207712_10231218 Ga0207712_102312182 295
249 3300001979 JGI24740J21852_10000497 JGI24740J21852_1000049712 296
250 3300001989 JGI24739J22299_10000214 JGI24739J22299_100002148 296
251 3300001990 JGI24737J22298_10000367 JGI24737J22298_100003678 296
252 3300002067 JGI24735J21928_10001472 JGI24735J21928_1000147212 296
253 3300002075 JGI24738J21930_10010240 JGI24738J21930_100102402 296
254 3300005327 Ga0070658_10000139 Ga0070658_1000013941 296
255 3300005339 Ga0070660_100052494 Ga0070660_1000524943 296
256 3300005458 Ga0070681_10556041 Ga0070681_105560411 296
257 3300005563 Ga0068855_100004272 Ga0068855_1000042727 296
258 3300005563 Ga0068855_100021286 Ga0068855_1000212865 296
259 3300005577 Ga0068857_100019510 Ga0068857_1000195102 296
260 3300005578 Ga0068854_100000298 Ga0068854_1000002985 296
261 3300005614 Ga0068856_100003382 Ga0068856_10000338211 296
262 3300005616 Ga0068852_100000545 Ga0068852_10000054515 296
263 3300005616 Ga0068852_100018020 Ga0068852_1000180203 296
264 3300005834 Ga0068851_10002017 Ga0068851_100020172 296
265 3300009093 Ga0105240_10002755 Ga0105240_1000275510 296
266 3300009174 Ga0105241_10029336 Ga0105241_100293362 296
267 3300009174 Ga0105241_10224284 Ga0105241_102242842 296
268 3300009551 Ga0105238_10021648 Ga0105238_100216484 296
269 3300009551 Ga0105238_10036050 Ga0105238_100360502 296
270 3300010375 Ga0105239_10012505 Ga0105239_100125052 296
271 3300013100 Ga0157373_10016340 Ga0157373_100163403 296
272 3300013102 Ga0157371_10003894 Ga0157371_100038942 296
273 3300013307 Ga0157372_10000722 Ga0157372_100007226 296
274 3300025321 Ga0207656_10101384 Ga0207656_101013841 296
275 3300025904 Ga0207647_10001684 Ga0207647_100016849 296
276 3300025904 Ga0207647_10008642 Ga0207647_100086423 296
277 3300025909 Ga0207705_10000009 Ga0207705_1000000915 296
278 3300025911 Ga0207654_10006855 Ga0207654_100068553 296
279 3300025911 Ga0207654_10182596 Ga0207654_101825962 296
280 3300025913 Ga0207695_10002649 Ga0207695_100026499 296
281 3300025913 Ga0207695_10006300 Ga0207695_100063008 296
282 3300025919 Ga0207657_10002697 Ga0207657_1000269712 296
283 3300025924 Ga0207694_10011952 Ga0207694_100119524 296
284 3300025924 Ga0207694_10019838 Ga0207694_100198383 296
285 3300025933 Ga0207706_10006033 Ga0207706_100060332 296
286 3300025945 Ga0207679_10354240 Ga0207679_103542402 296
287 3300025949 Ga0207667_10004412 Ga0207667_100044128 296
288 3300025981 Ga0207640_10000193 Ga0207640_1000019315 296
289 3300026067 Ga0207678_10001522 Ga0207678_100015228 296
290 3300026078 Ga0207702_10007861 Ga0207702_100078614 296
291 3300026078 Ga0207702_10017481 Ga0207702_100174812 296
292 3300026116 Ga0207674_10004762 Ga0207674_1000476211 296
293 3300026142 Ga0207698_10000320 Ga0207698_100003208 296
294 3300026142 Ga0207698_10092625 Ga0207698_100926251 296
295 3300031548 Ga0307408_100084410 Ga0307408_1000844103 296
296 3300031548 Ga0307408_100279153 Ga0307408_1002791532 296
297 3300031731 Ga0307405_10171137 Ga0307405_101711372 296
298 3300031824 Ga0307413_10055144 Ga0307413_100551442 296
299 3300031824 Ga0307413_10552527 Ga0307413_105525271 296
300 3300031901 Ga0307406_10004991 Ga0307406_100049912 296
301 3300031911 Ga0307412_10003181 Ga0307412_100031812 296
302 3300031911 Ga0307412_10153433 Ga0307412_101534332 296
303 3300032002 Ga0307416_100059267 Ga0307416_1000592672 296
304 3300032002 Ga0307416_100157727 Ga0307416_1001577272 296
305 3300032004 Ga0307414_10053066 Ga0307414_100530662 296
306 3300032004 Ga0307414_10079839 Ga0307414_100798392 296
307 3300032004 Ga0307414_10180412 Ga0307414_101804122 296
308 3300032005 Ga0307411_10338162 Ga0307411_103381621 296
309 3300042004 Ga0439445_0020908 Ga0439445_0020908_170_1060 296
310 3300042116 Ga0450912_000003 Ga0450912_000003_3544_4434 296
311 3300042532 Ga0450893_0000082 Ga0450893_0000082_1173_2063 296
312 3300049515 Ga0501292_000017 Ga0501292_000017_29242_30132 296
313 3300049708 Ga0501245_000207 Ga0501245_000207_5443_6333 296
314 3300049775 Ga0501279_000019 Ga0501279_000019_28602_29492 296
315 3300049778 Ga0501282_007309 Ga0501282_007309_216_1106 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

11

207

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

17

226

0.91

PF08659

KR

KR domain

12

183

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zzp-assembly2.cif.gz_D-3 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and 3-oxovalerate 0.9518 2 192
4yae-assembly1.cif.gz_B crystal structure of ligl-apo form from sphingobium sp. strain syk-6 0.9491 3 266
4mow-assembly1.cif.gz_C crystal structure of a putative glucose 1-dehydrogenase from burkholderia cenocepacia j2315 0.9477 3 190
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9472 7 237
4trr-assembly2.cif.gz_G crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 0.9469 5 190
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9539 91 188 3.40.50.720
3ioyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9517 5 248 3.40.50.720
4yaeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9502 3 266 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9472 7 237 3.40.50.720
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9469 5 190 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A534PYM4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9723 1 188 GO:0016491
AF-A0A534PYM4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9672 1 188 GO:0016491
AF-A0A2N3E5P0-F1-model_v4 Short-chain dehydrogenase 0.9613 1 183 GO:0016491
AF-A0A2D5KQ22-F1-model_v4 deleted 0.9586 3 188
AF-A0A7K1CVG8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9573 2 188 GO:0016616

Feature Viewer

pLDDT pTM Quality
91.97 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map