F403567

General Info

Members Datasets Scaffolds Average Seq Length
316 177 316 98

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10221003|Ga0070681_102210031
Length 115
Sequence LRASWDGNFRRAVKASMIPIQESAKGIAFAVKVHPRARKNAITGEVGDALKLALTAPPVEGKANQAVIEFFAELFAIPRSSVTIASGETSRNKIVRIAGVSKPAAEQKLAENFKS

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
61 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
105 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.75
Rhizosphere 94.94
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10074561 3300002239 Unclassified 612
2 Ga0070683_101217744 3300005329 Unclassified 723
3 Ga0068869_100000935 3300005334 Bacteria 16859
4 Ga0070680_100345537 3300005336 Bacteria 1265
5 Ga0070682_100140957 3300005337 Bacteria 1643
6 Ga0068868_100625937 3300005338 Unclassified 956
7 Ga0070692_10073119 3300005345 Bacteria 1831
8 Ga0070675_100552754 3300005354 Unclassified 1041
9 Ga0070673_101881982 3300005364 Unclassified 567
10 Ga0070659_100886054 3300005366 Unclassified 779
11 Ga0070709_10282878 3300005434 Bacteria 1206
12 Ga0070709_10370414 3300005434 Bacteria 1062
13 Ga0070709_10418277 3300005434 Bacteria 1004
14 Ga0070714_100000075 3300005435 Bacteria 84982
15 Ga0070714_100020172 3300005435 Bacteria 5440
16 Ga0070714_100032486 3300005435 Unclassified 4356
17 Ga0070714_100774531 3300005435 Unclassified 928
18 Ga0070714_100947804 3300005435 Bacteria 836
19 Ga0070714_101401075 3300005435 Unclassified 682
20 Ga0070713_100000134 3300005436 Bacteria 48639
21 Ga0070713_100134429 3300005436 Bacteria 2184
22 Ga0070713_100502385 3300005436 Bacteria 1144
23 Ga0070710_10116543 3300005437 Bacteria 1611
24 Ga0070711_100000271 3300005439 Bacteria 26787
25 Ga0070711_100030638 3300005439 Unclassified 3564
26 Ga0070711_100038547 3300005439 Bacteria 3214
27 Ga0070711_100726746 3300005439 Bacteria 838
28 Ga0070708_100101496 3300005445 Unclassified 2635
29 Ga0070662_100660921 3300005457 Bacteria 882
30 Ga0070681_10129032 3300005458 Bacteria 2461
31 Ga0070681_10221003 3300005458 Bacteria 1809
32 Ga0070698_101903270 3300005471 Bacteria 548
33 Ga0070679_100806998 3300005530 Unclassified 882
34 Ga0070684_101957605 3300005535 Unclassified 553
35 Ga0068853_100024017 3300005539 Bacteria 5109
36 Ga0068853_101597396 3300005539 Bacteria 632
37 Ga0070693_101559989 3300005547 Unclassified 518
38 Ga0070665_100232433 3300005548 Bacteria 1844
39 Ga0068855_100064646 3300005563 Bacteria 4267
40 Ga0070664_100932721 3300005564 Bacteria 815
41 Ga0068856_102356889 3300005614 Unclassified 540
42 Ga0068859_100062826 3300005617 Unclassified 3744
43 Ga0068858_100001619 3300005842 Bacteria 22968
44 Ga0068860_100005894 3300005843 Bacteria 12335
45 Ga0068862_100097898 3300005844 Bacteria 2562
46 Ga0070717_10011648 3300006028 Bacteria 6688
47 Ga0070717_10018940 3300006028 Bacteria 5389
48 Ga0070717_10236080 3300006028 Bacteria 1611
49 Ga0070717_10316062 3300006028 Bacteria 1391
50 Ga0070717_10374871 3300006028 Bacteria 1275
51 Ga0070717_10964286 3300006028 Unclassified 777
52 Ga0070717_12128404 3300006028 Bacteria 505
53 Ga0070715_10003006 3300006163 Bacteria 5274
54 Ga0070715_11097665 3300006163 Unclassified 501
55 Ga0070716_100003540 3300006173 Bacteria 7367
56 Ga0070716_100017381 3300006173 Bacteria 3728
57 Ga0070716_100060259 3300006173 Bacteria 2191
58 Ga0070716_101346165 3300006173 Bacteria 579
59 Ga0070716_101718595 3300006173 Unclassified 518
60 Ga0070712_100000262 3300006175 Bacteria 29465
61 Ga0070712_100002390 3300006175 Bacteria 11557
62 Ga0070712_100322822 3300006175 Bacteria 1256
63 Ga0097621_100111033 3300006237 Unclassified 2316
64 Ga0075434_100033911 3300006871 Bacteria 5040
65 Ga0075434_101764034 3300006871 Unclassified 626
66 Ga0068865_100314018 3300006881 Unclassified 1258
67 Ga0075436_100604275 3300006914 Bacteria 808
68 Ga0097620_100062828 3300006931 Unclassified 3744
69 Ga0075435_100719169 3300007076 Unclassified 868
70 Ga0075435_100903035 3300007076 Unclassified 770
71 Ga0105240_10157882 3300009093 Bacteria 2696
72 Ga0105245_10002858 3300009098 Bacteria 15509
73 Ga0105245_10317201 3300009098 Bacteria 1534
74 Ga0105242_10142758 3300009176 Bacteria 2080
75 Ga0105242_10210220 3300009176 Unclassified 1734
76 Ga0105248_10264320 3300009177 Bacteria 1937
77 Ga0105237_10136586 3300009545 Bacteria 2446
78 Ga0105237_10236827 3300009545 Bacteria 1827
79 Ga0105238_11835860 3300009551 Bacteria 638
80 Ga0105249_10409980 3300009553 Unclassified 1387
81 Ga0105239_10014364 3300010375 Bacteria 8786
82 Ga0105239_10504148 3300010375 Bacteria 1376
83 Ga0105239_10615858 3300010375 Unclassified 1239
84 Ga0105246_10503857 3300011119 Bacteria 1029
85 Ga0157370_10131759 3300013104 Bacteria 2332
86 Ga0157369_12693769 3300013105 Unclassified 501
87 Ga0157374_10012766 3300013296 Bacteria 7319
88 Ga0157374_10308941 3300013296 Bacteria 1565
89 Ga0157378_10121664 3300013297 Bacteria 2406
90 Ga0157378_10596466 3300013297 Bacteria 1115
91 Ga0157378_12068958 3300013297 Unclassified 620
92 Ga0163162_10004210 3300013306 Bacteria 13826
93 Ga0157372_11107502 3300013307 Unclassified 916
94 Ga0157375_10084316 3300013308 Unclassified 3226
95 Ga0157376_10178865 3300014969 Bacteria 1937
96 Ga0157376_11424695 3300014969 Unclassified 725
97 Ga0182007_10028410 3300015262 Bacteria 1922
98 Ga0224569_107404 3300022732 Bacteria 795
99 Ga0228598_1002843 3300024227 Bacteria 3756
100 Ga0207656_10626200 3300025321 Unclassified 550
101 Ga0207692_10002000 3300025898 Bacteria 7789
102 Ga0207692_10605815 3300025898 Bacteria 704
103 Ga0207647_10002874 3300025904 Bacteria 12974
104 Ga0207685_10003971 3300025905 Bacteria 3683
105 Ga0207685_10801074 3300025905 Unclassified 519
106 Ga0207699_10041384 3300025906 Unclassified 2661
107 Ga0207699_10387185 3300025906 Bacteria 993
108 Ga0207699_10519368 3300025906 Bacteria 861
109 Ga0207699_11174733 3300025906 Unclassified 568
110 Ga0207684_11317558 3300025910 Bacteria 594
111 Ga0207707_11537217 3300025912 Unclassified 526
112 Ga0207693_10000275 3300025915 Bacteria 47590
113 Ga0207693_10008118 3300025915 Bacteria 8605
114 Ga0207693_10092417 3300025915 Bacteria 2371
115 Ga0207663_10004323 3300025916 Bacteria 7053
116 Ga0207663_10207112 3300025916 Bacteria 1419
117 Ga0207663_10598892 3300025916 Bacteria 866
118 Ga0207663_10666157 3300025916 Bacteria 822
119 Ga0207646_10741999 3300025922 Bacteria 876
120 Ga0207687_10003150 3300025927 Bacteria 11190
121 Ga0207700_10000111 3300025928 Bacteria 48784
122 Ga0207700_10006979 3300025928 Bacteria 6872
123 Ga0207700_10149384 3300025928 Bacteria 1929
124 Ga0207700_10201224 3300025928 Bacteria 1678
125 Ga0207664_10000096 3300025929 Bacteria 81164
126 Ga0207664_10043578 3300025929 Bacteria 3510
127 Ga0207664_10116333 3300025929 Unclassified 2231
128 Ga0207664_10885386 3300025929 Unclassified 802
129 Ga0207664_11618233 3300025929 Unclassified 570
130 Ga0207706_11707083 3300025933 Unclassified 507
131 Ga0207704_10281424 3300025938 Unclassified 1264
132 Ga0207665_10000358 3300025939 Bacteria 31676
133 Ga0207665_10031372 3300025939 Bacteria 3516
134 Ga0207665_10559963 3300025939 Unclassified 889
135 Ga0207665_10711543 3300025939 Unclassified 790
136 Ga0207689_10000542 3300025942 Bacteria 35861
137 Ga0207661_11004414 3300025944 Bacteria 768
138 Ga0207661_11770303 3300025944 Bacteria 563
139 Ga0207679_10704520 3300025945 Unclassified 916
140 Ga0207667_10165895 3300025949 Bacteria 2271
141 Ga0207651_11905944 3300025960 Unclassified 534
142 Ga0207677_10108430 3300026023 Bacteria 2062
143 Ga0207677_10111955 3300026023 Bacteria 2035
144 Ga0207703_10010977 3300026035 Bacteria 7058
145 Ga0207702_10077565 3300026078 Bacteria 2874
146 Ga0207702_10275050 3300026078 Bacteria 1590
147 Ga0207641_10097653 3300026088 Bacteria 2582
148 Ga0207675_100081187 3300026118 Bacteria 3040
149 Ga0207683_10317237 3300026121 Bacteria 1427
150 Ga0207698_10757315 3300026142 Unclassified 970
151 Ga0268265_10042450 3300028380 Bacteria 3375
152 Ga0268264_10020572 3300028381 Bacteria 5392
153 Ga0265336_10048924 3300028666 Bacteria 1281
154 Ga0265338_10003551 3300028800 Bacteria 21796
155 Ga0265338_10004711 3300028800 Bacteria 18253
156 Ga0265338_10027722 3300028800 Bacteria 5675
157 Ga0265338_10041379 3300028800 Bacteria 4310
158 Ga0265338_10047557 3300028800 Bacteria 3917
159 Ga0265338_10069802 3300028800 Bacteria 3017
160 Ga0265338_10256899 3300028800 Bacteria 1286
161 Ga0265762_1091236 3300030760 Unclassified 665
162 Ga0265325_10006235 3300031241 Bacteria 7269
163 Ga0265325_10129594 3300031241 Bacteria 1209
164 Ga0265340_10515609 3300031247 Unclassified 526
165 Ga0265339_10072264 3300031249 Bacteria 1836
166 Ga0265339_10074494 3300031249 Bacteria 1803
167 Ga0265339_10204121 3300031249 Bacteria 973
168 Ga0265331_10345709 3300031250 Unclassified 666
169 Ga0265331_10541623 3300031250 Unclassified 525
170 Ga0265316_10016458 3300031344 Bacteria 6412
171 Ga0265316_10041841 3300031344 Bacteria 3664
172 Ga0265316_10285616 3300031344 Unclassified 1205
173 Ga0307408_100017169 3300031548 Unclassified 4842
174 Ga0265314_10038372 3300031711 Unclassified 3461
175 Ga0265314_10043404 3300031711 Unclassified 3198
176 Ga0265314_10412027 3300031711 Unclassified 728
177 Ga0307409_100012125 3300031995 Bacteria 5476
178 Ga0307416_100089065 3300032002 Bacteria 2641
179 Ga0373938_0087895 3300034957 Bacteria 765
180 Ga0373926_0057730 3300035083 Unclassified 1410
181 Ga0373934_0083497 3300035086 Bacteria 1284
182 Ga0373934_0317076 3300035086 Unclassified 647
183 Ga0373944_0058037 3300035089 Unclassified 1235
184 Ga0373923_0126178 3300035111 Unclassified 1147
185 Ga0373936_0014158 3300035113 Unclassified 3047
186 Ga0373945_0003349 3300035116 Bacteria 5036
187 Ga0373945_0003464 3300035116 Bacteria 4965
188 Ga0373945_0014544 3300035116 Bacteria 2639
189 Ga0373953_0043566 3300035117 Unclassified 1792
190 Ga0373954_0013357 3300035118 Bacteria 3659
191 Ga0373956_0012621 3300035119 Bacteria 3505
192 Ga0373956_0043386 3300035119 Bacteria 2002
193 Ga0373957_0007308 3300035120 Bacteria 3531
194 Ga0373957_0180488 3300035120 Unclassified 875
195 Ga0373943_0000047 3300035170 Bacteria 41181
196 Ga0373943_0036666 3300035170 Bacteria 2349
197 Ga0373946_0037452 3300035171 Bacteria 1971
198 Ga0373955_0012079 3300035172 Bacteria 4142
199 Ga0373955_0030585 3300035172 Unclassified 2812
200 Ga0373955_0819676 3300035172 Unclassified 572
201 Ga0373924_0036100 3300035410 Unclassified 2007
202 Ga0373924_0207406 3300035410 Unclassified 865
203 Ga0373935_0000841 3300035692 Bacteria 16552
204 Ga0373935_0001333 3300035692 Bacteria 13657
205 Ga0373935_0009893 3300035692 Bacteria 5714
206 Ga0373935_0104955 3300035692 Unclassified 1868
207 Ga0373935_0192490 3300035692 Bacteria 1406
208 Ga0373935_0366156 3300035692 Bacteria 1030
209 Ga0373935_0590904 3300035692 Bacteria 811
210 Ga0373935_1222307 3300035692 Bacteria 560
211 Ga0373927_0068560 3300035695 Bacteria 2295
212 Ga0373927_0082982 3300035695 Bacteria 2078
213 Ga0373927_0089947 3300035695 Bacteria 1993
214 Ga0373927_0215538 3300035695 Bacteria 1261
215 Ga0373927_0864694 3300035695 Bacteria 597
216 Ga0373933_0010271 3300035724 Bacteria 5129
217 Ga0373933_0072959 3300035724 Bacteria 2091
218 Ga0373933_0538309 3300035724 Bacteria 766
219 Ga0373933_0553348 3300035724 Unclassified 755
220 Ga0373947_0000112 3300035725 Bacteria 40758
221 Ga0373947_0026776 3300035725 Unclassified 3372
222 Ga0373947_0326733 3300035725 Bacteria 1026
223 Ga0373937_0147343 3300036401 Unclassified 2204
224 Ga0373937_0156270 3300036401 Bacteria 2138
225 Ga0373937_0345785 3300036401 Unclassified 1408
226 Ga0373937_0492517 3300036401 Bacteria 1164
227 Ga0373925_0000770 3300037068 Bacteria 29427
228 Ga0373925_0008172 3300037068 Bacteria 7620
229 Ga0373925_0010839 3300037068 Bacteria 6610
230 Ga0373925_0027423 3300037068 Unclassified 4169
231 Ga0373925_0042863 3300037068 Bacteria 3357
232 Ga0373925_0049570 3300037068 Bacteria 3130
233 Ga0395905_0446328 3300037471 Viruses 1191
234 Ga0436360_0709063 3300039438 Bacteria 560
235 Ga0451839_0576847 3300041496 Unclassified 551
236 Ga0466961_0087396 3300044693 Bacteria 1970
237 Ga0466963_0100783 3300044694 Bacteria 1977
238 Ga0466957_0207402 3300044842 Bacteria 1289
239 Ga0466957_0515440 3300044842 Bacteria 830
240 Ga0466959_0187748 3300045049 Bacteria 1443
241 Ga0466958_0057069 3300045836 Bacteria 2373
242 Ga0466958_0254892 3300045836 Unclassified 1123
243 Ga0466967_0338778 3300045976 Unclassified 1454
244 Ga0466967_0937855 3300045976 Bacteria 861
245 Ga0466967_1102739 3300045976 Bacteria 791
246 Ga0495592_0203435 3300046454 Unclassified 1335
247 Ga0495629_0018762 3300046459 Bacteria 4945
248 Ga0495653_0461970 3300046463 Unclassified 797
249 Ga0495653_0710292 3300046463 Bacteria 610
250 Ga0495580_0000603 3300046472 Bacteria 30353
251 Ga0495580_0002140 3300046472 Bacteria 17326
252 Ga0495580_0012747 3300046472 Bacteria 6443
253 Ga0495580_0015311 3300046472 Bacteria 5788
254 Ga0495580_0374273 3300046472 Unclassified 963
255 Ga0495580_0744077 3300046472 Unclassified 639
256 Ga0495580_1008594 3300046472 Unclassified 530
257 Ga0495580_1018630 3300046472 Bacteria 527
258 Ga0495582_0001976 3300046473 Bacteria 11502
259 Ga0495582_0355774 3300046473 Bacteria 843
260 Ga0495639_0098262 3300046475 Bacteria 1380
261 Ga0495639_0593302 3300046475 Unclassified 569
262 Ga0495594_0578444 3300046499 Bacteria 637
263 Ga0495630_0039171 3300046517 Bacteria 3545
264 Ga0495630_0153718 3300046517 Bacteria 1751
265 Ga0495630_0530180 3300046517 Bacteria 903
266 Ga0495652_0509371 3300046529 Bacteria 833
267 Ga0495665_0020860 3300046531 Bacteria 3520
268 Ga0495665_0076150 3300046531 Unclassified 1766
269 Ga0495665_0672869 3300046531 Unclassified 514
270 Ga0495586_0143704 3300046535 Bacteria 1340
271 Ga0495586_0164561 3300046535 Bacteria 1252
272 Ga0495645_0308163 3300046543 Bacteria 1032
273 Ga0495667_0447202 3300046559 Bacteria 812
274 Ga0495634_0710642 3300046642 Bacteria 577
275 Ga0495635_0129158 3300046663 Bacteria 1723
276 Ga0495635_0470853 3300046663 Unclassified 829
277 Ga0495588_0458350 3300046674 Unclassified 669
278 Ga0495599_0196575 3300046678 Unclassified 1240
279 Ga0495623_0001371 3300046679 Bacteria 16530
280 Ga0495623_0114464 3300046679 Bacteria 1631
281 Ga0495647_0054850 3300046681 Unclassified 1559
282 Ga0495658_0007843 3300046683 Bacteria 5287
283 Ga0495658_0022720 3300046683 Bacteria 3321
284 Ga0495669_0116161 3300046684 Bacteria 1252
285 Ga0495670_0525501 3300046691 Unclassified 643
286 Ga0495581_0047366 3300047315 Bacteria 2485
287 Ga0495581_0086399 3300047315 Unclassified 1819
288 Ga0495674_0034545 3300047319 Bacteria 4572
289 Ga0495674_0224244 3300047319 Bacteria 1553
290 Ga0495684_0186707 3300047471 Bacteria 1535
291 Ga0495593_0212968 3300047673 Bacteria 970
292 Ga0495593_0482075 3300047673 Bacteria 621
293 Ga0495602_0099618 3300048088 Bacteria 2389
294 Ga0496103_0367087 3300048906 Bacteria 925
295 Ga0496104_0020276 3300048907 Bacteria 6092
296 Ga0496104_0105390 3300048907 Unclassified 2702
297 Ga0496104_0177537 3300048907 Bacteria 2040
298 Ga0496105_0008491 3300048908 Bacteria 7980
299 Ga0496105_0020434 3300048908 Bacteria 5350
300 Ga0496110_0042861 3300048913 Bacteria 3950
301 Ga0496111_0102159 3300048914 Bacteria 2107
302 Ga0496112_0006571 3300048915 Bacteria 10232
303 Ga0496112_0215374 3300048915 Bacteria 1877
304 Ga0496112_0630396 3300048915 Bacteria 1003
305 Ga0496113_0003019 3300048916 Bacteria 9971
306 Ga0496113_1543603 3300048916 Bacteria 512
307 Ga0496114_0157472 3300048917 Bacteria 1973
308 Ga0496115_0005470 3300048918 Bacteria 9242
309 Ga0501083_0309913 3300049744 Bacteria 1027
310 nmdc:mga0n895_199351_c1 3300050512 Unclassified 2033
311 nmdc:mga0rr50_867406_c1 3300050513 Unclassified 770
312 nmdc:mga08x19_919792_c1 3300050514 Unclassified 621
313 nmdc:mga0a205_743680_c1 3300050515 Unclassified 829
314 Ga0495612_0405017 3300053078 Unclassified 620
315 Ga0495619_0112001 3300053085 Bacteria 1866
316 Ga0466962_0197158 3300061719 Bacteria 983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10131759 Ga0157370_101317591 94
2 3300005434 Ga0070709_10282878 Ga0070709_102828781 95
3 3300005435 Ga0070714_100000075 Ga0070714_10000007560 95
4 3300005435 Ga0070714_100020172 Ga0070714_1000201725 95
5 3300005435 Ga0070714_100774531 Ga0070714_1007745312 95
6 3300005436 Ga0070713_100134429 Ga0070713_1001344292 95
7 3300005439 Ga0070711_100030638 Ga0070711_1000306382 95
8 3300005439 Ga0070711_100038547 Ga0070711_1000385472 95
9 3300005445 Ga0070708_100101496 Ga0070708_1001014964 95
10 3300005471 Ga0070698_101903270 Ga0070698_1019032701 95
11 3300006028 Ga0070717_10011648 Ga0070717_100116482 95
12 3300006028 Ga0070717_10236080 Ga0070717_102360801 95
13 3300006028 Ga0070717_10316062 Ga0070717_103160622 95
14 3300006028 Ga0070717_12128404 Ga0070717_121284041 95
15 3300006173 Ga0070716_100003540 Ga0070716_1000035408 95
16 3300006173 Ga0070716_100060259 Ga0070716_1000602593 95
17 3300006175 Ga0070712_100002390 Ga0070712_1000023907 95
18 3300006914 Ga0075436_100604275 Ga0075436_1006042752 95
19 3300007076 Ga0075435_100719169 Ga0075435_1007191692 95
20 3300013297 Ga0157378_12068958 Ga0157378_120689581 95
21 3300014969 Ga0157376_10178865 Ga0157376_101788652 95
22 3300022732 Ga0224569_107404 Ga0224569_1074042 95
23 3300024227 Ga0228598_1002843 Ga0228598_10028433 95
24 3300025898 Ga0207692_10002000 Ga0207692_100020003 95
25 3300025906 Ga0207699_10041384 Ga0207699_100413842 95
26 3300025910 Ga0207684_11317558 Ga0207684_113175581 95
27 3300025915 Ga0207693_10008118 Ga0207693_100081187 95
28 3300025916 Ga0207663_10207112 Ga0207663_102071123 95
29 3300025916 Ga0207663_10598892 Ga0207663_105988922 95
30 3300025916 Ga0207663_10666157 Ga0207663_106661571 95
31 3300025922 Ga0207646_10741999 Ga0207646_107419992 95
32 3300025928 Ga0207700_10149384 Ga0207700_101493842 95
33 3300025929 Ga0207664_10000096 Ga0207664_1000009646 95
34 3300025929 Ga0207664_10116333 Ga0207664_101163332 95
35 3300025929 Ga0207664_10885386 Ga0207664_108853862 95
36 3300025929 Ga0207664_11618233 Ga0207664_116182332 95
37 3300025939 Ga0207665_10000358 Ga0207665_100003588 95
38 3300028666 Ga0265336_10048924 Ga0265336_100489241 95
39 3300028800 Ga0265338_10003551 Ga0265338_100035512 95
40 3300028800 Ga0265338_10004711 Ga0265338_1000471117 95
41 3300028800 Ga0265338_10027722 Ga0265338_100277224 95
42 3300028800 Ga0265338_10047557 Ga0265338_100475573 95
43 3300028800 Ga0265338_10069802 Ga0265338_100698023 95
44 3300028800 Ga0265338_10256899 Ga0265338_102568992 95
45 3300030760 Ga0265762_1091236 Ga0265762_10912361 95
46 3300031241 Ga0265325_10129594 Ga0265325_101295941 95
47 3300031249 Ga0265339_10074494 Ga0265339_100744943 95
48 3300031249 Ga0265339_10204121 Ga0265339_102041212 95
49 3300031250 Ga0265331_10541623 Ga0265331_105416231 95
50 3300031344 Ga0265316_10016458 Ga0265316_100164584 95
51 3300031344 Ga0265316_10041841 Ga0265316_100418413 95
52 3300031344 Ga0265316_10285616 Ga0265316_102856163 95
53 3300031711 Ga0265314_10038372 Ga0265314_100383722 95
54 3300031711 Ga0265314_10043404 Ga0265314_100434041 95
55 3300035083 Ga0373926_0057730 Ga0373926_0057730_660_947 95
56 3300035086 Ga0373934_0317076 Ga0373934_0317076_344_631 95
57 3300035089 Ga0373944_0058037 Ga0373944_0058037_197_484 95
58 3300035113 Ga0373936_0014158 Ga0373936_0014158_1823_2110 95
59 3300035116 Ga0373945_0003464 Ga0373945_0003464_4301_4588 95
60 3300035117 Ga0373953_0043566 Ga0373953_0043566_318_605 95
61 3300035118 Ga0373954_0013357 Ga0373954_0013357_260_547 95
62 3300035120 Ga0373957_0007308 Ga0373957_0007308_1060_1347 95
63 3300035170 Ga0373943_0000047 Ga0373943_0000047_8801_9088 95
64 3300035171 Ga0373946_0037452 Ga0373946_0037452_384_671 95
65 3300035172 Ga0373955_0030585 Ga0373955_0030585_2332_2619 95
66 3300035692 Ga0373935_0000841 Ga0373935_0000841_2224_2511 95
67 3300035695 Ga0373927_0068560 Ga0373927_0068560_1866_2153 95
68 3300035724 Ga0373933_0010271 Ga0373933_0010271_2694_2981 95
69 3300035725 Ga0373947_0000112 Ga0373947_0000112_35208_35495 95
70 3300036401 Ga0373937_0156270 Ga0373937_0156270_230_517 95
71 3300036401 Ga0373937_0492517 Ga0373937_0492517_345_632 95
72 3300037068 Ga0373925_0000770 Ga0373925_0000770_2156_2443 95
73 3300044693 Ga0466961_0087396 Ga0466961_0087396_621_908 95
74 3300044694 Ga0466963_0100783 Ga0466963_0100783_979_1266 95
75 3300044842 Ga0466957_0207402 Ga0466957_0207402_535_822 95
76 3300044842 Ga0466957_0515440 Ga0466957_0515440_240_527 95
77 3300045049 Ga0466959_0187748 Ga0466959_0187748_536_823 95
78 3300045836 Ga0466958_0057069 Ga0466958_0057069_238_525 95
79 3300045976 Ga0466967_0937855 Ga0466967_0937855_459_746 95
80 3300046454 Ga0495592_0203435 Ga0495592_0203435_629_916 95
81 3300046463 Ga0495653_0461970 Ga0495653_0461970_491_778 95
82 3300046472 Ga0495580_0000603 Ga0495580_0000603_29772_30059 95
83 3300046472 Ga0495580_0015311 Ga0495580_0015311_534_821 95
84 3300046472 Ga0495580_1008594 Ga0495580_1008594_13_300 95
85 3300046517 Ga0495630_0153718 Ga0495630_0153718_474_761 95
86 3300046531 Ga0495665_0672869 Ga0495665_0672869_198_485 95
87 3300046543 Ga0495645_0308163 Ga0495645_0308163_209_496 95
88 3300046663 Ga0495635_0470853 Ga0495635_0470853_481_768 95
89 3300046678 Ga0495599_0196575 Ga0495599_0196575_457_744 95
90 3300046679 Ga0495623_0114464 Ga0495623_0114464_898_1185 95
91 3300047315 Ga0495581_0086399 Ga0495581_0086399_786_1073 95
92 3300047319 Ga0495674_0034545 Ga0495674_0034545_2476_2763 95
93 3300047319 Ga0495674_0224244 Ga0495674_0224244_329_616 95
94 3300048088 Ga0495602_0099618 Ga0495602_0099618_1453_1740 95
95 3300049744 Ga0501083_0309913 Ga0501083_0309913_141_428 95
96 3300053078 Ga0495612_0405017 Ga0495612_0405017_155_442 95
97 3300053085 Ga0495619_0112001 Ga0495619_0112001_1219_1506 95
98 3300061719 Ga0466962_0197158 Ga0466962_0197158_589_876 95
99 3300039438 Ga0436360_0709063 Ga0436360_0709063_15_305 96
100 3300045976 Ga0466967_1102739 Ga0466967_1102739_421_711 96
101 3300046472 Ga0495580_0012747 Ga0495580_0012747_784_1074 96
102 3300005434 Ga0070709_10418277 Ga0070709_104182772 97
103 3300046472 Ga0495580_0744077 Ga0495580_0744077_54_347 97
104 3300026078 Ga0207702_10077565 Ga0207702_100775652 98
105 3300026121 Ga0207683_10317237 Ga0207683_103172372 98
106 3300035692 Ga0373935_0192490 Ga0373935_0192490_657_953 98
107 3300035695 Ga0373927_0864694 Ga0373927_0864694_40_336 98
108 3300036401 Ga0373937_0345785 Ga0373937_0345785_728_1024 98
109 3300045976 Ga0466967_0338778 Ga0466967_0338778_208_504 98
110 3300046473 Ga0495582_0355774 Ga0495582_0355774_205_501 98
111 3300046475 Ga0495639_0593302 Ga0495639_0593302_63_359 98
112 3300046499 Ga0495594_0578444 Ga0495594_0578444_126_422 98
113 3300046531 Ga0495665_0076150 Ga0495665_0076150_819_1115 98
114 3300046535 Ga0495586_0164561 Ga0495586_0164561_36_332 98
115 3300047315 Ga0495581_0047366 Ga0495581_0047366_507_803 98
116 3300047471 Ga0495684_0186707 Ga0495684_0186707_1054_1350 98
117 3300048915 Ga0496112_0630396 Ga0496112_0630396_237_533 98
118 3300048916 Ga0496113_1543603 Ga0496113_1543603_122_418 98
119 3300005329 Ga0070683_101217744 Ga0070683_1012177442 99
120 3300005336 Ga0070680_100345537 Ga0070680_1003455372 99
121 3300005337 Ga0070682_100140957 Ga0070682_1001409572 99
122 3300005345 Ga0070692_10073119 Ga0070692_100731192 99
123 3300005434 Ga0070709_10370414 Ga0070709_103704142 99
124 3300005435 Ga0070714_100032486 Ga0070714_1000324865 99
125 3300005435 Ga0070714_100947804 Ga0070714_1009478042 99
126 3300005435 Ga0070714_101401075 Ga0070714_1014010751 99
127 3300005436 Ga0070713_100000134 Ga0070713_10000013430 99
128 3300005436 Ga0070713_100502385 Ga0070713_1005023852 99
129 3300005437 Ga0070710_10116543 Ga0070710_101165433 99
130 3300005439 Ga0070711_100000271 Ga0070711_10000027120 99
131 3300005439 Ga0070711_100726746 Ga0070711_1007267462 99
132 3300005458 Ga0070681_10129032 Ga0070681_101290324 99
133 3300005458 Ga0070681_10221003 Ga0070681_102210031 99
134 3300005530 Ga0070679_100806998 Ga0070679_1008069982 99
135 3300005539 Ga0068853_100024017 Ga0068853_1000240175 99
136 3300005539 Ga0068853_101597396 Ga0068853_1015973962 99
137 3300005547 Ga0070693_101559989 Ga0070693_1015599891 99
138 3300005564 Ga0070664_100932721 Ga0070664_1009327211 99
139 3300005614 Ga0068856_102356889 Ga0068856_1023568891 99
140 3300006028 Ga0070717_10018940 Ga0070717_100189403 99
141 3300006028 Ga0070717_10374871 Ga0070717_103748712 99
142 3300006028 Ga0070717_10964286 Ga0070717_109642862 99
143 3300006163 Ga0070715_10003006 Ga0070715_100030067 99
144 3300006163 Ga0070715_11097665 Ga0070715_110976652 99
145 3300006173 Ga0070716_100017381 Ga0070716_1000173815 99
146 3300006173 Ga0070716_101346165 Ga0070716_1013461651 99
147 3300006175 Ga0070712_100000262 Ga0070712_10000026221 99
148 3300006175 Ga0070712_100322822 Ga0070712_1003228222 99
149 3300009093 Ga0105240_10157882 Ga0105240_101578824 99
150 3300009098 Ga0105245_10002858 Ga0105245_100028585 99
151 3300009176 Ga0105242_10210220 Ga0105242_102102202 99
152 3300009545 Ga0105237_10236827 Ga0105237_102368272 99
153 3300009551 Ga0105238_11835860 Ga0105238_118358602 99
154 3300010375 Ga0105239_10504148 Ga0105239_105041482 99
155 3300010375 Ga0105239_10615858 Ga0105239_106158582 99
156 3300013105 Ga0157369_12693769 Ga0157369_126937692 99
157 3300013296 Ga0157374_10308941 Ga0157374_103089412 99
158 3300013297 Ga0157378_10596466 Ga0157378_105964662 99
159 3300014969 Ga0157376_11424695 Ga0157376_114246952 99
160 3300025898 Ga0207692_10605815 Ga0207692_106058152 99
161 3300025905 Ga0207685_10003971 Ga0207685_100039711 99
162 3300025905 Ga0207685_10801074 Ga0207685_108010741 99
163 3300025906 Ga0207699_10387185 Ga0207699_103871852 99
164 3300025906 Ga0207699_10519368 Ga0207699_105193682 99
165 3300025906 Ga0207699_11174733 Ga0207699_111747332 99
166 3300025912 Ga0207707_11537217 Ga0207707_115372172 99
167 3300025915 Ga0207693_10000275 Ga0207693_1000027523 99
168 3300025915 Ga0207693_10092417 Ga0207693_100924173 99
169 3300025916 Ga0207663_10004323 Ga0207663_100043235 99
170 3300025927 Ga0207687_10003150 Ga0207687_100031504 99
171 3300025928 Ga0207700_10000111 Ga0207700_1000011138 99
172 3300025928 Ga0207700_10006979 Ga0207700_100069797 99
173 3300025928 Ga0207700_10201224 Ga0207700_102012242 99
174 3300025929 Ga0207664_10043578 Ga0207664_100435782 99
175 3300025939 Ga0207665_10031372 Ga0207665_100313722 99
176 3300025939 Ga0207665_10559963 Ga0207665_105599632 99
177 3300025939 Ga0207665_10711543 Ga0207665_107115432 99
178 3300025944 Ga0207661_11004414 Ga0207661_110044142 99
179 3300025944 Ga0207661_11770303 Ga0207661_117703031 99
180 3300025945 Ga0207679_10704520 Ga0207679_107045202 99
181 3300026023 Ga0207677_10111955 Ga0207677_101119552 99
182 3300026078 Ga0207702_10275050 Ga0207702_102750503 99
183 3300034957 Ga0373938_0087895 Ga0373938_0087895_364_663 99
184 3300035111 Ga0373923_0126178 Ga0373923_0126178_649_948 99
185 3300035116 Ga0373945_0003349 Ga0373945_0003349_677_982 99
186 3300035116 Ga0373945_0014544 Ga0373945_0014544_901_1200 99
187 3300035119 Ga0373956_0012621 Ga0373956_0012621_916_1215 99
188 3300035120 Ga0373957_0180488 Ga0373957_0180488_27_326 99
189 3300035170 Ga0373943_0036666 Ga0373943_0036666_485_784 99
190 3300035172 Ga0373955_0819676 Ga0373955_0819676_26_325 99
191 3300035410 Ga0373924_0036100 Ga0373924_0036100_849_1148 99
192 3300035410 Ga0373924_0207406 Ga0373924_0207406_155_454 99
193 3300035692 Ga0373935_0001333 Ga0373935_0001333_7634_7933 99
194 3300035692 Ga0373935_0009893 Ga0373935_0009893_5211_5510 99
195 3300035692 Ga0373935_0104955 Ga0373935_0104955_1438_1737 99
196 3300035692 Ga0373935_0366156 Ga0373935_0366156_58_357 99
197 3300035692 Ga0373935_1222307 Ga0373935_1222307_83_388 99
198 3300035695 Ga0373927_0089947 Ga0373927_0089947_89_388 99
199 3300035695 Ga0373927_0215538 Ga0373927_0215538_681_986 99
200 3300035724 Ga0373933_0538309 Ga0373933_0538309_185_484 99
201 3300035724 Ga0373933_0553348 Ga0373933_0553348_298_597 99
202 3300035725 Ga0373947_0026776 Ga0373947_0026776_2548_2847 99
203 3300036401 Ga0373937_0147343 Ga0373937_0147343_39_338 99
204 3300037068 Ga0373925_0010839 Ga0373925_0010839_5967_6272 99
205 3300037068 Ga0373925_0027423 Ga0373925_0027423_36_335 99
206 3300037068 Ga0373925_0042863 Ga0373925_0042863_1615_1914 99
207 3300037068 Ga0373925_0049570 Ga0373925_0049570_2245_2544 99
208 3300041496 Ga0451839_0576847 Ga0451839_0576847_182_481 99
209 3300045836 Ga0466958_0254892 Ga0466958_0254892_776_1075 99
210 3300046459 Ga0495629_0018762 Ga0495629_0018762_4021_4320 99
211 3300046463 Ga0495653_0710292 Ga0495653_0710292_90_389 99
212 3300046472 Ga0495580_0002140 Ga0495580_0002140_14402_14701 99
213 3300046472 Ga0495580_0374273 Ga0495580_0374273_404_703 99
214 3300046472 Ga0495580_1018630 Ga0495580_1018630_121_426 99
215 3300046473 Ga0495582_0001976 Ga0495582_0001976_10951_11250 99
216 3300046475 Ga0495639_0098262 Ga0495639_0098262_644_943 99
217 3300046517 Ga0495630_0039171 Ga0495630_0039171_2948_3253 99
218 3300046517 Ga0495630_0530180 Ga0495630_0530180_169_468 99
219 3300046529 Ga0495652_0509371 Ga0495652_0509371_361_660 99
220 3300046531 Ga0495665_0020860 Ga0495665_0020860_1923_2222 99
221 3300046535 Ga0495586_0143704 Ga0495586_0143704_239_538 99
222 3300046559 Ga0495667_0447202 Ga0495667_0447202_276_575 99
223 3300046642 Ga0495634_0710642 Ga0495634_0710642_25_330 99
224 3300046663 Ga0495635_0129158 Ga0495635_0129158_355_654 99
225 3300046674 Ga0495588_0458350 Ga0495588_0458350_104_403 99
226 3300046679 Ga0495623_0001371 Ga0495623_0001371_14767_15066 99
227 3300046681 Ga0495647_0054850 Ga0495647_0054850_657_956 99
228 3300046683 Ga0495658_0007843 Ga0495658_0007843_949_1248 99
229 3300046684 Ga0495669_0116161 Ga0495669_0116161_570_869 99
230 3300047673 Ga0495593_0212968 Ga0495593_0212968_415_720 99
231 3300047673 Ga0495593_0482075 Ga0495593_0482075_62_361 99
232 3300048907 Ga0496104_0020276 Ga0496104_0020276_4138_4437 99
233 3300048907 Ga0496104_0105390 Ga0496104_0105390_1899_2198 99
234 3300048907 Ga0496104_0177537 Ga0496104_0177537_24_323 99
235 3300048908 Ga0496105_0008491 Ga0496105_0008491_20_319 99
236 3300048908 Ga0496105_0020434 Ga0496105_0020434_707_1006 99
237 3300048913 Ga0496110_0042861 Ga0496110_0042861_1952_2251 99
238 3300048914 Ga0496111_0102159 Ga0496111_0102159_931_1230 99
239 3300048915 Ga0496112_0215374 Ga0496112_0215374_1403_1702 99
240 3300048916 Ga0496113_0003019 Ga0496113_0003019_8168_8467 99
241 3300048917 Ga0496114_0157472 Ga0496114_0157472_1122_1421 99
242 3300048918 Ga0496115_0005470 Ga0496115_0005470_766_1065 99
243 3300050514 nmdc:mga08x19_919792_c1 nmdc:mga08x19_919792_c1_19_318 99
244 3300002239 JGI24034J26672_10074561 JGI24034J26672_100745612 100
245 3300005334 Ga0068869_100000935 Ga0068869_10000093515 100
246 3300005338 Ga0068868_100625937 Ga0068868_1006259372 100
247 3300005354 Ga0070675_100552754 Ga0070675_1005527542 100
248 3300005364 Ga0070673_101881982 Ga0070673_1018819822 100
249 3300005366 Ga0070659_100886054 Ga0070659_1008860542 100
250 3300005457 Ga0070662_100660921 Ga0070662_1006609211 100
251 3300005535 Ga0070684_101957605 Ga0070684_1019576052 100
252 3300005548 Ga0070665_100232433 Ga0070665_1002324332 100
253 3300005563 Ga0068855_100064646 Ga0068855_1000646464 100
254 3300005617 Ga0068859_100062826 Ga0068859_1000628263 100
255 3300005842 Ga0068858_100001619 Ga0068858_10000161924 100
256 3300005843 Ga0068860_100005894 Ga0068860_1000058944 100
257 3300005844 Ga0068862_100097898 Ga0068862_1000978982 100
258 3300006173 Ga0070716_101718595 Ga0070716_1017185952 100
259 3300006237 Ga0097621_100111033 Ga0097621_1001110332 100
260 3300006871 Ga0075434_100033911 Ga0075434_1000339117 100
261 3300006871 Ga0075434_101764034 Ga0075434_1017640342 100
262 3300006881 Ga0068865_100314018 Ga0068865_1003140182 100
263 3300006931 Ga0097620_100062828 Ga0097620_1000628282 100
264 3300007076 Ga0075435_100903035 Ga0075435_1009030352 100
265 3300009098 Ga0105245_10317201 Ga0105245_103172012 100
266 3300009176 Ga0105242_10142758 Ga0105242_101427583 100
267 3300009177 Ga0105248_10264320 Ga0105248_102643202 100
268 3300009545 Ga0105237_10136586 Ga0105237_101365862 100
269 3300009553 Ga0105249_10409980 Ga0105249_104099802 100
270 3300010375 Ga0105239_10014364 Ga0105239_100143646 100
271 3300011119 Ga0105246_10503857 Ga0105246_105038572 100
272 3300013296 Ga0157374_10012766 Ga0157374_100127664 100
273 3300013297 Ga0157378_10121664 Ga0157378_101216643 100
274 3300013306 Ga0163162_10004210 Ga0163162_100042104 100
275 3300013307 Ga0157372_11107502 Ga0157372_111075022 100
276 3300013308 Ga0157375_10084316 Ga0157375_100843164 100
277 3300015262 Ga0182007_10028410 Ga0182007_100284102 100
278 3300025321 Ga0207656_10626200 Ga0207656_106262002 100
279 3300025904 Ga0207647_10002874 Ga0207647_100028744 100
280 3300025933 Ga0207706_11707083 Ga0207706_117070832 100
281 3300025938 Ga0207704_10281424 Ga0207704_102814242 100
282 3300025942 Ga0207689_10000542 Ga0207689_1000054230 100
283 3300025949 Ga0207667_10165895 Ga0207667_101658952 100
284 3300025960 Ga0207651_11905944 Ga0207651_119059442 100
285 3300026023 Ga0207677_10108430 Ga0207677_101084302 100
286 3300026035 Ga0207703_10010977 Ga0207703_100109773 100
287 3300026088 Ga0207641_10097653 Ga0207641_100976532 100
288 3300026118 Ga0207675_100081187 Ga0207675_1000811872 100
289 3300026142 Ga0207698_10757315 Ga0207698_107573152 100
290 3300028380 Ga0268265_10042450 Ga0268265_100424502 100
291 3300028381 Ga0268264_10020572 Ga0268264_100205722 100
292 3300028800 Ga0265338_10041379 Ga0265338_100413793 100
293 3300031241 Ga0265325_10006235 Ga0265325_100062353 100
294 3300031247 Ga0265340_10515609 Ga0265340_105156091 100
295 3300031249 Ga0265339_10072264 Ga0265339_100722642 100
296 3300031250 Ga0265331_10345709 Ga0265331_103457092 100
297 3300031548 Ga0307408_100017169 Ga0307408_1000171694 100
298 3300031711 Ga0265314_10412027 Ga0265314_104120271 100
299 3300031995 Ga0307409_100012125 Ga0307409_1000121255 100
300 3300032002 Ga0307416_100089065 Ga0307416_1000890653 100
301 3300035086 Ga0373934_0083497 Ga0373934_0083497_708_1010 100
302 3300035119 Ga0373956_0043386 Ga0373956_0043386_1158_1460 100
303 3300035172 Ga0373955_0012079 Ga0373955_0012079_3188_3490 100
304 3300035692 Ga0373935_0590904 Ga0373935_0590904_38_340 100
305 3300035695 Ga0373927_0082982 Ga0373927_0082982_1357_1659 100
306 3300035724 Ga0373933_0072959 Ga0373933_0072959_1207_1509 100
307 3300035725 Ga0373947_0326733 Ga0373947_0326733_13_315 100
308 3300037068 Ga0373925_0008172 Ga0373925_0008172_4739_5041 100
309 3300037471 Ga0395905_0446328 Ga0395905_0446328_284_586 100
310 3300046683 Ga0495658_0022720 Ga0495658_0022720_1466_1768 100
311 3300046691 Ga0495670_0525501 Ga0495670_0525501_83_385 100
312 3300048906 Ga0496103_0367087 Ga0496103_0367087_263_565 100
313 3300048915 Ga0496112_0006571 Ga0496112_0006571_5799_6101 100
314 3300050512 nmdc:mga0n895_199351_c1 nmdc:mga0n895_199351_c1_394_696 100
315 3300050513 nmdc:mga0rr50_867406_c1 nmdc:mga0rr50_867406_c1_334_636 100
316 3300050515 nmdc:mga0a205_743680_c1 nmdc:mga0a205_743680_c1_191_493 100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02594

DUF167

Uncharacterised ACR, YggU family COG1872

26

98

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n91-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.7823 4 95
1yh5-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.7302 4 100
1n91-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.7217 4 95
1yh5-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.705 4 100
7mzv-assembly1.cif.gz_A structure of yeast pseudouridine synthase 7 (pus7) 0.691 49 91
ID Description Score Start End Superfamily
af_B7EHD8_35_125_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.9419 8 96 3.30.1200.10
af_A0A1D6GPH0_156_306_3.90.110.10 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9293 48 66 3.90.110.10
af_Q58035_1_98_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.9203 1 96 3.30.1200.10
af_X1WD69_65_162_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.9155 3 97 3.30.1200.10
af_Q8IKR0_45_147_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.9149 4 97 3.30.1200.10
ID Description Score Start End GO Terms
AF-A0A2V9YAC0-F1-model_v4 UPF0235 protein DMG78_18465 0.9832 1 93 GO:0005737
AF-A0A2E4W7H6-F1-model_v4 UPF0235 protein CL489_09745 0.9809 4 96
AF-A0A383CYL2-F1-model_v4 Uncharacterized protein 0.9752 2 81 GO:0005737
AF-A0A847YRR5-F1-model_v4 UPF0235 protein GYA36_15140 0.9747 2 94 GO:0005737
AF-A9FMG3-F1-model_v4 UPF0235 protein sce8156 0.9736 2 97 GO:0005737

Feature Viewer

pLDDT pTM Quality
80.55 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map