F403569

General Info

Members Datasets Scaffolds Average Seq Length
316 218 313 274

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100130194|Ga0070698_1001301943
Length 293
Sequence MDAFLQQIVSGLASGGIYALVALALVMTYLATNAVNFAQGEMAMFSTYLAWSMIQEGLPYWLAFFATLVIAFLGGIAIERAILRPVERAPVLAITIVTIGLFAIFNSLAGWIFTYTIQPFPSPFPSEPIRLSGVVLSPHSLGSLAVTLALPMLLYAFFRYTSLGLAMRAAAQYPEGSRLVGIRVGWMLALGWGLAAILGAVAGILIAPVLFLEPNMMGGILIYAFASATLGGFTSPVGAVIGGFLVGIIENLAGTYIRFIGTDLKLTVALAIIVLVLIFKPSGLFGRAHAQPT

Samples

Sample ID Description Type Environment
1 2643221683 Variovorax sp. Root473 Isolate Unclassified
2 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
3 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
149 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
215 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
216 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
217 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.06
Nodule 0.32
Rhizoplane 0.63
Rhizosphere 93.04
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1003690 3300003792 Bacteria 7266
2 Ga0055531_10001403 3300003794 Bacteria 17819
3 Ga0065707_10012400 3300005295 Bacteria 2114
4 Ga0070683_100172191 3300005329 Bacteria 2055
5 Ga0070690_100005969 3300005330 Bacteria 6877
6 Ga0070690_100012906 3300005330 Bacteria 4926
7 Ga0070690_100022845 3300005330 Bacteria 3830
8 Ga0070670_100043900 3300005331 Bacteria 3843
9 Ga0070677_10002411 3300005333 Bacteria 5965
10 Ga0068869_100004332 3300005334 Bacteria 8810
11 Ga0068869_100009111 3300005334 Bacteria 6430
12 Ga0070666_10004949 3300005335 Bacteria 8151
13 Ga0070680_100144406 3300005336 Bacteria 1996
14 Ga0068868_100032084 3300005338 Bacteria 4038
15 Ga0068868_100050742 3300005338 Bacteria 3259
16 Ga0068868_100275721 3300005338 Bacteria 1422
17 Ga0070689_100004177 3300005340 Bacteria 9731
18 Ga0070689_100408946 3300005340 Bacteria 1148
19 Ga0070691_10070885 3300005341 Bacteria 1691
20 Ga0070687_100007656 3300005343 Bacteria 4520
21 Ga0070687_100011217 3300005343 Bacteria 3912
22 Ga0070692_10029742 3300005345 Bacteria 2726
23 Ga0070668_100127885 3300005347 Bacteria 2036
24 Ga0070669_100040122 3300005353 Bacteria 3402
25 Ga0070675_100041325 3300005354 Bacteria 3766
26 Ga0070675_100042071 3300005354 Bacteria 3732
27 Ga0070675_100408018 3300005354 Bacteria 1213
28 Ga0070675_100549798 3300005354 Unclassified 1044
29 Ga0070671_100042799 3300005355 Bacteria 3765
30 Ga0070673_100162705 3300005364 Bacteria 1899
31 Ga0070673_100498748 3300005364 Bacteria 1101
32 Ga0070701_10000991 3300005438 Bacteria 10306
33 Ga0070701_10221712 3300005438 Bacteria 1128
34 Ga0070705_100294082 3300005440 Bacteria 1161
35 Ga0070700_100015782 3300005441 Bacteria 4290
36 Ga0070694_100005593 3300005444 Bacteria 7617
37 Ga0070694_100007232 3300005444 Bacteria 6760
38 Ga0070708_100319110 3300005445 Bacteria 1463
39 Ga0070678_100036514 3300005456 Bacteria 3441
40 Ga0070678_100152158 3300005456 Bacteria 1865
41 Ga0070662_100020143 3300005457 Bacteria 4539
42 Ga0068867_100006301 3300005459 Bacteria 8395
43 Ga0068867_100008427 3300005459 Bacteria 7272
44 Ga0068867_100131949 3300005459 Bacteria 1943
45 Ga0070706_100000058 3300005467 Bacteria 133347
46 Ga0070706_100158848 3300005467 Bacteria 2111
47 Ga0070706_100309739 3300005467 Bacteria 1473
48 Ga0070707_100008515 3300005468 Bacteria 9528
49 Ga0070707_100260560 3300005468 Bacteria 1687
50 Ga0070698_100130194 3300005471 Bacteria 2472
51 Ga0070699_100543453 3300005518 Bacteria 1057
52 Ga0070684_100008489 3300005535 Bacteria 8034
53 Ga0070697_100002460 3300005536 Bacteria 14255
54 Ga0070697_100004865 3300005536 Bacteria 10303
55 Ga0068853_100481442 3300005539 Unclassified 1170
56 Ga0070672_100004725 3300005543 Bacteria 8940
57 Ga0070686_100000247 3300005544 Bacteria 36839
58 Ga0070686_100015769 3300005544 Bacteria 4385
59 Ga0070695_100062969 3300005545 Bacteria 2410
60 Ga0070696_100028084 3300005546 Bacteria 3837
61 Ga0070693_100004863 3300005547 Bacteria 6412
62 Ga0070693_100227846 3300005547 Bacteria 1224
63 Ga0070665_100293591 3300005548 Bacteria 1628
64 Ga0070665_100490428 3300005548 Bacteria 1240
65 Ga0070704_100250242 3300005549 Bacteria 1455
66 Ga0068855_100084965 3300005563 Bacteria 3663
67 Ga0068857_100100453 3300005577 Bacteria 2595
68 Ga0068856_100207126 3300005614 Bacteria 1976
69 Ga0068852_100012855 3300005616 Bacteria 6382
70 Ga0068852_100265599 3300005616 Bacteria 1649
71 Ga0068859_100007812 3300005617 Bacteria 10858
72 Ga0068859_100040900 3300005617 Bacteria 4656
73 Ga0068864_100019005 3300005618 Bacteria 5745
74 Ga0068864_100067142 3300005618 Bacteria 3114
75 Ga0068866_10001059 3300005718 Bacteria 12119
76 Ga0068861_100006046 3300005719 Bacteria 8233
77 Ga0068870_10013493 3300005840 Bacteria 3841
78 Ga0068863_100009149 3300005841 Bacteria 9667
79 Ga0068863_100090851 3300005841 Bacteria 2895
80 Ga0068858_100006541 3300005842 Bacteria 11334
81 Ga0068858_100011978 3300005842 Bacteria 8174
82 Ga0068858_100026741 3300005842 Bacteria 5359
83 Ga0068860_100000445 3300005843 Bacteria 52236
84 Ga0068860_100029749 3300005843 Bacteria 5255
85 Ga0068860_100046184 3300005843 Bacteria 4153
86 Ga0068862_100150123 3300005844 Bacteria 2074
87 Ga0081455_10019625 3300005937 Bacteria 6386
88 Ga0075365_10017503 3300006038 Bacteria 4385
89 Ga0070716_100114213 3300006173 Bacteria 1679
90 Ga0097621_100053926 3300006237 Bacteria 3277
91 Ga0097621_100056051 3300006237 Bacteria 3219
92 Ga0075370_10043889 3300006353 Bacteria 2527
93 Ga0075370_10160572 3300006353 Bacteria 1319
94 Ga0068871_100008295 3300006358 Bacteria 7466
95 Ga0068871_100047297 3300006358 Bacteria 3469
96 Ga0068871_100247200 3300006358 Bacteria 1553
97 Ga0075428_100003340 3300006844 Bacteria 17561
98 Ga0075428_100198957 3300006844 Bacteria 2167
99 Ga0075430_100000520 3300006846 Bacteria 28959
100 Ga0075430_100100659 3300006846 Bacteria 2413
101 Ga0075431_100009047 3300006847 Bacteria 9987
102 Ga0075433_10141798 3300006852 Bacteria 2136
103 Ga0075434_100000132 3300006871 Bacteria 44951
104 Ga0075434_100031833 3300006871 Bacteria 5201
105 Ga0075434_100049920 3300006871 Bacteria 4155
106 Ga0075434_100138712 3300006871 Bacteria 2451
107 Ga0075429_100000638 3300006880 Bacteria 27089
108 Ga0075429_100141972 3300006880 Bacteria 2102
109 Ga0068865_100001393 3300006881 Bacteria 14049
110 Ga0068865_100002093 3300006881 Bacteria 11787
111 Ga0075436_100000638 3300006914 Bacteria 23058
112 Ga0097620_100007812 3300006931 Bacteria 10858
113 Ga0097620_100040899 3300006931 Bacteria 4656
114 Ga0075435_100006450 3300007076 Bacteria 8299
115 Ga0075435_100037184 3300007076 Bacteria 3875
116 Ga0075435_100118635 3300007076 Bacteria 2206
117 Ga0099794_10047137 3300007265 Bacteria 2066
118 Ga0099794_10119064 3300007265 Bacteria 1327
119 Ga0111539_10002479 3300009094 Bacteria 24486
120 Ga0111539_10107535 3300009094 Bacteria 3273
121 Ga0105245_10035088 3300009098 Bacteria 4450
122 Ga0105247_10052903 3300009101 Bacteria 2504
123 Ga0114129_10007443 3300009147 Bacteria 15595
124 Ga0114129_10015516 3300009147 Bacteria 10831
125 Ga0105243_10001129 3300009148 Bacteria 24198
126 Ga0105243_10021971 3300009148 Bacteria 4846
127 Ga0105241_10171175 3300009174 Bacteria 1794
128 Ga0105242_10003998 3300009176 Bacteria 11461
129 Ga0105242_10185434 3300009176 Unclassified 1838
130 Ga0105248_10049230 3300009177 Bacteria 4726
131 Ga0105248_10075724 3300009177 Bacteria 3782
132 Ga0105248_10213162 3300009177 Bacteria 2176
133 Ga0105239_10160394 3300010375 Bacteria 2512
134 Ga0105239_10238374 3300010375 Bacteria 2042
135 Ga0157374_10021499 3300013296 Bacteria 5742
136 Ga0157378_10001828 3300013297 Bacteria 19102
137 Ga0157378_10183852 3300013297 Bacteria 1968
138 Ga0163162_10054073 3300013306 Bacteria 4037
139 Ga0163162_10235759 3300013306 Bacteria 1960
140 Ga0157375_10012725 3300013308 Bacteria 7468
141 Ga0157380_10013661 3300014326 Bacteria 5929
142 Ga0157380_10015790 3300014326 Bacteria 5556
143 Ga0157379_10014502 3300014968 Bacteria 6916
144 Ga0157379_10045614 3300014968 Bacteria 3912
145 Ga0157379_10106164 3300014968 Bacteria 2521
146 Ga0157376_10028875 3300014969 Bacteria 4413
147 Ga0157376_10309622 3300014969 Bacteria 1498
148 Ga0163161_10020823 3300017792 Bacteria 4605
149 Ga0209673_1025384 3300025273 Bacteria 1971
150 Ga0209051_1000025 3300025303 Bacteria 415397
151 Ga0209257_1000039 3300025304 Bacteria 591694
152 Ga0207697_10015533 3300025315 Bacteria 3145
153 Ga0207682_10008973 3300025893 Bacteria 3951
154 Ga0207642_10001218 3300025899 Bacteria 7965
155 Ga0207642_10002491 3300025899 Bacteria 5731
156 Ga0207680_10005090 3300025903 Bacteria 6265
157 Ga0207645_10004582 3300025907 Bacteria 10192
158 Ga0207684_10000066 3300025910 Bacteria 193406
159 Ga0207660_10064740 3300025917 Bacteria 2639
160 Ga0207662_10001475 3300025918 Bacteria 11429
161 Ga0207649_10336047 3300025920 Bacteria 1114
162 Ga0207646_10034329 3300025922 Bacteria 4584
163 Ga0207681_10008531 3300025923 Bacteria 6257
164 Ga0207659_10031683 3300025926 Bacteria 3623
165 Ga0207659_10524779 3300025926 Bacteria 1004
166 Ga0207644_10219316 3300025931 Bacteria 1507
167 Ga0207690_10260514 3300025932 Bacteria 1343
168 Ga0207706_10009798 3300025933 Bacteria 8792
169 Ga0207686_10004786 3300025934 Bacteria 7265
170 Ga0207686_10013074 3300025934 Bacteria 4583
171 Ga0207709_10006596 3300025935 Bacteria 6516
172 Ga0207670_10298341 3300025936 Bacteria 1261
173 Ga0207669_10019212 3300025937 Bacteria 3552
174 Ga0207669_10354698 3300025937 Bacteria 1134
175 Ga0207665_10063296 3300025939 Bacteria 2512
176 Ga0207691_10010762 3300025940 Bacteria 8782
177 Ga0207711_10030467 3300025941 Bacteria 4550
178 Ga0207711_10044194 3300025941 Bacteria 3802
179 Ga0207689_10000673 3300025942 Bacteria 32601
180 Ga0207689_10004853 3300025942 Bacteria 12116
181 Ga0207689_10007510 3300025942 Bacteria 9558
182 Ga0207651_10055288 3300025960 Bacteria 2725
183 Ga0207712_10011898 3300025961 Bacteria 5548
184 Ga0207658_10003494 3300025986 Bacteria 11091
185 Ga0207677_10024617 3300026023 Bacteria 3743
186 Ga0207677_10525724 3300026023 Bacteria 1027
187 Ga0207703_10001799 3300026035 Bacteria 19132
188 Ga0207703_10004160 3300026035 Bacteria 11933
189 Ga0207703_10113213 3300026035 Bacteria 2319
190 Ga0207703_10197403 3300026035 Bacteria 1786
191 Ga0207708_10000998 3300026075 Bacteria 21173
192 Ga0207702_10067270 3300026078 Bacteria 3074
193 Ga0207641_10015255 3300026088 Bacteria 6295
194 Ga0207648_10001170 3300026089 Bacteria 29352
195 Ga0207648_10004667 3300026089 Bacteria 14019
196 Ga0207648_10341301 3300026089 Bacteria 1349
197 Ga0207676_10035996 3300026095 Bacteria 3762
198 Ga0207676_10052933 3300026095 Bacteria 3175
199 Ga0207674_10355395 3300026116 Bacteria 1416
200 Ga0207675_100000583 3300026118 Bacteria 35648
201 Ga0207675_100007314 3300026118 Bacteria 10439
202 Ga0207675_100626972 3300026118 Bacteria 1080
203 Ga0207683_10054461 3300026121 Bacteria 3508
204 Ga0207698_10048625 3300026142 Bacteria 3221
205 Ga0209969_1000217 3300027360 Bacteria 7674
206 Ga0209967_1000307 3300027364 Bacteria 6635
207 Ga0209996_1003789 3300027395 Bacteria 1911
208 Ga0210000_1012256 3300027462 Bacteria 1273
209 Ga0209995_1002322 3300027471 Bacteria 3003
210 Ga0209968_1001103 3300027526 Bacteria 4119
211 Ga0209999_1000946 3300027543 Bacteria 4895
212 Ga0209970_1006569 3300027614 Bacteria 1909
213 Ga0209974_10021832 3300027876 Bacteria 2120
214 Ga0207428_10042496 3300027907 Bacteria 3676
215 Ga0268266_10376782 3300028379 Bacteria 1338
216 Ga0268265_10004016 3300028380 Bacteria 10360
217 Ga0268265_10005090 3300028380 Bacteria 9014
218 Ga0268265_10392009 3300028380 Bacteria 1281
219 Ga0268264_10367058 3300028381 Bacteria 1375
220 Ga0268264_10404777 3300028381 Bacteria 1312
221 Ga0307408_100048450 3300031548 Bacteria 3048
222 Ga0307408_100480307 3300031548 Bacteria 1084
223 Ga0307408_100636496 3300031548 Bacteria 952
224 Ga0307508_10011978 3300031616 Bacteria 7935
225 Ga0316575_10004257 3300031665 Bacteria 5024
226 Ga0316575_10012111 3300031665 Bacteria 3202
227 Ga0316579_10005426 3300031691 Bacteria 5146
228 Ga0316578_10005156 3300031728 Bacteria 6297
229 Ga0307405_10003735 3300031731 Bacteria 7071
230 Ga0307413_10026207 3300031824 Bacteria 3209
231 Ga0307410_10013767 3300031852 Bacteria 4733
232 Ga0307406_10005448 3300031901 Bacteria 6964
233 Ga0307407_10002451 3300031903 Bacteria 7268
234 Ga0307412_10009014 3300031911 Bacteria 5717
235 Ga0307409_100022174 3300031995 Bacteria 4371
236 Ga0307416_100001584 3300032002 Bacteria 12484
237 Ga0307414_10031261 3300032004 Bacteria 3490
238 Ga0307411_10002419 3300032005 Bacteria 8242
239 Ga0307415_100011692 3300032126 Bacteria 5038
240 Ga0316583_10031602 3300032133 Bacteria 1884
241 Ga0373926_0032031 3300035083 Bacteria 1855
242 Ga0373936_0032000 3300035113 Bacteria 2079
243 Ga0373954_0000033 3300035118 Bacteria 54385
244 Ga0373956_0092243 3300035119 Bacteria 1398
245 Ga0373961_0007225 3300035241 Bacteria 2684
246 Ga0316574_0006010 3300035398 Bacteria 6522
247 Ga0373931_0037609 3300035691 Bacteria 2528
248 Ga0373935_0016858 3300035692 Bacteria 4423
249 Ga0373933_0006414 3300035724 Bacteria 6403
250 Ga0373937_0000377 3300036401 Bacteria 41470
251 Ga0316582_0007634 3300036647 Bacteria 5768
252 Ga0373925_0332519 3300037068 Bacteria 1231
253 Ga0395899_0006613 3300037312 Bacteria 8984
254 Ga0395898_0138897 3300037466 Bacteria 2326
255 Ga0395898_0195925 3300037466 Bacteria 1930
256 Ga0395905_0031794 3300037471 Bacteria 4966
257 Ga0395905_0542848 3300037471 Bacteria 1063
258 Ga0316581_0010467 3300037588 Bacteria 2572
259 Ga0395901_0523894 3300038443 Bacteria 1204
260 Ga0439460_0002968 3300042461 Bacteria 4089
261 Ga0453684_0725883 3300044712 Bacteria 1077
262 Ga0466971_0174568 3300044719 Bacteria 1009
263 Ga0495621_0139363 3300046539 Bacteria 948
264 Ga0495645_0096540 3300046543 Bacteria 2106
265 Ga0495647_0039613 3300046681 Bacteria 1787
266 Ga0495669_0031138 3300046684 Bacteria 2342
267 Ga0495636_0017975 3300047318 Bacteria 2834
268 Ga0495675_0208087 3300047444 Bacteria 1189
269 Ga0496108_0080647 3300048911 Bacteria 2757
270 Ga0496110_0065203 3300048913 Bacteria 3220
271 Ga0496124_0036960 3300048927 Bacteria 4252
272 Ga0501034_0011426 3300049571 Bacteria 9200
273 Ga0501040_0007117 3300049576 Bacteria 7244
274 Ga0501043_0000149 3300049579 Bacteria 65122
275 Ga0501043_0237067 3300049579 Bacteria 1408
276 Ga0501046_0000092 3300049580 Bacteria 97456
277 Ga0501046_0180611 3300049580 Bacteria 1578
278 Ga0501047_0000028 3300049581 Bacteria 220279
279 Ga0501047_0024991 3300049581 Bacteria 5738
280 Ga0501047_0144475 3300049581 Bacteria 2257
281 Ga0501048_0000097 3300049582 Bacteria 47728
282 Ga0501072_0008364 3300049588 Bacteria 7856
283 Ga0501075_0041504 3300049591 Bacteria 3448
284 Ga0501075_0277442 3300049591 Bacteria 1277
285 Ga0501079_0165691 3300049741 Bacteria 1724
286 Ga0501081_0028611 3300049743 Bacteria 3762
287 Ga0501081_0208727 3300049743 Bacteria 1418
288 Ga0501045_0002894 3300049824 Bacteria 11731
289 Ga0501045_0141218 3300049824 Bacteria 1791
290 Ga0501045_0287787 3300049824 Bacteria 1223
291 nmdc:mga07m45_19535_c1 3300050496 Bacteria 3673
292 nmdc:mga07m45_82549_c1 3300050496 Bacteria 1250
293 nmdc:mga05p37_21838_c1 3300050507 Bacteria 7754
294 nmdc:mga05p37_980_c1 3300050507 Bacteria 32442
295 nmdc:mga09592_947_c1 3300050508 Bacteria 22820
296 nmdc:mga0qj67_705_c1 3300050509 Bacteria 22775
297 nmdc:mga06r32_2106_c1 3300050510 Bacteria 17820
298 nmdc:mga06r32_48707_c1 3300050510 Bacteria 4051
299 nmdc:mga06r32_85802_c1 3300050510 Bacteria 3070
300 nmdc:mga08y16_36775_c1 3300050511 Bacteria 5141
301 nmdc:mga0n895_119372_c1 3300050512 Bacteria 2658
302 nmdc:mga0n895_51200_c1 3300050512 Bacteria 4051
303 nmdc:mga0n895_58125_c1 3300050512 Bacteria 3813
304 nmdc:mga08x19_2618_c1 3300050514 Bacteria 10913
305 nmdc:mga0a205_27029_c1 3300050515 Bacteria 5478
306 Ga0500643_000309 3300053087 Bacteria 40193
307 Ga0500651_0001224 3300053093 Bacteria 12780
308 Ga0500566_0021347 3300053094 Bacteria 3806
309 Ga0500634_0060938 3300053161 Bacteria 2002
310 Ga0500634_0067807 3300053161 Bacteria 1875
311 Ga0500637_0141979 3300053178 Bacteria 1390
312 Ga0590071_016672 3300059421 Bacteria 1724
313 Ga0590075_011546 3300059424 Bacteria 2137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0041504 Ga0501075_0041504_2687_3433 229
2 3300005937 Ga0081455_10019625 Ga0081455_100196252 231
3 3300035118 Ga0373954_0000033 Ga0373954_0000033_28586_29455 231
4 3300035119 Ga0373956_0092243 Ga0373956_0092243_454_1323 231
5 3300035724 Ga0373933_0006414 Ga0373933_0006414_1942_2811 231
6 3300036401 Ga0373937_0000377 Ga0373937_0000377_31947_32816 231
7 3300005354 Ga0070675_100408018 Ga0070675_1004080182 238
8 3300005577 Ga0068857_100100453 Ga0068857_1001004532 238
9 3300010375 Ga0105239_10238374 Ga0105239_102383742 238
10 3300013306 Ga0163162_10235759 Ga0163162_102357592 238
11 3300025926 Ga0207659_10031683 Ga0207659_100316832 238
12 3300026035 Ga0207703_10113213 Ga0207703_101132133 238
13 3300026116 Ga0207674_10355395 Ga0207674_103553951 238
14 3300028380 Ga0268265_10392009 Ga0268265_103920092 238
15 3300028381 Ga0268264_10367058 Ga0268264_103670581 238
16 3300048911 Ga0496108_0080647 Ga0496108_0080647_585_1457 238
17 3300026095 Ga0207676_10035996 Ga0207676_100359963 241
18 3300048913 Ga0496110_0065203 Ga0496110_0065203_1991_2863 246
19 3300049571 Ga0501034_0011426 Ga0501034_0011426_207_1079 248
20 3300049588 Ga0501072_0008364 Ga0501072_0008364_3993_4865 248
21 3300053087 Ga0500643_000309 Ga0500643_000309_25793_26665 249
22 3300053161 Ga0500634_0067807 Ga0500634_0067807_477_1349 249
23 3300037471 Ga0395905_0542848 Ga0395905_0542848_12_806 250
24 3300046539 Ga0495621_0139363 Ga0495621_0139363_138_932 250
25 3300005547 Ga0070693_100004863 Ga0070693_1000048632 251
26 3300007265 Ga0099794_10047137 Ga0099794_100471373 251
27 3300005330 Ga0070690_100022845 Ga0070690_1000228454 252
28 3300005334 Ga0068869_100009111 Ga0068869_1000091112 252
29 3300005336 Ga0070680_100144406 Ga0070680_1001444062 252
30 3300005340 Ga0070689_100004177 Ga0070689_1000041779 252
31 3300005341 Ga0070691_10070885 Ga0070691_100708852 252
32 3300005343 Ga0070687_100007656 Ga0070687_1000076562 252
33 3300005438 Ga0070701_10000991 Ga0070701_100009918 252
34 3300005441 Ga0070700_100015782 Ga0070700_1000157824 252
35 3300005456 Ga0070678_100152158 Ga0070678_1001521582 252
36 3300005459 Ga0068867_100008427 Ga0068867_1000084274 252
37 3300005544 Ga0070686_100000247 Ga0070686_10000024728 252
38 3300005545 Ga0070695_100062969 Ga0070695_1000629692 252
39 3300005718 Ga0068866_10001059 Ga0068866_100010597 252
40 3300005840 Ga0068870_10013493 Ga0068870_100134932 252
41 3300005842 Ga0068858_100011978 Ga0068858_1000119781 252
42 3300005843 Ga0068860_100046184 Ga0068860_1000461844 252
43 3300006358 Ga0068871_100008295 Ga0068871_1000082952 252
44 3300006881 Ga0068865_100001393 Ga0068865_1000013939 252
45 3300009148 Ga0105243_10001129 Ga0105243_100011297 252
46 3300009176 Ga0105242_10003998 Ga0105242_100039985 252
47 3300013297 Ga0157378_10001828 Ga0157378_1000182812 252
48 3300014326 Ga0157380_10013661 Ga0157380_100136613 252
49 3300014968 Ga0157379_10014502 Ga0157379_100145022 252
50 3300025899 Ga0207642_10001218 Ga0207642_100012185 252
51 3300025934 Ga0207686_10004786 Ga0207686_100047863 252
52 3300025935 Ga0207709_10006596 Ga0207709_100065967 252
53 3300025942 Ga0207689_10000673 Ga0207689_100006737 252
54 3300026035 Ga0207703_10004160 Ga0207703_100041607 252
55 3300026075 Ga0207708_10000998 Ga0207708_1000099812 252
56 3300026089 Ga0207648_10001170 Ga0207648_1000117019 252
57 3300026118 Ga0207675_100000583 Ga0207675_10000058321 252
58 3300028380 Ga0268265_10005090 Ga0268265_100050903 252
59 3300028381 Ga0268264_10404777 Ga0268264_104047771 252
60 3300006871 Ga0075434_100049920 Ga0075434_1000499202 253
61 3300007076 Ga0075435_100037184 Ga0075435_1000371844 253
62 3300009147 Ga0114129_10015516 Ga0114129_100155165 253
63 3300047318 Ga0495636_0017975 Ga0495636_0017975_1765_2637 253
64 3300050507 nmdc:mga05p37_21838_c1 nmdc:mga05p37_21838_c1_3044_3913 253
65 3300050512 nmdc:mga0n895_58125_c1 nmdc:mga0n895_58125_c1_253_1125 253
66 3300053093 Ga0500651_0001224 Ga0500651_0001224_5586_6458 253
67 3300053161 Ga0500634_0060938 Ga0500634_0060938_97_969 253
68 3300035083 Ga0373926_0032031 Ga0373926_0032031_588_1460 254
69 3300048927 Ga0496124_0036960 Ga0496124_0036960_2133_3005 254
70 3300006353 Ga0075370_10043889 Ga0075370_100438893 255
71 3300050496 nmdc:mga07m45_19535_c1 nmdc:mga07m45_19535_c1_2783_3652 255
72 3300005331 Ga0070670_100043900 Ga0070670_1000439004 257
73 3300005338 Ga0068868_100032084 Ga0068868_1000320843 257
74 3300005354 Ga0070675_100549798 Ga0070675_1005497981 257
75 3300005364 Ga0070673_100162705 Ga0070673_1001627052 257
76 3300005438 Ga0070701_10221712 Ga0070701_102217121 257
77 3300005459 Ga0068867_100131949 Ga0068867_1001319492 257
78 3300005539 Ga0068853_100481442 Ga0068853_1004814422 257
79 3300005548 Ga0070665_100293591 Ga0070665_1002935912 257
80 3300005549 Ga0070704_100250242 Ga0070704_1002502421 257
81 3300005617 Ga0068859_100040900 Ga0068859_1000409005 257
82 3300005618 Ga0068864_100019005 Ga0068864_1000190055 257
83 3300005841 Ga0068863_100090851 Ga0068863_1000908512 257
84 3300005842 Ga0068858_100026741 Ga0068858_1000267415 257
85 3300005843 Ga0068860_100029749 Ga0068860_1000297492 257
86 3300005844 Ga0068862_100150123 Ga0068862_1001501232 257
87 3300006237 Ga0097621_100053926 Ga0097621_1000539262 257
88 3300006358 Ga0068871_100047297 Ga0068871_1000472974 257
89 3300006931 Ga0097620_100040899 Ga0097620_1000408995 257
90 3300009098 Ga0105245_10035088 Ga0105245_100350883 257
91 3300009101 Ga0105247_10052903 Ga0105247_100529032 257
92 3300009174 Ga0105241_10171175 Ga0105241_101711752 257
93 3300009176 Ga0105242_10185434 Ga0105242_101854343 257
94 3300009177 Ga0105248_10049230 Ga0105248_100492303 257
95 3300010375 Ga0105239_10160394 Ga0105239_101603942 257
96 3300013297 Ga0157378_10183852 Ga0157378_101838522 257
97 3300014968 Ga0157379_10106164 Ga0157379_101061642 257
98 3300025941 Ga0207711_10030467 Ga0207711_100304674 257
99 3300025942 Ga0207689_10007510 Ga0207689_100075105 257
100 3300026035 Ga0207703_10197403 Ga0207703_101974032 257
101 3300026118 Ga0207675_100626972 Ga0207675_1006269721 257
102 3300006871 Ga0075434_100138712 Ga0075434_1001387123 258
103 3300035691 Ga0373931_0037609 Ga0373931_0037609_884_1756 258
104 3300050512 nmdc:mga0n895_51200_c1 nmdc:mga0n895_51200_c1_2071_2943 258
105 3300006173 Ga0070716_100114213 Ga0070716_1001142132 259
106 3300006852 Ga0075433_10141798 Ga0075433_101417982 259
107 3300006871 Ga0075434_100031833 Ga0075434_1000318334 259
108 3300007076 Ga0075435_100118635 Ga0075435_1001186352 259
109 3300025939 Ga0207665_10063296 Ga0207665_100632962 259
110 3300050515 nmdc:mga0a205_27029_c1 nmdc:mga0a205_27029_c1_936_1808 259
111 3300005445 Ga0070708_100319110 Ga0070708_1003191101 261
112 3300005467 Ga0070706_100158848 Ga0070706_1001588483 261
113 3300047444 Ga0495675_0208087 Ga0495675_0208087_264_1112 261
114 3300005563 Ga0068855_100084965 Ga0068855_1000849654 263
115 3300014969 Ga0157376_10028875 Ga0157376_100288754 263
116 3300005547 Ga0070693_100227846 Ga0070693_1002278462 264
117 3300031691 Ga0316579_10005426 Ga0316579_100054263 264
118 3300031728 Ga0316578_10005156 Ga0316578_100051566 264
119 3300032133 Ga0316583_10031602 Ga0316583_100316022 264
120 3300036647 Ga0316582_0007634 Ga0316582_0007634_4047_4925 264
121 3300037588 Ga0316581_0010467 Ga0316581_0010467_911_1789 264
122 3300027395 Ga0209996_1003789 Ga0209996_10037892 265
123 3300031665 Ga0316575_10004257 Ga0316575_100042572 266
124 3300059421 Ga0590071_016672 Ga0590071_016672_234_1106 266
125 3300059424 Ga0590075_011546 Ga0590075_011546_643_1515 266
126 3300005338 Ga0068868_100050742 Ga0068868_1000507421 267
127 3300005355 Ga0070671_100042799 Ga0070671_1000427994 267
128 3300005616 Ga0068852_100265599 Ga0068852_1002655992 267
129 3300006844 Ga0075428_100003340 Ga0075428_10000334010 267
130 3300009094 Ga0111539_10002479 Ga0111539_1000247925 267
131 3300009177 Ga0105248_10213162 Ga0105248_102131622 267
132 3300025931 Ga0207644_10219316 Ga0207644_102193162 267
133 3300026023 Ga0207677_10525724 Ga0207677_105257242 267
134 3300027907 Ga0207428_10042496 Ga0207428_100424962 267
135 3300038443 Ga0395901_0523894 Ga0395901_0523894_175_1056 267
136 3300050511 nmdc:mga08y16_36775_c1 nmdc:mga08y16_36775_c1_3200_4081 267
137 3300046684 Ga0495669_0031138 Ga0495669_0031138_1325_2206 268
138 3300037068 Ga0373925_0332519 Ga0373925_0332519_126_998 269
139 3300044719 Ga0466971_0174568 Ga0466971_0174568_85_957 269
140 3300035113 Ga0373936_0032000 Ga0373936_0032000_1038_1910 270
141 3300037312 Ga0395899_0006613 Ga0395899_0006613_1589_2461 270
142 3300037466 Ga0395898_0138897 Ga0395898_0138897_1051_1923 270
143 3300049579 Ga0501043_0237067 Ga0501043_0237067_471_1346 270
144 3300049743 Ga0501081_0208727 Ga0501081_0208727_419_1288 270
145 3300049824 Ga0501045_0141218 Ga0501045_0141218_291_1163 270
146 3300049824 Ga0501045_0287787 Ga0501045_0287787_49_918 270
147 3300026089 Ga0207648_10341301 Ga0207648_103413011 271
148 3300031548 Ga0307408_100480307 Ga0307408_1004803071 271
149 3300031665 Ga0316575_10012111 Ga0316575_100121114 272
150 3300035398 Ga0316574_0006010 Ga0316574_0006010_4696_5574 272
151 iso_pu_bacteria 2643221683 2644464696 272
152 iso_pu_bacteria 2894023352 2894025425 272
153 iso_pu_bacteria 2939631187 2939631620 272
154 3300005340 Ga0070689_100408946 Ga0070689_1004089461 274
155 3300005614 Ga0068856_100207126 Ga0068856_1002071262 274
156 3300006871 Ga0075434_100000132 Ga0075434_1000001328 274
157 3300006914 Ga0075436_100000638 Ga0075436_1000006388 274
158 3300007076 Ga0075435_100006450 Ga0075435_1000064505 274
159 3300025936 Ga0207670_10298341 Ga0207670_102983411 274
160 3300026078 Ga0207702_10067270 Ga0207702_100672703 274
161 3300050512 nmdc:mga0n895_119372_c1 nmdc:mga0n895_119372_c1_1533_2405 274
162 3300050514 nmdc:mga08x19_2618_c1 nmdc:mga08x19_2618_c1_5250_6116 274
163 3300005329 Ga0070683_100172191 Ga0070683_1001721912 275
164 3300005330 Ga0070690_100012906 Ga0070690_1000129064 275
165 3300005535 Ga0070684_100008489 Ga0070684_1000084894 275
166 3300005544 Ga0070686_100015769 Ga0070686_1000157694 275
167 3300006237 Ga0097621_100056051 Ga0097621_1000560512 275
168 3300014969 Ga0157376_10309622 Ga0157376_103096223 275
169 3300025920 Ga0207649_10336047 Ga0207649_103360472 275
170 3300031548 Ga0307408_100636496 Ga0307408_1006364961 275
171 3300035241 Ga0373961_0007225 Ga0373961_0007225_393_1262 275
172 3300037466 Ga0395898_0195925 Ga0395898_0195925_781_1650 275
173 3300037471 Ga0395905_0031794 Ga0395905_0031794_3599_4468 275
174 3300049579 Ga0501043_0000149 Ga0501043_0000149_22966_23835 275
175 3300049580 Ga0501046_0000092 Ga0501046_0000092_41424_42293 275
176 3300049580 Ga0501046_0180611 Ga0501046_0180611_294_1175 275
177 3300049581 Ga0501047_0000028 Ga0501047_0000028_196619_197488 275
178 3300049582 Ga0501048_0000097 Ga0501048_0000097_22360_23229 275
179 3300049591 Ga0501075_0277442 Ga0501075_0277442_137_1018 275
180 3300049741 Ga0501079_0165691 Ga0501079_0165691_406_1287 275
181 3300049824 Ga0501045_0002894 Ga0501045_0002894_4767_5636 275
182 3300003792 Ga0055540_1003690 Ga0055540_10036905 276
183 3300003794 Ga0055531_10001403 Ga0055531_1000140315 276
184 3300005295 Ga0065707_10012400 Ga0065707_100124003 276
185 3300005330 Ga0070690_100005969 Ga0070690_1000059694 276
186 3300005333 Ga0070677_10002411 Ga0070677_100024114 276
187 3300005334 Ga0068869_100004332 Ga0068869_1000043324 276
188 3300005335 Ga0070666_10004949 Ga0070666_100049492 276
189 3300005338 Ga0068868_100275721 Ga0068868_1002757212 276
190 3300005343 Ga0070687_100011217 Ga0070687_1000112172 276
191 3300005345 Ga0070692_10029742 Ga0070692_100297422 276
192 3300005347 Ga0070668_100127885 Ga0070668_1001278852 276
193 3300005353 Ga0070669_100040122 Ga0070669_1000401224 276
194 3300005354 Ga0070675_100041325 Ga0070675_1000413253 276
195 3300005354 Ga0070675_100042071 Ga0070675_1000420711 276
196 3300005364 Ga0070673_100498748 Ga0070673_1004987481 276
197 3300005440 Ga0070705_100294082 Ga0070705_1002940821 276
198 3300005444 Ga0070694_100005593 Ga0070694_1000055935 276
199 3300005444 Ga0070694_100007232 Ga0070694_1000072324 276
200 3300005456 Ga0070678_100036514 Ga0070678_1000365143 276
201 3300005457 Ga0070662_100020143 Ga0070662_1000201432 276
202 3300005459 Ga0068867_100006301 Ga0068867_1000063016 276
203 3300005467 Ga0070706_100000058 Ga0070706_10000005837 276
204 3300005467 Ga0070706_100309739 Ga0070706_1003097392 276
205 3300005468 Ga0070707_100008515 Ga0070707_1000085152 276
206 3300005468 Ga0070707_100260560 Ga0070707_1002605602 276
207 3300005471 Ga0070698_100130194 Ga0070698_1001301943 276
208 3300005518 Ga0070699_100543453 Ga0070699_1005434531 276
209 3300005536 Ga0070697_100002460 Ga0070697_1000024609 276
210 3300005536 Ga0070697_100004865 Ga0070697_1000048655 276
211 3300005543 Ga0070672_100004725 Ga0070672_1000047255 276
212 3300005546 Ga0070696_100028084 Ga0070696_1000280842 276
213 3300005548 Ga0070665_100490428 Ga0070665_1004904282 276
214 3300005616 Ga0068852_100012855 Ga0068852_1000128555 276
215 3300005617 Ga0068859_100007812 Ga0068859_1000078124 276
216 3300005618 Ga0068864_100067142 Ga0068864_1000671423 276
217 3300005719 Ga0068861_100006046 Ga0068861_1000060463 276
218 3300005841 Ga0068863_100009149 Ga0068863_1000091496 276
219 3300005842 Ga0068858_100006541 Ga0068858_1000065414 276
220 3300005843 Ga0068860_100000445 Ga0068860_10000044542 276
221 3300006038 Ga0075365_10017503 Ga0075365_100175034 276
222 3300006353 Ga0075370_10160572 Ga0075370_101605722 276
223 3300006358 Ga0068871_100247200 Ga0068871_1002472001 276
224 3300006844 Ga0075428_100198957 Ga0075428_1001989572 276
225 3300006846 Ga0075430_100000520 Ga0075430_10000052030 276
226 3300006846 Ga0075430_100100659 Ga0075430_1001006592 276
227 3300006847 Ga0075431_100009047 Ga0075431_1000090473 276
228 3300006880 Ga0075429_100000638 Ga0075429_10000063820 276
229 3300006880 Ga0075429_100141972 Ga0075429_1001419722 276
230 3300006881 Ga0068865_100002093 Ga0068865_1000020934 276
231 3300006931 Ga0097620_100007812 Ga0097620_1000078124 276
232 3300007265 Ga0099794_10119064 Ga0099794_101190642 276
233 3300009094 Ga0111539_10107535 Ga0111539_101075353 276
234 3300009147 Ga0114129_10007443 Ga0114129_100074438 276
235 3300009148 Ga0105243_10021971 Ga0105243_100219714 276
236 3300009177 Ga0105248_10075724 Ga0105248_100757244 276
237 3300013296 Ga0157374_10021499 Ga0157374_100214994 276
238 3300013306 Ga0163162_10054073 Ga0163162_100540733 276
239 3300013308 Ga0157375_10012725 Ga0157375_100127254 276
240 3300014326 Ga0157380_10015790 Ga0157380_100157904 276
241 3300014968 Ga0157379_10045614 Ga0157379_100456144 276
242 3300017792 Ga0163161_10020823 Ga0163161_100208233 276
243 3300025273 Ga0209673_1025384 Ga0209673_10253842 276
244 3300025303 Ga0209051_1000025 Ga0209051_1000025334 276
245 3300025304 Ga0209257_1000039 Ga0209257_1000039274 276
246 3300025315 Ga0207697_10015533 Ga0207697_100155333 276
247 3300025893 Ga0207682_10008973 Ga0207682_100089733 276
248 3300025899 Ga0207642_10002491 Ga0207642_100024915 276
249 3300025903 Ga0207680_10005090 Ga0207680_100050904 276
250 3300025907 Ga0207645_10004582 Ga0207645_100045828 276
251 3300025910 Ga0207684_10000066 Ga0207684_1000006683 276
252 3300025917 Ga0207660_10064740 Ga0207660_100647403 276
253 3300025918 Ga0207662_10001475 Ga0207662_100014754 276
254 3300025922 Ga0207646_10034329 Ga0207646_100343294 276
255 3300025923 Ga0207681_10008531 Ga0207681_100085311 276
256 3300025926 Ga0207659_10524779 Ga0207659_105247791 276
257 3300025932 Ga0207690_10260514 Ga0207690_102605142 276
258 3300025933 Ga0207706_10009798 Ga0207706_100097988 276
259 3300025934 Ga0207686_10013074 Ga0207686_100130741 276
260 3300025937 Ga0207669_10019212 Ga0207669_100192123 276
261 3300025937 Ga0207669_10354698 Ga0207669_103546981 276
262 3300025940 Ga0207691_10010762 Ga0207691_100107624 276
263 3300025941 Ga0207711_10044194 Ga0207711_100441944 276
264 3300025942 Ga0207689_10004853 Ga0207689_100048534 276
265 3300025960 Ga0207651_10055288 Ga0207651_100552881 276
266 3300025961 Ga0207712_10011898 Ga0207712_100118983 276
267 3300025986 Ga0207658_10003494 Ga0207658_100034948 276
268 3300026023 Ga0207677_10024617 Ga0207677_100246172 276
269 3300026035 Ga0207703_10001799 Ga0207703_1000179910 276
270 3300026088 Ga0207641_10015255 Ga0207641_100152553 276
271 3300026089 Ga0207648_10004667 Ga0207648_1000466710 276
272 3300026095 Ga0207676_10052933 Ga0207676_100529333 276
273 3300026118 Ga0207675_100007314 Ga0207675_1000073144 276
274 3300026121 Ga0207683_10054461 Ga0207683_100544613 276
275 3300026142 Ga0207698_10048625 Ga0207698_100486251 276
276 3300027360 Ga0209969_1000217 Ga0209969_10002173 276
277 3300027364 Ga0209967_1000307 Ga0209967_10003075 276
278 3300027462 Ga0210000_1012256 Ga0210000_10122562 276
279 3300027471 Ga0209995_1002322 Ga0209995_10023222 276
280 3300027526 Ga0209968_1001103 Ga0209968_10011033 276
281 3300027543 Ga0209999_1000946 Ga0209999_10009464 276
282 3300027614 Ga0209970_1006569 Ga0209970_10065692 276
283 3300027876 Ga0209974_10021832 Ga0209974_100218322 276
284 3300028379 Ga0268266_10376782 Ga0268266_103767822 276
285 3300028380 Ga0268265_10004016 Ga0268265_100040164 276
286 3300031548 Ga0307408_100048450 Ga0307408_1000484503 276
287 3300031616 Ga0307508_10011978 Ga0307508_100119783 276
288 3300031731 Ga0307405_10003735 Ga0307405_100037353 276
289 3300031824 Ga0307413_10026207 Ga0307413_100262073 276
290 3300031852 Ga0307410_10013767 Ga0307410_100137671 276
291 3300031901 Ga0307406_10005448 Ga0307406_100054484 276
292 3300031903 Ga0307407_10002451 Ga0307407_100024513 276
293 3300031911 Ga0307412_10009014 Ga0307412_100090144 276
294 3300031995 Ga0307409_100022174 Ga0307409_1000221743 276
295 3300032002 Ga0307416_100001584 Ga0307416_10000158411 276
296 3300032004 Ga0307414_10031261 Ga0307414_100312613 276
297 3300032005 Ga0307411_10002419 Ga0307411_100024193 276
298 3300032126 Ga0307415_100011692 Ga0307415_1000116922 276
299 3300035692 Ga0373935_0016858 Ga0373935_0016858_2544_3446 276
300 3300042461 Ga0439460_0002968 Ga0439460_0002968_2644_3516 276
301 3300044712 Ga0453684_0725883 Ga0453684_0725883_154_1026 276
302 3300046543 Ga0495645_0096540 Ga0495645_0096540_1159_2031 276
303 3300046681 Ga0495647_0039613 Ga0495647_0039613_486_1358 276
304 3300049576 Ga0501040_0007117 Ga0501040_0007117_3326_4207 276
305 3300049581 Ga0501047_0024991 Ga0501047_0024991_2415_3287 276
306 3300049581 Ga0501047_0144475 Ga0501047_0144475_1057_1929 276
307 3300049743 Ga0501081_0028611 Ga0501081_0028611_404_1285 276
308 3300050496 nmdc:mga07m45_82549_c1 nmdc:mga07m45_82549_c1_17_889 276
309 3300050507 nmdc:mga05p37_980_c1 nmdc:mga05p37_980_c1_22019_22891 276
310 3300050508 nmdc:mga09592_947_c1 nmdc:mga09592_947_c1_6681_7553 276
311 3300050509 nmdc:mga0qj67_705_c1 nmdc:mga0qj67_705_c1_19955_20827 276
312 3300050510 nmdc:mga06r32_2106_c1 nmdc:mga06r32_2106_c1_9921_10793 276
313 3300050510 nmdc:mga06r32_48707_c1 nmdc:mga06r32_48707_c1_385_1257 276
314 3300050510 nmdc:mga06r32_85802_c1 nmdc:mga06r32_85802_c1_403_1275 276
315 3300053094 Ga0500566_0021347 Ga0500566_0021347_1074_1946 276
316 3300053178 Ga0500637_0141979 Ga0500637_0141979_35_907 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

7

277

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5624 5 263
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.5493 10 261
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5355 3 265
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5342 5 263
5b58-assembly1.cif.gz_B inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.5308 6 261
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8245 8 259 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7981 8 262 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.757 8 259 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7476 11 258 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7408 8 262 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A519H964-F1-model_v4 deleted 0.9471 1 160
AF-A0A519H964-F1-model_v4 deleted 0.9415 1 160
AF-A0A2H0L040-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9063 2 270 GO:0005886
GO:0006865
GO:0022857
AF-A0A521YNU4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9017 2 267 GO:0005886
GO:0006865
GO:0022857
AF-A0A1Q5S4X3-F1-model_v4 ABC transporter permease 0.8983 1 276 GO:0005886
GO:0006865
GO:0022857

Feature Viewer

pLDDT pTM Quality
71.32 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map